F292858

General Info

Members Datasets Scaffolds Average Seq Length
190 156 380 141

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0008798|Ga0436360_0008798_67_525
Length 152
Sequence VSRGDPFELERFVAAQDEDGTYEAAVAELRAGRKRSHWMWFVFPQIAGLGQSPTSRRYAIASLDEARAYLDHPVLGPRLQEAAGIVAGLSGLTAEDVLGGIDSLKLRSSMTLFHRAAPEDPVFARVLDAYFGGSADPATDRLLPDINPRDGG

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
99 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
102 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
103 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
104 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
107 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
108 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
111 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
114 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
115 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
116 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
128 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
131 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
132 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
133 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
134 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
143 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
144 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
145 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
146 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
153 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
154 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
155 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
156 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 0.53
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 9.47
Rhizosphere 81.58
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0008798 3300039438 Bacteria 690
2 JGI24752J21851_1004161 3300001976 Bacteria 1899
3 JGI24748J21848_1007302 3300002074 Bacteria 1295
4 Ga0070658_10034236 3300005327 Bacteria 4087
5 Ga0070658_11083822 3300005327 Bacteria 697
6 Ga0070683_100101373 3300005329 Bacteria 2711
7 Ga0070690_100506362 3300005330 Bacteria 904
8 Ga0070670_100004266 3300005331 Bacteria 11961
9 Ga0070666_10004566 3300005335 Bacteria 8444
10 Ga0070666_11195757 3300005335 Bacteria 566
11 Ga0070680_100000944 3300005336 Bacteria 20588
12 Ga0070680_100192856 3300005336 Bacteria 1717
13 Ga0068868_100074563 3300005338 Bacteria 2710
14 Ga0070660_100004638 3300005339 Bacteria 9515
15 Ga0070661_100026040 3300005344 Bacteria 4204
16 Ga0070661_100074416 3300005344 Bacteria 2501
17 Ga0070669_100123964 3300005353 Bacteria 1975
18 Ga0070675_100066971 3300005354 Bacteria 2971
19 Ga0070671_100086803 3300005355 Bacteria 2618
20 Ga0070674_100276599 3300005356 Bacteria 1329
21 Ga0070673_100000163 3300005364 Bacteria 32129
22 Ga0070667_100011314 3300005367 Bacteria 7379
23 Ga0070714_100037907 3300005435 Bacteria 4053
24 Ga0070663_100003329 3300005455 Bacteria 9266
25 Ga0070663_100725426 3300005455 Bacteria 847
26 Ga0070678_100001547 3300005456 Bacteria 12290
27 Ga0070662_100000478 3300005457 Bacteria 23734
28 Ga0070681_10037288 3300005458 Bacteria 4879
29 Ga0070685_10294786 3300005466 Bacteria 1091
30 Ga0070699_100504817 3300005518 Unclassified 1099
31 Ga0070679_100001358 3300005530 Bacteria 21597
32 Ga0070684_100478200 3300005535 Bacteria 1153
33 Ga0070672_100004071 3300005543 Bacteria 9541
34 Ga0070665_100000317 3300005548 Bacteria 74997
35 Ga0070665_100006041 3300005548 Bacteria 12373
36 Ga0070665_100008613 3300005548 Bacteria 10323
37 Ga0068855_100009884 3300005563 Bacteria 11506
38 Ga0070664_100018520 3300005564 Bacteria 5723
39 Ga0070664_100089842 3300005564 Bacteria 2658
40 Ga0068856_100010961 3300005614 Bacteria 8800
41 Ga0068856_100230390 3300005614 Bacteria 1868
42 Ga0068859_100789093 3300005617 Bacteria 1038
43 Ga0068864_100059589 3300005618 Bacteria 3303
44 Ga0068851_10093971 3300005834 Bacteria 1583
45 Ga0068863_100004660 3300005841 Bacteria 13517
46 Ga0068858_100010636 3300005842 Bacteria 8708
47 Ga0068860_100046822 3300005843 Bacteria 4123
48 Ga0068860_100278890 3300005843 Bacteria 1633
49 Ga0081539_10010505 3300005985 Bacteria 7508
50 Ga0075364_10136851 3300006051 Bacteria 1646
51 Ga0097621_100007643 3300006237 Bacteria 7747
52 Ga0068871_100002657 3300006358 Bacteria 12206
53 Ga0097620_100789122 3300006931 Bacteria 1038
54 Ga0105243_12039419 3300009148 Bacteria 608
55 Ga0105242_10537943 3300009176 Bacteria 1118
56 Ga0105248_10008362 3300009177 Bacteria 11367
57 Ga0105246_11174680 3300011119 Bacteria 705
58 Ga0157371_10082534 3300013102 Bacteria 2276
59 Ga0157370_10007539 3300013104 Bacteria 11820
60 Ga0157369_10073414 3300013105 Bacteria 3671
61 Ga0157369_12132218 3300013105 Bacteria 568
62 Ga0157374_10006636 3300013296 Bacteria 9833
63 Ga0163162_10007903 3300013306 Bacteria 10367
64 Ga0157375_10002650 3300013308 Bacteria 15497
65 Ga0163163_10004847 3300014325 Bacteria 11562
66 Ga0163163_11652413 3300014325 Bacteria 701
67 Ga0157377_10272575 3300014745 Bacteria 1106
68 Ga0157379_12186585 3300014968 Bacteria 549
69 Ga0157376_11793915 3300014969 Bacteria 650
70 Ga0163161_11292750 3300017792 Bacteria 634
71 Ga0206351_10551845 3300020077 Bacteria 1021
72 Ga0207426_1014816 3300025302 Bacteria 2848
73 Ga0207680_10056345 3300025903 Bacteria 2373
74 Ga0207647_10000736 3300025904 Bacteria 25695
75 Ga0207705_10000067 3300025909 Bacteria 136004
76 Ga0207660_10047357 3300025917 Bacteria 3039
77 Ga0207657_10000346 3300025919 Bacteria 49145
78 Ga0207649_10021692 3300025920 Bacteria 3702
79 Ga0207649_10193050 3300025920 Bacteria 1433
80 Ga0207652_10000527 3300025921 Bacteria 38846
81 Ga0207650_10014281 3300025925 Bacteria 5518
82 Ga0207659_10075143 3300025926 Bacteria 2478
83 Ga0207664_10139539 3300025929 Bacteria 2049
84 Ga0207644_10001503 3300025931 Bacteria 15031
85 Ga0207690_11378831 3300025932 Bacteria 589
86 Ga0207706_10001240 3300025933 Bacteria 25703
87 Ga0207669_10836273 3300025937 Bacteria 765
88 Ga0207691_10003394 3300025940 Bacteria 15491
89 Ga0207691_11257070 3300025940 Bacteria 612
90 Ga0207711_10006899 3300025941 Bacteria 9535
91 Ga0207661_10488535 3300025944 Bacteria 1124
92 Ga0207679_10011154 3300025945 Bacteria 5805
93 Ga0207667_10001743 3300025949 Bacteria 27391
94 Ga0207651_10017304 3300025960 Bacteria 4255
95 Ga0207640_12173713 3300025981 Bacteria 504
96 Ga0207658_10008180 3300025986 Bacteria 7122
97 Ga0207703_10056304 3300026035 Bacteria 3202
98 Ga0207703_11180596 3300026035 Bacteria 736
99 Ga0207678_10002985 3300026067 Bacteria 15307
100 Ga0207678_10317161 3300026067 Bacteria 1341
101 Ga0207702_10008156 3300026078 Bacteria 8857
102 Ga0207702_10054298 3300026078 Bacteria 3394
103 Ga0207702_10530860 3300026078 Bacteria 1149
104 Ga0207641_10146192 3300026088 Bacteria 2137
105 Ga0207648_11357749 3300026089 Bacteria 668
106 Ga0207676_10005216 3300026095 Bacteria 9197
107 Ga0207674_11974748 3300026116 Bacteria 549
108 Ga0207683_10001131 3300026121 Bacteria 24274
109 Ga0268266_10001868 3300028379 Bacteria 23785
110 Ga0268266_10031202 3300028379 Bacteria 4524
111 Ga0268266_10072791 3300028379 Bacteria 2981
112 Ga0268264_10096786 3300028381 Bacteria 2557
113 Ga0395899_0001516 3300037312 Bacteria 19629
114 Ga0395900_0002620 3300037418 Bacteria 19629
115 Ga0395898_0012923 3300037466 Bacteria 8611
116 Ga0395898_0933778 3300037466 Bacteria 805
117 Ga0395905_0000801 3300037471 Bacteria 41315
118 Ga0395901_0002295 3300038443 Bacteria 19494
119 Ga0395901_0451022 3300038443 Bacteria 1315
120 Ga0395901_1189057 3300038443 Bacteria 729
121 Ga0451791_0964258 3300041451 Bacteria 1940
122 Ga0451793_1269534 3300041452 Bacteria 1992
123 Ga0451797_0034863 3300041453 Bacteria 697
124 Ga0451797_0692995 3300041453 Bacteria 784
125 Ga0451807_0559703 3300041486 Bacteria 1618
126 Ga0451833_0901712 3300041491 Bacteria 1968
127 Ga0451837_0647840 3300041494 Bacteria 3103
128 Ga0451839_0781329 3300041496 Bacteria 627
129 Ga0451841_0343559 3300041498 Bacteria 3125
130 Ga0451853_0204204 3300041512 Bacteria 707
131 Ga0439432_043472 3300042006 Bacteria 1417
132 Ga0466969_0023466 3300044656 Bacteria 3179
133 Ga0466965_0566860 3300044683 Bacteria 642
134 Ga0466966_0003926 3300044684 Bacteria 9821
135 Ga0466966_0190126 3300044684 Bacteria 1244
136 Ga0466961_0101394 3300044693 Bacteria 1813
137 Ga0466961_0512525 3300044693 Bacteria 724
138 Ga0466963_0037208 3300044694 Bacteria 3176
139 Ga0466971_0075819 3300044719 Bacteria 1530
140 Ga0466968_0131553 3300044735 Bacteria 1139
141 Ga0466970_0024516 3300044765 Bacteria 3155
142 Ga0466970_0055172 3300044765 Bacteria 2122
143 Ga0466960_0018624 3300044901 Bacteria 3047
144 Ga0466959_0010758 3300045049 Bacteria 6555
145 Ga0466967_0303496 3300045976 Bacteria 1536
146 Ga0466967_1730775 3300045976 Bacteria 622
147 Ga0495585_0023112 3300046492 Bacteria 3567
148 Ga0495606_0210345 3300046507 Bacteria 1102
149 Ga0495631_0046163 3300046518 Bacteria 1915
150 Ga0495631_0084760 3300046518 Bacteria 1365
151 Ga0495632_0000250 3300046519 Bacteria 53467
152 Ga0495633_0009075 3300046558 Bacteria 5529
153 Ga0495625_0641723 3300046660 Bacteria 633
154 Ga0495661_0007004 3300046665 Bacteria 7885
155 Ga0495661_0012651 3300046665 Bacteria 5695
156 Ga0495670_0001204 3300046691 Bacteria 12575
157 Ga0495683_0118499 3300047323 Bacteria 1258
158 Ga0495677_0114251 3300047445 Bacteria 1027
159 Ga0495681_0023255 3300047470 Bacteria 3296
160 Ga0495626_0092882 3300048091 Bacteria 1325
161 Ga0496100_0389139 3300048903 Bacteria 1060
162 Ga0496100_0769689 3300048903 Bacteria 753
163 Ga0496101_0483890 3300048904 Bacteria 977
164 Ga0496102_0087064 3300048905 Bacteria 2886
165 Ga0496103_0207817 3300048906 Bacteria 1259
166 Ga0496105_0599677 3300048908 Bacteria 855
167 Ga0496106_0717192 3300048909 Bacteria 796
168 Ga0496108_0005805 3300048911 Bacteria 10005
169 Ga0496109_0048582 3300048912 Bacteria 3860
170 Ga0496110_0016281 3300048913 Bacteria 6206
171 Ga0496111_0037904 3300048914 Bacteria 3451
172 Ga0496113_0002132 3300048916 Bacteria 11414
173 Ga0496113_1564005 3300048916 Bacteria 508
174 Ga0496117_0003236 3300048920 Bacteria 19180
175 Ga0496118_0000243 3300048921 Bacteria 96384
176 Ga0496119_0041489 3300048922 Bacteria 2930
177 Ga0496121_0342951 3300048924 Bacteria 998
178 Ga0496122_0145395 3300048925 Bacteria 1474
179 Ga0496124_0000040 3300048927 Bacteria 307061
180 Ga0501034_0752732 3300049571 Bacteria 870
181 Ga0501034_0896857 3300049571 Bacteria 775
182 Ga0501047_0214772 3300049581 Bacteria 1780
183 Ga0501047_0506615 3300049581 Bacteria 1034
184 Ga0501081_0085035 3300049743 Bacteria 2219
185 Ga0501044_0185755 3300049823 Bacteria 2044
186 nmdc:mga00v17_377461_c1 3300050491 Bacteria 922
187 nmdc:mga0yw44_95670_c1 3300050492 Bacteria 1884
188 nmdc:mga0k408_525890_c1 3300050493 Bacteria 700
189 2753302858 2751185788 Bacteria 4541048
190 2928105023 2928104781 Bacteria 3877447
191 Ga0436360_0008798
192 JGI24752J21851_1004161
193 JGI24748J21848_1007302
194 Ga0070658_10034236
195 Ga0070658_11083822
196 Ga0070683_100101373
197 Ga0070690_100506362
198 Ga0070670_100004266
199 Ga0070666_10004566
200 Ga0070666_11195757
201 Ga0070680_100000944
202 Ga0070680_100192856
203 Ga0068868_100074563
204 Ga0070660_100004638
205 Ga0070661_100026040
206 Ga0070661_100074416
207 Ga0070669_100123964
208 Ga0070675_100066971
209 Ga0070671_100086803
210 Ga0070674_100276599
211 Ga0070673_100000163
212 Ga0070667_100011314
213 Ga0070714_100037907
214 Ga0070663_100003329
215 Ga0070663_100725426
216 Ga0070678_100001547
217 Ga0070662_100000478
218 Ga0070681_10037288
219 Ga0070685_10294786
220 Ga0070699_100504817
221 Ga0070679_100001358
222 Ga0070684_100478200
223 Ga0070672_100004071
224 Ga0070665_100000317
225 Ga0070665_100006041
226 Ga0070665_100008613
227 Ga0068855_100009884
228 Ga0070664_100018520
229 Ga0070664_100089842
230 Ga0068856_100010961
231 Ga0068856_100230390
232 Ga0068859_100789093
233 Ga0068864_100059589
234 Ga0068851_10093971
235 Ga0068863_100004660
236 Ga0068858_100010636
237 Ga0068860_100046822
238 Ga0068860_100278890
239 Ga0081539_10010505
240 Ga0075364_10136851
241 Ga0097621_100007643
242 Ga0068871_100002657
243 Ga0097620_100789122
244 Ga0105243_12039419
245 Ga0105242_10537943
246 Ga0105248_10008362
247 Ga0105246_11174680
248 Ga0157371_10082534
249 Ga0157370_10007539
250 Ga0157369_10073414
251 Ga0157369_12132218
252 Ga0157374_10006636
253 Ga0163162_10007903
254 Ga0157375_10002650
255 Ga0163163_10004847
256 Ga0163163_11652413
257 Ga0157377_10272575
258 Ga0157379_12186585
259 Ga0157376_11793915
260 Ga0163161_11292750
261 Ga0206351_10551845
262 Ga0207426_1014816
263 Ga0207680_10056345
264 Ga0207647_10000736
265 Ga0207705_10000067
266 Ga0207660_10047357
267 Ga0207657_10000346
268 Ga0207649_10021692
269 Ga0207649_10193050
270 Ga0207652_10000527
271 Ga0207650_10014281
272 Ga0207659_10075143
273 Ga0207664_10139539
274 Ga0207644_10001503
275 Ga0207690_11378831
276 Ga0207706_10001240
277 Ga0207669_10836273
278 Ga0207691_10003394
279 Ga0207691_11257070
280 Ga0207711_10006899
281 Ga0207661_10488535
282 Ga0207679_10011154
283 Ga0207667_10001743
284 Ga0207651_10017304
285 Ga0207640_12173713
286 Ga0207658_10008180
287 Ga0207703_10056304
288 Ga0207703_11180596
289 Ga0207678_10002985
290 Ga0207678_10317161
291 Ga0207702_10008156
292 Ga0207702_10054298
293 Ga0207702_10530860
294 Ga0207641_10146192
295 Ga0207648_11357749
296 Ga0207676_10005216
297 Ga0207674_11974748
298 Ga0207683_10001131
299 Ga0268266_10001868
300 Ga0268266_10031202
301 Ga0268266_10072791
302 Ga0268264_10096786
303 Ga0395899_0001516
304 Ga0395900_0002620
305 Ga0395898_0012923
306 Ga0395898_0933778
307 Ga0395905_0000801
308 Ga0395901_0002295
309 Ga0395901_0451022
310 Ga0395901_1189057
311 Ga0451791_0964258
312 Ga0451793_1269534
313 Ga0451797_0034863
314 Ga0451797_0692995
315 Ga0451807_0559703
316 Ga0451833_0901712
317 Ga0451837_0647840
318 Ga0451839_0781329
319 Ga0451841_0343559
320 Ga0451853_0204204
321 Ga0439432_043472
322 Ga0466969_0023466
323 Ga0466965_0566860
324 Ga0466966_0003926
325 Ga0466966_0190126
326 Ga0466961_0101394
327 Ga0466961_0512525
328 Ga0466963_0037208
329 Ga0466971_0075819
330 Ga0466968_0131553
331 Ga0466970_0024516
332 Ga0466970_0055172
333 Ga0466960_0018624
334 Ga0466959_0010758
335 Ga0466967_0303496
336 Ga0466967_1730775
337 Ga0495585_0023112
338 Ga0495606_0210345
339 Ga0495631_0046163
340 Ga0495631_0084760
341 Ga0495632_0000250
342 Ga0495633_0009075
343 Ga0495625_0641723
344 Ga0495661_0007004
345 Ga0495661_0012651
346 Ga0495670_0001204
347 Ga0495683_0118499
348 Ga0495677_0114251
349 Ga0495681_0023255
350 Ga0495626_0092882
351 Ga0496100_0389139
352 Ga0496100_0769689
353 Ga0496101_0483890
354 Ga0496102_0087064
355 Ga0496103_0207817
356 Ga0496105_0599677
357 Ga0496106_0717192
358 Ga0496108_0005805
359 Ga0496109_0048582
360 Ga0496110_0016281
361 Ga0496111_0037904
362 Ga0496113_0002132
363 Ga0496113_1564005
364 Ga0496117_0003236
365 Ga0496118_0000243
366 Ga0496119_0041489
367 Ga0496121_0342951
368 Ga0496122_0145395
369 Ga0496124_0000040
370 Ga0501034_0752732
371 Ga0501034_0896857
372 Ga0501047_0214772
373 Ga0501047_0506615
374 Ga0501081_0085035
375 Ga0501044_0185755
376 nmdc:mga00v17_377461_c1
377 nmdc:mga0yw44_95670_c1
378 nmdc:mga0k408_525890_c1
379 2753302858
380 2928105023

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08837

DUF1810

Protein of unknown function (DUF1810)

6

143

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9735 3 139
2jek-assembly1.cif.gz_A crystal structure of the conserved hypothetical protein rv1873 from mycobacterium tuberculosis at 1.38 a 0.9463 3 139
1fo3-assembly1.cif.gz_A crystal structure of human class i alpha1,2-mannosidase in complex with kifunensine 0.5118 59 121
3wre-assembly1.cif.gz_A-2 the crystal structure of native hypba1 from bifidobacterium longum jcm 1217 0.5012 10 128
3wrg-assembly1.cif.gz_A the complex structure of hypba1 with l-arabinose 0.4885 19 128
ID Description Score Start End Superfamily
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9735 3 139 1.25.40.380
2jekA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Protein of unknown function DUF1810 0.9463 3 139 1.25.40.380
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.5153 7 141 1.25.10.10
af_Q54B61_245_442_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.4924 7 141 1.25.10.10
af_Q4CPF4_206_337_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4801 10 124 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q3WEK1-F1-model_v4 DUF1810 family protein 0.9971 7 136
AF-A0A519UUX2-F1-model_v4 DUF1810 family protein 0.9963 6 62
AF-A0A6G6Y2B7-F1-model_v4 DUF1810 domain-containing protein 0.9958 5 136
AF-A0A4R1VH71-F1-model_v4 Uncharacterized protein (DUF1810 family) 0.9948 7 109
AF-A0A0Q4P354-F1-model_v4 Calpastatin 0.9947 7 138

Map