F292933

General Info

Members Datasets Scaffolds Average Seq Length
190 116 380 196

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0079321|Ga0466963_0079321_712_1386
Length 224
Sequence LQFTTARRRRVGDEERRAGSLVTVGRTGRVERVTKESSVLVEVDLDGTGRTEVATGVPFFDHMLDALGKHGALDLVVRASGDVEIDAHHTVEDVAIVLGQALKQALGDKSGIRRFGDAWIPMDEAXXXXVVDVSGRPYCVHTGEPESMAGFVVGGNYPTVLNRHVFESIAFHAGIALHVRVTGGRDPHHITEAQYKALARALRAATETDPRLEGPASTKGVLES

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
65 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
72 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
73 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
76 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
77 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
78 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
79 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
80 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
81 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
84 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
85 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
86 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
91 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
92 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
93 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
94 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
95 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
96 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
97 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
98 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
99 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
100 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
101 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
102 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
103 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
104 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
105 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
106 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
107 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
108 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
109 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
110 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
111 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
112 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
113 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
114 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
115 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
116 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 1.58
Isolates 6.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 3.68
Rhizosphere 78.42
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0079321 3300044694 Bacteria 2221
2 Ga0070690_100340529 3300005330 Bacteria 1086
3 Ga0070670_100309323 3300005331 Bacteria 1383
4 Ga0070680_100003180 3300005336 Bacteria 12203
5 Ga0070680_100224117 3300005336 Bacteria 1587
6 Ga0070660_100019779 3300005339 Bacteria 4939
7 Ga0070660_100088855 3300005339 Bacteria 2434
8 Ga0070660_100570502 3300005339 Bacteria 945
9 Ga0070692_10147200 3300005345 Bacteria 1338
10 Ga0070668_100000654 3300005347 Bacteria 23449
11 Ga0070659_100015117 3300005366 Bacteria 5773
12 Ga0070714_100390131 3300005435 Bacteria 1314
13 Ga0070713_100368614 3300005436 Bacteria 1336
14 Ga0070711_100028693 3300005439 Bacteria 3664
15 Ga0070663_100000249 3300005455 Bacteria 27248
16 Ga0070681_10000004 3300005458 Bacteria 205157
17 Ga0070681_10174520 3300005458 Bacteria 2071
18 Ga0070681_10211557 3300005458 Bacteria 1855
19 Ga0070681_10428051 3300005458 Bacteria 1235
20 Ga0070681_10926134 3300005458 Bacteria 790
21 Ga0070706_100018169 3300005467 Bacteria 6487
22 Ga0070706_100078147 3300005467 Bacteria 3064
23 Ga0070706_100138912 3300005467 Bacteria 2268
24 Ga0070706_100205888 3300005467 Bacteria 1837
25 Ga0070707_100015128 3300005468 Bacteria 7242
26 Ga0070707_100045457 3300005468 Bacteria 4203
27 Ga0070699_100244931 3300005518 Bacteria 1601
28 Ga0070699_100862374 3300005518 Bacteria 829
29 Ga0070679_100000012 3300005530 Bacteria 155885
30 Ga0070679_100044843 3300005530 Bacteria 4405
31 Ga0070679_100237267 3300005530 Bacteria 1782
32 Ga0070679_100641090 3300005530 Bacteria 1005
33 Ga0070684_100054260 3300005535 Bacteria 3492
34 Ga0068857_100735410 3300005577 Bacteria 939
35 Ga0068856_100046216 3300005614 Bacteria 4288
36 Ga0068856_100639329 3300005614 Bacteria 1085
37 Ga0068856_100729544 3300005614 Bacteria 1011
38 Ga0075364_10011486 3300006051 Bacteria 5379
39 Ga0070716_100006732 3300006173 Bacteria 5629
40 Ga0070712_101021624 3300006175 Bacteria 716
41 Ga0075362_10079626 3300006177 Bacteria 1509
42 Ga0075366_10281105 3300006195 Unclassified 1017
43 Ga0068865_101284929 3300006881 Bacteria 650
44 Ga0105240_11014828 3300009093 Bacteria 887
45 Ga0105245_10000809 3300009098 Bacteria 28488
46 Ga0105245_10193663 3300009098 Bacteria 1949
47 Ga0105242_10068684 3300009176 Bacteria 2933
48 Ga0105237_10156939 3300009545 Bacteria 2272
49 Ga0105237_10359958 3300009545 Bacteria 1459
50 Ga0105239_10089896 3300010375 Bacteria 3387
51 Ga0157373_10445395 3300013100 Unclassified 931
52 Ga0157369_10004984 3300013105 Bacteria 15541
53 Ga0157369_10016379 3300013105 Bacteria 8340
54 Ga0157369_10134693 3300013105 Bacteria 2616
55 Ga0157369_10212061 3300013105 Bacteria 2029
56 Ga0157369_10902607 3300013105 Bacteria 906
57 Ga0157372_10011994 3300013307 Bacteria 9228
58 Ga0157372_10444972 3300013307 Bacteria 1510
59 Ga0157380_11221940 3300014326 Bacteria 796
60 Ga0157376_10015239 3300014969 Bacteria 5802
61 Ga0197907_10782661 3300020069 Bacteria 1792
62 Ga0213875_10000071 3300021388 Bacteria 120220
63 Ga0213875_10000316 3300021388 Bacteria 46077
64 Ga0213875_10004974 3300021388 Bacteria 7208
65 Ga0224712_10020671 3300022467 Bacteria 2239
66 Ga0224712_10212258 3300022467 Bacteria 883
67 Ga0207705_10126060 3300025909 Bacteria 1903
68 Ga0207705_10164002 3300025909 Bacteria 1670
69 Ga0207684_10329825 3300025910 Bacteria 1315
70 Ga0207707_10000159 3300025912 Bacteria 70857
71 Ga0207707_10573106 3300025912 Bacteria 957
72 Ga0207707_10677424 3300025912 Bacteria 867
73 Ga0207707_10775958 3300025912 Bacteria 800
74 Ga0207671_10031272 3300025914 Bacteria 3965
75 Ga0207660_10002821 3300025917 Bacteria 11403
76 Ga0207657_10022274 3300025919 Bacteria 5935
77 Ga0207657_10091443 3300025919 Bacteria 2537
78 Ga0207657_10253582 3300025919 Bacteria 1402
79 Ga0207652_10000106 3300025921 Bacteria 90763
80 Ga0207652_10094740 3300025921 Bacteria 2629
81 Ga0207652_10575535 3300025921 Bacteria 1011
82 Ga0207646_10023951 3300025922 Bacteria 5599
83 Ga0207646_10076792 3300025922 Bacteria 2985
84 Ga0207646_10475872 3300025922 Bacteria 1126
85 Ga0207687_10000429 3300025927 Bacteria 28464
86 Ga0207687_10128910 3300025927 Bacteria 1903
87 Ga0207664_10085107 3300025929 Bacteria 2580
88 Ga0207664_10285770 3300025929 Bacteria 1448
89 Ga0207690_10002319 3300025932 Bacteria 11603
90 Ga0207661_10511136 3300025944 Bacteria 1098
91 Ga0207678_10000065 3300026067 Bacteria 83028
92 Ga0207702_10192957 3300026078 Bacteria 1883
93 Ga0207702_10543504 3300026078 Bacteria 1136
94 Ga0207674_10102656 3300026116 Bacteria 2839
95 Ga0207683_10045943 3300026121 Bacteria 3820
96 Ga0207698_10728190 3300026142 Bacteria 989
97 Ga0307515_10076606 3300028794 Bacteria 4433
98 Ga0307515_10368547 3300028794 Bacteria 1074
99 Ga0316579_10049331 3300031691 Bacteria 1967
100 Ga0316576_10004792 3300031727 Bacteria 8173
101 Ga0316578_10007148 3300031728 Bacteria 5573
102 Ga0307413_10000161 3300031824 Bacteria 18416
103 Ga0307518_10088238 3300031838 Bacteria 2234
104 Ga0307411_10112994 3300032005 Bacteria 1948
105 Ga0316583_10050362 3300032133 Bacteria 1466
106 Ga0307507_10012874 3300033179 Bacteria 10262
107 Ga0307507_10273816 3300033179 Bacteria 1063
108 Ga0307507_10450698 3300033179 Bacteria 710
109 Ga0316574_0037466 3300035398 Bacteria 2975
110 Ga0373933_0388207 3300035724 Bacteria 910
111 Ga0316584_0001763 3300036712 Bacteria 13306
112 Ga0316584_0254139 3300036712 Bacteria 1283
113 Ga0373925_0211976 3300037068 Bacteria 1543
114 Ga0395905_0281572 3300037471 Unclassified 1549
115 Ga0436364_0383034 3300037853 Bacteria 52816
116 Ga0436364_0619304 3300037853 Bacteria 133320
117 Ga0436364_1021553 3300037853 Bacteria 907
118 Ga0436364_1257195 3300037853 Bacteria 162167
119 Ga0436363_0122670 3300039450 Bacteria 1062
120 Ga0436363_0311414 3300039450 Bacteria 769
121 Ga0436363_1715377 3300039450 Bacteria 774
122 Ga0436362_0875086 3300039453 Bacteria 1179
123 Ga0466972_0003722 3300044658 Bacteria 7583
124 Ga0466965_0132096 3300044683 Bacteria 1295
125 Ga0466965_0146799 3300044683 Bacteria 1231
126 Ga0466965_0450002 3300044683 Bacteria 717
127 Ga0466966_0074133 3300044684 Bacteria 2128
128 Ga0466966_0178088 3300044684 Bacteria 1291
129 Ga0466961_0019701 3300044693 Bacteria 4341
130 Ga0466961_0027748 3300044693 Bacteria 3642
131 Ga0466961_0147920 3300044693 Bacteria 1468
132 Ga0466961_0322990 3300044693 Bacteria 941
133 Ga0466963_0000946 3300044694 Bacteria 14867
134 Ga0466963_0020362 3300044694 Bacteria 4171
135 Ga0466963_0144631 3300044694 Bacteria 1649
136 Ga0466971_0014319 3300044719 Bacteria 3489
137 Ga0466968_0019667 3300044735 Bacteria 2719
138 Ga0466968_0108892 3300044735 Bacteria 1244
139 Ga0466970_0002697 3300044765 Bacteria 8575
140 Ga0466970_0043081 3300044765 Bacteria 2401
141 Ga0466970_0178789 3300044765 Bacteria 1177
142 Ga0466970_0285397 3300044765 Bacteria 929
143 Ga0466957_0000298 3300044842 Bacteria 24230
144 Ga0466957_0100401 3300044842 Bacteria 1824
145 Ga0466960_0008862 3300044901 Bacteria 4132
146 Ga0466959_0134179 3300045049 Bacteria 1753
147 Ga0466958_0000011 3300045836 Bacteria 57675
148 Ga0466958_0013377 3300045836 Bacteria 4671
149 Ga0466958_0030508 3300045836 Bacteria 3203
150 Ga0466958_0354037 3300045836 Bacteria 945
151 Ga0466958_0421402 3300045836 Bacteria 863
152 Ga0466967_0000585 3300045976 Bacteria 18006
153 Ga0466967_0016427 3300045976 Bacteria 5838
154 Ga0466967_0113858 3300045976 Bacteria 2489
155 Ga0466967_0120816 3300045976 Bacteria 2420
156 Ga0466967_0254723 3300045976 Bacteria 1678
157 Ga0466967_0332632 3300045976 Bacteria 1467
158 Ga0466967_0773339 3300045976 Bacteria 953
159 Ga0495647_0372089 3300046681 Bacteria 653
160 Ga0495604_0275504 3300047317 Bacteria 1138
161 Ga0496101_0041564 3300048904 Bacteria 3279
162 Ga0496101_0706632 3300048904 Bacteria 796
163 Ga0496102_0050310 3300048905 Bacteria 3794
164 Ga0496106_0696136 3300048909 Bacteria 810
165 Ga0496109_0042148 3300048912 Bacteria 4134
166 Ga0496110_0821004 3300048913 Bacteria 834
167 Ga0496115_0024076 3300048918 Bacteria 4730
168 Ga0501073_0456867 3300049589 Bacteria 883
169 nmdc:mga03683_22852_c1 3300050489 Bacteria 2428
170 nmdc:mga00v17_107581_c1 3300050491 Bacteria 1766
171 Ga0495619_0039963 3300053085 Bacteria 3064
172 Ga0500566_0162387 3300053094 Bacteria 1163
173 Ga0500595_026497 3300053119 Bacteria 1997
174 Ga0500597_006602 3300053120 Bacteria 3867
175 Ga0500638_043863 3300053162 Bacteria 2171
176 Ga0500637_0096872 3300053178 Bacteria 1710
177 Ga0501082_0001659 3300060353 Bacteria 19597
178 Ga0466962_0010392 3300061719 Bacteria 4473
179 2558912081 2558860112 Bacteria 9931328
180 2753070974 2751185734 Bacteria 8863695
181 2791913485 2791354901 Bacteria 8322202
182 2816504143 2816332139 Bacteria 9138787
183 2870726445 2870721527 Bacteria 9689237
184 2870789812 2870782633 Bacteria 9624083
185 2891330899 2891326441 Bacteria 6439512
186 2899363523 2899359706 Bacteria 10940472
187 2917741034 2917736166 Bacteria 9690793
188 2966927662 2966924647 Bacteria 3268643
189 8003322275 8003314358 Bacteria 10575343
190 8047713575 8047710418 Bacteria 11023148
191 Ga0466963_0079321
192 Ga0070690_100340529
193 Ga0070670_100309323
194 Ga0070680_100003180
195 Ga0070680_100224117
196 Ga0070660_100019779
197 Ga0070660_100088855
198 Ga0070660_100570502
199 Ga0070692_10147200
200 Ga0070668_100000654
201 Ga0070659_100015117
202 Ga0070714_100390131
203 Ga0070713_100368614
204 Ga0070711_100028693
205 Ga0070663_100000249
206 Ga0070681_10000004
207 Ga0070681_10174520
208 Ga0070681_10211557
209 Ga0070681_10428051
210 Ga0070681_10926134
211 Ga0070706_100018169
212 Ga0070706_100078147
213 Ga0070706_100138912
214 Ga0070706_100205888
215 Ga0070707_100015128
216 Ga0070707_100045457
217 Ga0070699_100244931
218 Ga0070699_100862374
219 Ga0070679_100000012
220 Ga0070679_100044843
221 Ga0070679_100237267
222 Ga0070679_100641090
223 Ga0070684_100054260
224 Ga0068857_100735410
225 Ga0068856_100046216
226 Ga0068856_100639329
227 Ga0068856_100729544
228 Ga0075364_10011486
229 Ga0070716_100006732
230 Ga0070712_101021624
231 Ga0075362_10079626
232 Ga0075366_10281105
233 Ga0068865_101284929
234 Ga0105240_11014828
235 Ga0105245_10000809
236 Ga0105245_10193663
237 Ga0105242_10068684
238 Ga0105237_10156939
239 Ga0105237_10359958
240 Ga0105239_10089896
241 Ga0157373_10445395
242 Ga0157369_10004984
243 Ga0157369_10016379
244 Ga0157369_10134693
245 Ga0157369_10212061
246 Ga0157369_10902607
247 Ga0157372_10011994
248 Ga0157372_10444972
249 Ga0157380_11221940
250 Ga0157376_10015239
251 Ga0197907_10782661
252 Ga0213875_10000071
253 Ga0213875_10000316
254 Ga0213875_10004974
255 Ga0224712_10020671
256 Ga0224712_10212258
257 Ga0207705_10126060
258 Ga0207705_10164002
259 Ga0207684_10329825
260 Ga0207707_10000159
261 Ga0207707_10573106
262 Ga0207707_10677424
263 Ga0207707_10775958
264 Ga0207671_10031272
265 Ga0207660_10002821
266 Ga0207657_10022274
267 Ga0207657_10091443
268 Ga0207657_10253582
269 Ga0207652_10000106
270 Ga0207652_10094740
271 Ga0207652_10575535
272 Ga0207646_10023951
273 Ga0207646_10076792
274 Ga0207646_10475872
275 Ga0207687_10000429
276 Ga0207687_10128910
277 Ga0207664_10085107
278 Ga0207664_10285770
279 Ga0207690_10002319
280 Ga0207661_10511136
281 Ga0207678_10000065
282 Ga0207702_10192957
283 Ga0207702_10543504
284 Ga0207674_10102656
285 Ga0207683_10045943
286 Ga0207698_10728190
287 Ga0307515_10076606
288 Ga0307515_10368547
289 Ga0316579_10049331
290 Ga0316576_10004792
291 Ga0316578_10007148
292 Ga0307413_10000161
293 Ga0307518_10088238
294 Ga0307411_10112994
295 Ga0316583_10050362
296 Ga0307507_10012874
297 Ga0307507_10273816
298 Ga0307507_10450698
299 Ga0316574_0037466
300 Ga0373933_0388207
301 Ga0316584_0001763
302 Ga0316584_0254139
303 Ga0373925_0211976
304 Ga0395905_0281572
305 Ga0436364_0383034
306 Ga0436364_0619304
307 Ga0436364_1021553
308 Ga0436364_1257195
309 Ga0436363_0122670
310 Ga0436363_0311414
311 Ga0436363_1715377
312 Ga0436362_0875086
313 Ga0466972_0003722
314 Ga0466965_0132096
315 Ga0466965_0146799
316 Ga0466965_0450002
317 Ga0466966_0074133
318 Ga0466966_0178088
319 Ga0466961_0019701
320 Ga0466961_0027748
321 Ga0466961_0147920
322 Ga0466961_0322990
323 Ga0466963_0000946
324 Ga0466963_0020362
325 Ga0466963_0144631
326 Ga0466971_0014319
327 Ga0466968_0019667
328 Ga0466968_0108892
329 Ga0466970_0002697
330 Ga0466970_0043081
331 Ga0466970_0178789
332 Ga0466970_0285397
333 Ga0466957_0000298
334 Ga0466957_0100401
335 Ga0466960_0008862
336 Ga0466959_0134179
337 Ga0466958_0000011
338 Ga0466958_0013377
339 Ga0466958_0030508
340 Ga0466958_0354037
341 Ga0466958_0421402
342 Ga0466967_0000585
343 Ga0466967_0016427
344 Ga0466967_0113858
345 Ga0466967_0120816
346 Ga0466967_0254723
347 Ga0466967_0332632
348 Ga0466967_0773339
349 Ga0495647_0372089
350 Ga0495604_0275504
351 Ga0496101_0041564
352 Ga0496101_0706632
353 Ga0496102_0050310
354 Ga0496106_0696136
355 Ga0496109_0042148
356 Ga0496110_0821004
357 Ga0496115_0024076
358 Ga0501073_0456867
359 nmdc:mga03683_22852_c1
360 nmdc:mga00v17_107581_c1
361 Ga0495619_0039963
362 Ga0500566_0162387
363 Ga0500595_026497
364 Ga0500597_006602
365 Ga0500638_043863
366 Ga0500637_0096872
367 Ga0501082_0001659
368 Ga0466962_0010392
369 2558912081
370 2753070974
371 2791913485
372 2816504143
373 2870726445
374 2870789812
375 2891330899
376 2899363523
377 2917741034
378 2966927662
379 8003322275
380 8047713575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

55

202

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9829 3 184
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9827 1 184
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.98 3 184
4lom-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis hisb in complex with its substrate 0.9797 2 184
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9761 1 187
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9847 2 89 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9779 1 89 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9715 91 180 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9705 91 184 3.30.230.40
2ae8A02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9688 91 182 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A7W1SSW3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9954 1 95 GO:0000105
GO:0004424
AF-W4TS96-F1-model_v4 deleted 0.9951 1 91
AF-A0A6I2X0S7-F1-model_v4 deleted 0.9945 3 181
AF-A0A2H0ATB3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9945 1 72 GO:0000105
GO:0004424
AF-X1F1D4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.994 2 103 GO:0000105
GO:0004424

Map