F293014

General Info

Members Datasets Scaffolds Average Seq Length
190 134 190 267

Family's Representative Sequence

Representative Sequence 3300046543|Ga0495645_0011576|Ga0495645_0011576_2741_3730
Length 307
Sequence MADQPKAADDPADRRAELLARRERQRRGVRHRRLLAAGALVLGVGAIXAAVALLSGGSGRNSTSFGPVRNATPQPDWRPHTGPVPVLEYHVLGEAPSDAPYPELYVARPDFRHQLEWLDGHGYQAVTLEQVEEAWYHGGTLPAKPIVLSFDDGYRPQFTFALPQLRKHGWAGLLNLKAEGSDLYESNVKAMIDAGWELAAHTIHHLDLTELGPEQLEEEVAGSRAILRREYGVPVKDFCYPAGQFDGTVIAAVEAAGYSGATTEIPGYAGRDHPYELARFEILGSTGVSGLAEDLRSGEGETGAVGP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
54 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
55 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
56 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
57 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
58 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
59 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
60 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
61 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
62 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
65 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
66 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
67 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
68 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
69 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
70 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
71 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
72 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
73 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
74 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
75 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
76 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
79 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
80 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
81 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
84 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
85 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
86 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
92 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
93 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
94 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
95 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
96 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
97 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
98 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
99 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
100 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
123 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
124 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
129 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
130 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
133 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
134 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.05
Nodule 0
Rhizoplane 7.89
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005027 3300001979 Bacteria 5615
2 JGI25404J52841_10003613 3300003659 Bacteria 3071
3 Ga0070683_100098400 3300005329 Bacteria 2753
4 Ga0070683_100187879 3300005329 Bacteria 1961
5 Ga0070668_100213330 3300005347 Bacteria 1589
6 Ga0070688_100000373 3300005365 Bacteria 22710
7 Ga0070667_100001908 3300005367 Bacteria 18496
8 Ga0070711_100000944 3300005439 Bacteria 15375
9 Ga0070663_100007372 3300005455 Bacteria 6691
10 Ga0070663_100297720 3300005455 Unclassified 1290
11 Ga0068867_100000226 3300005459 Bacteria 36850
12 Ga0068867_100179074 3300005459 Bacteria 1684
13 Ga0070685_10000665 3300005466 Bacteria 18706
14 Ga0070679_100014593 3300005530 Bacteria 7548
15 Ga0070684_100040329 3300005535 Bacteria 4020
16 Ga0070684_100355512 3300005535 Unclassified 1348
17 Ga0068853_100028681 3300005539 Bacteria 4684
18 Ga0070665_100000135 3300005548 Bacteria 138925
19 Ga0070665_100099289 3300005548 Bacteria 2915
20 Ga0068856_100000336 3300005614 Bacteria 51580
21 Ga0068856_100255915 3300005614 Bacteria 1766
22 Ga0068851_10001239 3300005834 Bacteria 11087
23 Ga0068863_100000022 3300005841 Bacteria 188278
24 Ga0068863_100003052 3300005841 Bacteria 16547
25 Ga0068858_100000142 3300005842 Bacteria 75787
26 Ga0068858_100034515 3300005842 Bacteria 4693
27 Ga0068860_100008818 3300005843 Bacteria 10047
28 Ga0068862_100014002 3300005844 Bacteria 6651
29 Ga0081540_1000041 3300005983 Bacteria 136874
30 Ga0070715_10000021 3300006163 Bacteria 119283
31 Ga0105247_10000278 3300009101 Bacteria 47180
32 Ga0105242_10001792 3300009176 Bacteria 16941
33 Ga0105242_10081816 3300009176 Bacteria 2701
34 Ga0105238_10000055 3300009551 Bacteria 139232
35 Ga0105249_10044128 3300009553 Bacteria 4055
36 Ga0105249_10278519 3300009553 Bacteria 1669
37 Ga0157370_10050111 3300013104 Bacteria 3993
38 Ga0163162_10202696 3300013306 Bacteria 2113
39 Ga0157375_10000349 3300013308 Bacteria 41764
40 Ga0157379_10058043 3300014968 Bacteria 3459
41 Ga0163161_10000053 3300017792 Bacteria 117408
42 Ga0207656_10000701 3300025321 Bacteria 10978
43 Ga0207710_10000695 3300025900 Bacteria 18840
44 Ga0207685_10000028 3300025905 Bacteria 97935
45 Ga0207649_10000189 3300025920 Bacteria 50504
46 Ga0207652_10007942 3300025921 Bacteria 8516
47 Ga0207694_10000063 3300025924 Bacteria 139700
48 Ga0207687_10000032 3300025927 Bacteria 143196
49 Ga0207686_10000073 3300025934 Bacteria 92009
50 Ga0207686_10002485 3300025934 Bacteria 10010
51 Ga0207661_10073807 3300025944 Bacteria 2795
52 Ga0207661_10275150 3300025944 Bacteria 1503
53 Ga0207651_10000807 3300025960 Bacteria 13511
54 Ga0207712_10004957 3300025961 Bacteria 8418
55 Ga0207640_10000134 3300025981 Bacteria 54961
56 Ga0207640_10003392 3300025981 Bacteria 8582
57 Ga0207658_10003595 3300025986 Bacteria 10959
58 Ga0207658_10024597 3300025986 Bacteria 4214
59 Ga0207703_10001891 3300026035 Bacteria 18577
60 Ga0207703_10049631 3300026035 Bacteria 3393
61 Ga0207678_10015803 3300026067 Bacteria 6636
62 Ga0207678_10336869 3300026067 Unclassified 1299
63 Ga0207702_10000368 3300026078 Bacteria 51559
64 Ga0207702_10188962 3300026078 Bacteria 1902
65 Ga0207641_10000016 3300026088 Bacteria 307363
66 Ga0207641_10002193 3300026088 Bacteria 18362
67 Ga0207648_10000907 3300026089 Bacteria 33370
68 Ga0268266_10000056 3300028379 Bacteria 289176
69 Ga0268266_10075815 3300028379 Bacteria 2921
70 Ga0268266_10088432 3300028379 Bacteria 2711
71 Ga0268266_10119974 3300028379 Bacteria 2339
72 Ga0268265_10002439 3300028380 Bacteria 14024
73 Ga0268264_10010770 3300028381 Bacteria 7555
74 Ga0265338_10000507 3300028800 Bacteria 69026
75 Ga0466963_0069495 3300044694 Bacteria 2367
76 Ga0466960_0072215 3300044901 Bacteria 1720
77 Ga0466967_0000001 3300045976 Bacteria 229823
78 Ga0466967_0559627 3300045976 Bacteria 1126
79 Ga0495592_0154014 3300046454 Bacteria 1587
80 Ga0495603_0002286 3300046455 Bacteria 11264
81 Ga0495629_0010879 3300046459 Bacteria 6615
82 Ga0495629_0037460 3300046459 Bacteria 3418
83 Ga0495629_0131405 3300046459 Bacteria 1744
84 Ga0495641_0000027 3300046461 Bacteria 100420
85 Ga0495651_0149368 3300046462 Bacteria 1686
86 Ga0495653_0048925 3300046463 Bacteria 3260
87 Ga0495594_0000011 3300046499 Bacteria 118444
88 Ga0495608_0000007 3300046511 Bacteria 313495
89 Ga0495628_0009218 3300046516 Bacteria 8434
90 Ga0495628_0022401 3300046516 Bacteria 5189
91 Ga0495628_0105693 3300046516 Bacteria 2169
92 Ga0495630_0000454 3300046517 Bacteria 31035
93 Ga0495652_0000037 3300046529 Bacteria 133232
94 Ga0495652_0045664 3300046529 Bacteria 3764
95 Ga0495587_0021346 3300046536 Bacteria 3992
96 Ga0495645_0011576 3300046543 Bacteria 6212
97 Ga0495622_0000021 3300046557 Bacteria 162267
98 Ga0495667_0131351 3300046559 Bacteria 1615
99 Ga0495668_0026298 3300046616 Bacteria 3303
100 Ga0495634_0000031 3300046642 Bacteria 110396
101 Ga0495634_0002062 3300046642 Bacteria 16995
102 Ga0495634_0084593 3300046642 Bacteria 2068
103 Ga0495635_0000086 3300046663 Bacteria 55020
104 Ga0495657_0000001 3300046675 Bacteria 445641
105 Ga0495657_0002416 3300046675 Bacteria 15729
106 Ga0495599_0120012 3300046678 Bacteria 1635
107 Ga0495599_0140268 3300046678 Bacteria 1499
108 Ga0495647_0000001 3300046681 Bacteria 222371
109 Ga0495647_0015854 3300046681 Bacteria 2645
110 Ga0495647_0117139 3300046681 Bacteria 1117
111 Ga0495624_0000594 3300046690 Bacteria 28184
112 Ga0495649_0000585 3300046694 Bacteria 30585
113 Ga0495604_0000050 3300047317 Bacteria 108094
114 Ga0495676_0024326 3300047321 Bacteria 5246
115 Ga0495680_0000212 3300047322 Bacteria 63418
116 Ga0495680_0004041 3300047322 Bacteria 14142
117 Ga0495675_0000453 3300047444 Bacteria 27185
118 Ga0495685_003922 3300047447 Bacteria 4775
119 Ga0495684_0122118 3300047471 Bacteria 1961
120 Ga0495602_0005656 3300048088 Bacteria 13105
121 Ga0495602_0178238 3300048088 Bacteria 1642
122 Ga0496102_0293085 3300048905 Bacteria 1534
123 Ga0496103_0000174 3300048906 Bacteria 67124
124 Ga0496104_0000015 3300048907 Bacteria 374530
125 Ga0496105_0000004 3300048908 Bacteria 475798
126 Ga0496108_0000006 3300048911 Bacteria 469473
127 Ga0496108_0000137 3300048911 Bacteria 70783
128 Ga0496109_0000009 3300048912 Bacteria 236561
129 Ga0496109_0000088 3300048912 Bacteria 94877
130 Ga0496109_0391523 3300048912 Bacteria 1313
131 Ga0496111_0000316 3300048914 Bacteria 23885
132 Ga0496112_0000025 3300048915 Bacteria 146197
133 Ga0496113_0000027 3300048916 Bacteria 63463
134 Ga0496115_0000011 3300048918 Bacteria 222529
135 Ga0496115_0000162 3300048918 Bacteria 62522
136 Ga0496115_0072093 3300048918 Bacteria 2802
137 Ga0496117_0022586 3300048920 Bacteria 5042
138 Ga0496117_0189764 3300048920 Bacteria 1172
139 Ga0496118_0005822 3300048921 Bacteria 13815
140 Ga0496119_0013376 3300048922 Bacteria 6547
141 Ga0496119_0076715 3300048922 Bacteria 1938
142 Ga0496120_0079028 3300048923 Bacteria 1786
143 Ga0496121_0042711 3300048924 Bacteria 3938
144 Ga0496121_0123689 3300048924 Bacteria 1949
145 Ga0501032_0002323 3300049569 Bacteria 14908
146 Ga0501033_0001255 3300049570 Bacteria 22735
147 Ga0501034_0096542 3300049571 Bacteria 2951
148 Ga0501036_0004619 3300049572 Bacteria 11128
149 Ga0501037_0002105 3300049573 Bacteria 14423
150 Ga0501038_0003549 3300049574 Bacteria 14517
151 Ga0501039_0017629 3300049575 Bacteria 5477
152 Ga0501040_0015392 3300049576 Bacteria 5058
153 Ga0501042_0054800 3300049578 Bacteria 2844
154 Ga0501043_0002925 3300049579 Bacteria 14258
155 Ga0501046_0003552 3300049580 Bacteria 14279
156 Ga0501047_0002361 3300049581 Bacteria 18047
157 Ga0501047_0009486 3300049581 Bacteria 9197
158 Ga0501047_0128386 3300049581 Bacteria 2415
159 Ga0501047_0162060 3300049581 Bacteria 2108
160 Ga0501047_0396938 3300049581 Bacteria 1212
161 Ga0501048_0002577 3300049582 Bacteria 13867
162 Ga0501048_0262316 3300049582 Bacteria 1227
163 Ga0501067_0023630 3300049583 Bacteria 3407
164 Ga0501068_0009293 3300049584 Bacteria 5496
165 Ga0501069_0003034 3300049585 Bacteria 8625
166 Ga0501070_0000832 3300049586 Bacteria 28030
167 Ga0501070_0073384 3300049586 Bacteria 2831
168 Ga0501071_0027276 3300049587 Bacteria 4018
169 Ga0501072_0150783 3300049588 Bacteria 1853
170 Ga0501073_0011740 3300049589 Bacteria 6397
171 Ga0501079_0044849 3300049741 Bacteria 3412
172 Ga0501079_0070851 3300049741 Bacteria 2692
173 Ga0501080_0007024 3300049742 Bacteria 10165
174 Ga0501083_0002406 3300049744 Bacteria 12801
175 Ga0501083_0022893 3300049744 Bacteria 4336
176 Ga0501035_0004128 3300049822 Bacteria 13802
177 Ga0501044_0000684 3300049823 Bacteria 40967
178 Ga0501044_0179416 3300049823 Bacteria 2085
179 Ga0501045_0113790 3300049824 Bacteria 2007
180 Ga0495601_0001240 3300053077 Bacteria 13996
181 Ga0495601_0013268 3300053077 Bacteria 4953
182 Ga0495612_0001034 3300053078 Bacteria 11410
183 Ga0495595_0000002 3300053084 Bacteria 445641
184 Ga0495595_0000178 3300053084 Bacteria 25404
185 Ga0495619_0000010 3300053085 Bacteria 302390
186 Ga0495619_0000276 3300053085 Bacteria 36931
187 Ga0495619_0000485 3300053085 Bacteria 26622
188 Ga0500641_0006156 3300053096 Bacteria 4253
189 Ga0500614_000150 3300053123 Bacteria 17505
190 Ga0501082_0039863 3300060353 Bacteria 4052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0000037 Ga0495652_0000037_123812_124786 236
2 3300048906 Ga0496103_0000174 Ga0496103_0000174_8496_9482 236
3 3300048924 Ga0496121_0042711 Ga0496121_0042711_83_1114 237
4 3300005365 Ga0070688_100000373 Ga0070688_10000037323 238
5 3300005466 Ga0070685_10000665 Ga0070685_1000066512 238
6 3300045976 Ga0466967_0000001 Ga0466967_0000001_9423_10376 238
7 3300046536 Ga0495587_0021346 Ga0495587_0021346_2932_3903 238
8 3300049569 Ga0501032_0002323 Ga0501032_0002323_4331_5323 238
9 3300049570 Ga0501033_0001255 Ga0501033_0001255_17387_18379 238
10 3300049571 Ga0501034_0096542 Ga0501034_0096542_325_1317 238
11 3300049572 Ga0501036_0004619 Ga0501036_0004619_5779_6771 238
12 3300049573 Ga0501037_0002105 Ga0501037_0002105_4368_5360 238
13 3300049574 Ga0501038_0003549 Ga0501038_0003549_4269_5261 238
14 3300049575 Ga0501039_0017629 Ga0501039_0017629_211_1203 238
15 3300049576 Ga0501040_0015392 Ga0501040_0015392_109_1101 238
16 3300049578 Ga0501042_0054800 Ga0501042_0054800_194_1186 238
17 3300049579 Ga0501043_0002925 Ga0501043_0002925_4290_5282 238
18 3300049580 Ga0501046_0003552 Ga0501046_0003552_8977_9969 238
19 3300049581 Ga0501047_0002361 Ga0501047_0002361_7950_8942 238
20 3300049582 Ga0501048_0002577 Ga0501048_0002577_8551_9543 238
21 3300049583 Ga0501067_0023630 Ga0501067_0023630_1215_2207 238
22 3300049584 Ga0501068_0009293 Ga0501068_0009293_3255_4247 238
23 3300049585 Ga0501069_0003034 Ga0501069_0003034_6310_7302 238
24 3300049586 Ga0501070_0000832 Ga0501070_0000832_16275_17267 238
25 3300049588 Ga0501072_0150783 Ga0501072_0150783_131_1123 238
26 3300049589 Ga0501073_0011740 Ga0501073_0011740_4400_5392 238
27 3300049741 Ga0501079_0044849 Ga0501079_0044849_1332_2324 238
28 3300049742 Ga0501080_0007024 Ga0501080_0007024_4312_5304 238
29 3300049744 Ga0501083_0002406 Ga0501083_0002406_8314_9306 238
30 3300049822 Ga0501035_0004128 Ga0501035_0004128_4334_5326 238
31 3300049823 Ga0501044_0000684 Ga0501044_0000684_30479_31471 238
32 3300049824 Ga0501045_0113790 Ga0501045_0113790_264_1256 238
33 3300060353 Ga0501082_0039863 Ga0501082_0039863_1223_2215 238
34 3300003659 JGI25404J52841_10003613 JGI25404J52841_100036134 239
35 3300005983 Ga0081540_1000041 Ga0081540_100004195 239
36 3300005834 Ga0068851_10001239 Ga0068851_100012394 240
37 3300009101 Ga0105247_10000278 Ga0105247_1000027813 240
38 3300025321 Ga0207656_10000701 Ga0207656_100007014 240
39 3300025900 Ga0207710_10000695 Ga0207710_100006957 240
40 3300005843 Ga0068860_100008818 Ga0068860_1000088182 241
41 3300028381 Ga0268264_10010770 Ga0268264_100107702 241
42 3300046511 Ga0495608_0000007 Ga0495608_0000007_11238_12173 241
43 3300046616 Ga0495668_0026298 Ga0495668_0026298_276_1214 241
44 3300046675 Ga0495657_0000001 Ga0495657_0000001_143384_144319 241
45 3300047317 Ga0495604_0000050 Ga0495604_0000050_94621_95556 241
46 3300047444 Ga0495675_0000453 Ga0495675_0000453_43_978 241
47 3300053084 Ga0495595_0000002 Ga0495595_0000002_301323_302258 241
48 3300053085 Ga0495619_0000276 Ga0495619_0000276_26192_27127 241
49 3300005539 Ga0068853_100028681 Ga0068853_1000286815 242
50 3300005614 Ga0068856_100255915 Ga0068856_1002559152 242
51 3300025981 Ga0207640_10000134 Ga0207640_1000013453 242
52 3300026078 Ga0207702_10188962 Ga0207702_101889622 242
53 3300028379 Ga0268266_10119974 Ga0268266_101199742 242
54 3300046516 Ga0495628_0009218 Ga0495628_0009218_3999_4943 242
55 3300048920 Ga0496117_0022586 Ga0496117_0022586_897_1928 242
56 3300048921 Ga0496118_0005822 Ga0496118_0005822_4282_5313 242
57 3300048922 Ga0496119_0076715 Ga0496119_0076715_447_1478 242
58 3300005329 Ga0070683_100098400 Ga0070683_1000984002 243
59 3300005329 Ga0070683_100187879 Ga0070683_1001878792 243
60 3300005439 Ga0070711_100000944 Ga0070711_10000094413 243
61 3300005455 Ga0070663_100007372 Ga0070663_1000073728 243
62 3300005455 Ga0070663_100297720 Ga0070663_1002977202 243
63 3300005459 Ga0068867_100000226 Ga0068867_10000022637 243
64 3300005530 Ga0070679_100014593 Ga0070679_10001459310 243
65 3300005535 Ga0070684_100040329 Ga0070684_1000403292 243
66 3300005535 Ga0070684_100355512 Ga0070684_1003555121 243
67 3300005841 Ga0068863_100003052 Ga0068863_10000305210 243
68 3300005842 Ga0068858_100034515 Ga0068858_1000345152 243
69 3300009553 Ga0105249_10278519 Ga0105249_102785192 243
70 3300013104 Ga0157370_10050111 Ga0157370_100501115 243
71 3300013306 Ga0163162_10202696 Ga0163162_102026962 243
72 3300013308 Ga0157375_10000349 Ga0157375_1000034912 243
73 3300025921 Ga0207652_10007942 Ga0207652_100079421 243
74 3300025944 Ga0207661_10073807 Ga0207661_100738073 243
75 3300025944 Ga0207661_10275150 Ga0207661_102751501 243
76 3300026067 Ga0207678_10015803 Ga0207678_100158038 243
77 3300026067 Ga0207678_10336869 Ga0207678_103368692 243
78 3300026088 Ga0207641_10002193 Ga0207641_1000219310 243
79 3300026089 Ga0207648_10000907 Ga0207648_1000090735 243
80 3300046499 Ga0495594_0000011 Ga0495594_0000011_83560_84537 243
81 3300046516 Ga0495628_0022401 Ga0495628_0022401_1795_2718 243
82 3300046516 Ga0495628_0105693 Ga0495628_0105693_930_1847 243
83 3300046557 Ga0495622_0000021 Ga0495622_0000021_153961_154938 243
84 3300046559 Ga0495667_0131351 Ga0495667_0131351_660_1568 243
85 3300046642 Ga0495634_0000031 Ga0495634_0000031_100743_101624 243
86 3300046678 Ga0495599_0140268 Ga0495599_0140268_234_1211 243
87 3300046681 Ga0495647_0000001 Ga0495647_0000001_209136_210089 243
88 3300046694 Ga0495649_0000585 Ga0495649_0000585_9735_10610 243
89 3300047321 Ga0495676_0024326 Ga0495676_0024326_684_1649 243
90 3300048911 Ga0496108_0000006 Ga0496108_0000006_243031_243879 243
91 3300048912 Ga0496109_0000009 Ga0496109_0000009_10119_10967 243
92 3300048914 Ga0496111_0000316 Ga0496111_0000316_895_1839 243
93 3300048916 Ga0496113_0000027 Ga0496113_0000027_52761_53705 243
94 3300048920 Ga0496117_0189764 Ga0496117_0189764_139_1110 243
95 3300053077 Ga0495601_0001240 Ga0495601_0001240_4525_5385 243
96 3300053084 Ga0495595_0000178 Ga0495595_0000178_18409_19359 243
97 3300053085 Ga0495619_0000010 Ga0495619_0000010_9159_10064 243
98 3300053096 Ga0500641_0006156 Ga0500641_0006156_2606_3460 243
99 3300005548 Ga0070665_100000135 Ga0070665_100000135130 244
100 3300005614 Ga0068856_100000336 Ga0068856_10000033612 244
101 3300005842 Ga0068858_100000142 Ga0068858_10000014278 244
102 3300009551 Ga0105238_10000055 Ga0105238_10000055128 244
103 3300025924 Ga0207694_10000063 Ga0207694_1000006314 244
104 3300025934 Ga0207686_10000073 Ga0207686_10000073102 244
105 3300025981 Ga0207640_10003392 Ga0207640_100033926 244
106 3300025986 Ga0207658_10024597 Ga0207658_100245974 244
107 3300026035 Ga0207703_10001891 Ga0207703_1000189118 244
108 3300026078 Ga0207702_10000368 Ga0207702_1000036850 244
109 3300028379 Ga0268266_10000056 Ga0268266_10000056279 244
110 3300028379 Ga0268266_10075815 Ga0268266_100758153 244
111 3300044694 Ga0466963_0069495 Ga0466963_0069495_100_1068 244
112 3300045976 Ga0466967_0559627 Ga0466967_0559627_62_1030 244
113 3300046454 Ga0495592_0154014 Ga0495592_0154014_577_1515 244
114 3300046459 Ga0495629_0010879 Ga0495629_0010879_4909_5796 244
115 3300046459 Ga0495629_0037460 Ga0495629_0037460_1066_2031 244
116 3300046461 Ga0495641_0000027 Ga0495641_0000027_60885_61706 244
117 3300048088 Ga0495602_0178238 Ga0495602_0178238_525_1502 244
118 3300048911 Ga0496108_0000137 Ga0496108_0000137_10501_11454 244
119 3300048912 Ga0496109_0000088 Ga0496109_0000088_9302_10255 244
120 3300048912 Ga0496109_0391523 Ga0496109_0391523_165_1181 244
121 3300048918 Ga0496115_0072093 Ga0496115_0072093_1721_2677 244
122 3300048924 Ga0496121_0123689 Ga0496121_0123689_787_1815 244
123 3300049581 Ga0501047_0162060 Ga0501047_0162060_108_1100 244
124 3300049581 Ga0501047_0396938 Ga0501047_0396938_42_944 244
125 3300049582 Ga0501048_0262316 Ga0501048_0262316_251_1153 244
126 3300053078 Ga0495612_0001034 Ga0495612_0001034_5742_6551 244
127 3300053123 Ga0500614_000150 Ga0500614_000150_10204_11025 244
128 3300005459 Ga0068867_100179074 Ga0068867_1001790742 245
129 3300005841 Ga0068863_100000022 Ga0068863_100000022173 245
130 3300006163 Ga0070715_10000021 Ga0070715_10000021112 245
131 3300009176 Ga0105242_10081816 Ga0105242_100818162 245
132 3300017792 Ga0163161_10000053 Ga0163161_1000005315 245
133 3300025905 Ga0207685_10000028 Ga0207685_1000002813 245
134 3300025960 Ga0207651_10000807 Ga0207651_100008077 245
135 3300026088 Ga0207641_10000016 Ga0207641_10000016295 245
136 3300044901 Ga0466960_0072215 Ga0466960_0072215_579_1514 245
137 3300046455 Ga0495603_0002286 Ga0495603_0002286_3304_4245 245
138 3300046462 Ga0495651_0149368 Ga0495651_0149368_181_1125 245
139 3300046463 Ga0495653_0048925 Ga0495653_0048925_421_1365 245
140 3300046517 Ga0495630_0000454 Ga0495630_0000454_19672_20628 245
141 3300046642 Ga0495634_0002062 Ga0495634_0002062_2104_3045 245
142 3300046642 Ga0495634_0084593 Ga0495634_0084593_1054_1998 245
143 3300046663 Ga0495635_0000086 Ga0495635_0000086_11448_12392 245
144 3300046675 Ga0495657_0002416 Ga0495657_0002416_11432_12376 245
145 3300046681 Ga0495647_0015854 Ga0495647_0015854_846_1793 245
146 3300046681 Ga0495647_0117139 Ga0495647_0117139_60_878 245
147 3300046690 Ga0495624_0000594 Ga0495624_0000594_17210_18166 245
148 3300047322 Ga0495680_0000212 Ga0495680_0000212_11844_12788 245
149 3300047447 Ga0495685_003922 Ga0495685_003922_875_1822 245
150 3300047471 Ga0495684_0122118 Ga0495684_0122118_180_1136 245
151 3300048088 Ga0495602_0005656 Ga0495602_0005656_3789_4742 245
152 3300048915 Ga0496112_0000025 Ga0496112_0000025_14143_14961 245
153 3300048918 Ga0496115_0000011 Ga0496115_0000011_9007_9978 245
154 3300048918 Ga0496115_0000162 Ga0496115_0000162_49841_50800 245
155 3300053077 Ga0495601_0013268 Ga0495601_0013268_3937_4893 245
156 3300053085 Ga0495619_0000485 Ga0495619_0000485_15440_16414 245
157 3300001979 JGI24740J21852_10005027 JGI24740J21852_100050275 246
158 3300005347 Ga0070668_100213330 Ga0070668_1002133301 246
159 3300005367 Ga0070667_100001908 Ga0070667_10000190812 246
160 3300005548 Ga0070665_100099289 Ga0070665_1000992892 246
161 3300005844 Ga0068862_100014002 Ga0068862_1000140026 246
162 3300009176 Ga0105242_10001792 Ga0105242_1000179211 246
163 3300009553 Ga0105249_10044128 Ga0105249_100441282 246
164 3300014968 Ga0157379_10058043 Ga0157379_100580432 246
165 3300025920 Ga0207649_10000189 Ga0207649_1000018911 246
166 3300025927 Ga0207687_10000032 Ga0207687_10000032131 246
167 3300025934 Ga0207686_10002485 Ga0207686_100024857 246
168 3300025961 Ga0207712_10004957 Ga0207712_100049571 246
169 3300025986 Ga0207658_10003595 Ga0207658_100035953 246
170 3300026035 Ga0207703_10049631 Ga0207703_100496313 246
171 3300028379 Ga0268266_10088432 Ga0268266_100884322 246
172 3300028380 Ga0268265_10002439 Ga0268265_1000243912 246
173 3300028800 Ga0265338_10000507 Ga0265338_1000050763 246
174 3300046459 Ga0495629_0131405 Ga0495629_0131405_656_1594 246
175 3300046529 Ga0495652_0045664 Ga0495652_0045664_1683_2630 246
176 3300046543 Ga0495645_0011576 Ga0495645_0011576_2741_3730 246
177 3300046678 Ga0495599_0120012 Ga0495599_0120012_285_1232 246
178 3300047322 Ga0495680_0004041 Ga0495680_0004041_820_1770 246
179 3300048905 Ga0496102_0293085 Ga0496102_0293085_413_1234 246
180 3300048907 Ga0496104_0000015 Ga0496104_0000015_363390_364373 246
181 3300048908 Ga0496105_0000004 Ga0496105_0000004_111426_112409 246
182 3300048922 Ga0496119_0013376 Ga0496119_0013376_2951_3934 246
183 3300048923 Ga0496120_0079028 Ga0496120_0079028_690_1721 246
184 3300049581 Ga0501047_0009486 Ga0501047_0009486_594_1586 246
185 3300049581 Ga0501047_0128386 Ga0501047_0128386_269_1258 246
186 3300049586 Ga0501070_0073384 Ga0501070_0073384_370_1362 246
187 3300049587 Ga0501071_0027276 Ga0501071_0027276_1176_2165 246
188 3300049741 Ga0501079_0070851 Ga0501079_0070851_1028_2017 246
189 3300049744 Ga0501083_0022893 Ga0501083_0022893_2183_3172 246
190 3300049823 Ga0501044_0179416 Ga0501044_0179416_624_1613 246

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01522

Polysacc_deac_1

Polysaccharide deacetylase

138

261

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dq3-assembly2.cif.gz_B streptococcus pyogenes deacetylase ppld in complex with acetate 0.8786 27 241
5lgc-assembly1.cif.gz_A t48 deacetylase with substrate 0.8656 94 209
6go1-assembly2.cif.gz_B crystal structure of a bacillus anthracis peptidoglycan deacetylase 0.8507 30 242
7y51-assembly1.cif.gz_A-2 acetylxylan esterase from caldanaerobacter subterraneus subsp. tengcongensis tte0866 delta100 mutant 0.8419 93 205
4v33-assembly2.cif.gz_B crystal structure of the putative polysaccharide deacetylase ba0330 from bacillus anthracis 0.8392 30 241
ID Description Score Start End Superfamily
5lgcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8656 94 209 3.20.20.370
af_P31666_165_404_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8503 27 242 3.20.20.370
4v33B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8419 30 241 3.20.20.370
af_Q06702_109_291_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8374 94 212 3.20.20.370
af_O53444_35_232_3.20.20.370 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycoside hydrolase/deacetylase 0.8335 94 205 3.20.20.370
ID Description Score Start End GO Terms
AF-A0A537ZQG0-F1-model_v4 NodB homology domain-containing protein 0.9631 26 244 GO:0005975
GO:0016810
AF-A0A537ZNZ4-F1-model_v4 Polysaccharide deacetylase family protein 0.962 20 244 GO:0005975
GO:0016020
GO:0016810
AF-A0A538HVW4-F1-model_v4 NodB homology domain-containing protein 0.9536 30 244 GO:0005975
GO:0016810
AF-A0A1Q7UGW3-F1-model_v4 NodB homology domain-containing protein 0.9511 31 244 GO:0005975
GO:0016810
AF-H0E4Y3-F1-model_v4 Polysaccharide deacetylase 0.9462 31 244 GO:0005975
GO:0016810

Feature Viewer

pLDDT pTM Quality
88.16 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map