F292657

General Info

Members Datasets Scaffolds Average Seq Length
190 146 380 158

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_11056649|Ga0207676_110566492
Length 186
Sequence MALAQARSSTPTTAKPSSSLAVIYSGNRKAAAEFLAGRRIAVTGVSRNAEDHGANVVYKRMRERGYEVFAVNPNADEVEGDRCYHDLRSIPGGVEGVVIGTRPEIAEETMRECAELGIGHVWMHRGPGAGSVSASAAGYGREHGIAVIDGGCPCMFGQTADRGHKAMRTILTLTGHVPRRVWMLDP

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
40 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
43 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
63 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
64 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
67 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
68 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
69 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
70 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
71 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
72 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
73 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
80 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
81 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
82 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
130 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
139 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
140 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
143 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2643221679 Angustibacter sp. Root456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.16
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 13.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_11056649 3300026095 Bacteria 802
2 JGI24739J22299_10004759 3300001989 Bacteria 5182
3 JGI24737J22298_10011155 3300001990 Bacteria 2949
4 JGI24751J29686_10058215 3300002459 Bacteria 796
5 rootL2_10084442 3300003322 Bacteria 2114
6 Ga0070683_100854199 3300005329 Bacteria 873
7 Ga0070670_100278309 3300005331 Unclassified 1461
8 Ga0070682_101458828 3300005337 Bacteria 587
9 Ga0070692_10913369 3300005345 Bacteria 608
10 Ga0070668_100093407 3300005347 Unclassified 2374
11 Ga0070703_10000465 3300005406 Bacteria 16080
12 Ga0070713_100650050 3300005436 Unclassified 1004
13 Ga0070700_100907095 3300005441 Bacteria 718
14 Ga0070708_100012495 3300005445 Bacteria 6932
15 Ga0070663_100153633 3300005455 Bacteria 1767
16 Ga0070662_100024573 3300005457 Bacteria 4152
17 Ga0070706_100003001 3300005467 Bacteria 16720
18 Ga0070707_101200759 3300005468 Bacteria 725
19 Ga0070684_100540023 3300005535 Bacteria 1081
20 Ga0068853_100395211 3300005539 Unclassified 1293
21 Ga0070695_101103702 3300005545 Unclassified 649
22 Ga0068855_101164047 3300005563 Bacteria 803
23 Ga0068857_100148665 3300005577 Bacteria 2121
24 Ga0068854_100817881 3300005578 Bacteria 813
25 Ga0068859_100959660 3300005617 Unclassified 938
26 Ga0068858_100721667 3300005842 Bacteria 970
27 Ga0068860_100537013 3300005843 Unclassified 1170
28 Ga0068862_101405235 3300005844 Bacteria 701
29 Ga0081455_10328608 3300005937 Bacteria 1086
30 Ga0070717_10088741 3300006028 Bacteria 2607
31 Ga0070712_100650968 3300006175 Bacteria 895
32 Ga0075428_101091918 3300006844 Bacteria 843
33 Ga0097620_100959621 3300006931 Unclassified 938
34 Ga0111539_10021944 3300009094 Bacteria 7847
35 Ga0111539_10062174 3300009094 Bacteria 4421
36 Ga0111539_10905835 3300009094 Bacteria 1026
37 Ga0111539_11357210 3300009094 Bacteria 825
38 Ga0105245_10360830 3300009098 Unclassified 1442
39 Ga0114129_10040759 3300009147 Bacteria 6546
40 Ga0114129_11247465 3300009147 Unclassified 924
41 Ga0105242_12549333 3300009176 Bacteria 560
42 Ga0105239_12142575 3300010375 Bacteria 650
43 Ga0105246_10441932 3300011119 Bacteria 1091
44 Ga0157314_1012075 3300012500 Bacteria 771
45 Ga0157372_10066241 3300013307 Unclassified 4058
46 Ga0157372_10101043 3300013307 Bacteria 3292
47 Ga0213874_10040887 3300021377 Bacteria 1386
48 Ga0207653_10000233 3300025885 Bacteria 36792
49 Ga0207647_10045425 3300025904 Bacteria 2741
50 Ga0207684_10000233 3300025910 Bacteria 84435
51 Ga0207646_10183765 3300025922 Bacteria 1888
52 Ga0207650_10642150 3300025925 Bacteria 894
53 Ga0207687_10237110 3300025927 Unclassified 1444
54 Ga0207700_10392603 3300025928 Unclassified 1215
55 Ga0207664_10192313 3300025929 Bacteria 1757
56 Ga0207706_10007024 3300025933 Bacteria 10408
57 Ga0207704_10964928 3300025938 Bacteria 720
58 Ga0207661_10397851 3300025944 Bacteria 1249
59 Ga0207712_10829704 3300025961 Unclassified 814
60 Ga0207668_10076810 3300025972 Unclassified 2406
61 Ga0207640_10654365 3300025981 Bacteria 896
62 Ga0207658_10603727 3300025986 Unclassified 986
63 Ga0207703_10690884 3300026035 Bacteria 970
64 Ga0207703_11060106 3300026035 Bacteria 778
65 Ga0207639_10354762 3300026041 Unclassified 1311
66 Ga0207708_10072354 3300026075 Bacteria 2641
67 Ga0207676_11747721 3300026095 Bacteria 620
68 Ga0207674_10166520 3300026116 Bacteria 2158
69 Ga0207428_10130032 3300027907 Bacteria 1927
70 Ga0316576_10152044 3300031727 Bacteria 1744
71 Ga0307405_10265400 3300031731 Bacteria 1285
72 Ga0307406_10778907 3300031901 Bacteria 805
73 Ga0373926_0003980 3300035083 Bacteria 4830
74 Ga0373936_0066276 3300035113 Bacteria 1482
75 Ga0373945_0000475 3300035116 Bacteria 11348
76 Ga0373943_0001814 3300035170 Bacteria 9656
77 Ga0373943_0028079 3300035170 Bacteria 2650
78 Ga0373946_0000714 3300035171 Bacteria 11265
79 Ga0373946_0399395 3300035171 Bacteria 694
80 Ga0373935_0007568 3300035692 Bacteria 6503
81 Ga0373927_0000523 3300035695 Bacteria 29126
82 Ga0373927_0497412 3300035695 Bacteria 806
83 Ga0373947_0000882 3300035725 Bacteria 18142
84 Ga0373937_0265028 3300036401 Bacteria 1621
85 Ga0316584_0054752 3300036712 Bacteria 2986
86 Ga0373925_0000851 3300037068 Bacteria 27969
87 Ga0395898_0732328 3300037466 Bacteria 930
88 Ga0395898_1749656 3300037466 Bacteria 544
89 Ga0395901_0987783 3300038443 Bacteria 818
90 Ga0436363_0163142 3300039450 Bacteria 6834
91 Ga0439451_000617 3300042009 Bacteria 6756
92 Ga0466966_0260907 3300044684 Bacteria 1043
93 Ga0466963_0317043 3300044694 Bacteria 1097
94 Ga0466963_0554513 3300044694 Bacteria 812
95 Ga0466970_0089340 3300044765 Bacteria 1671
96 Ga0466959_0384262 3300045049 Bacteria 955
97 Ga0466958_0249974 3300045836 Bacteria 1134
98 Ga0495603_0480609 3300046455 Bacteria 711
99 Ga0495641_0014489 3300046461 Bacteria 4261
100 Ga0495651_0154580 3300046462 Bacteria 1650
101 Ga0495582_0121142 3300046473 Bacteria 1474
102 Ga0495664_0006465 3300046477 Bacteria 6476
103 Ga0495608_0105531 3300046511 Bacteria 1814
104 Ga0495666_0242446 3300046526 Bacteria 822
105 Ga0495667_0047000 3300046559 Bacteria 2852
106 Ga0495667_0065799 3300046559 Bacteria 2371
107 Ga0495667_0488693 3300046559 Bacteria 772
108 Ga0495634_0883616 3300046642 Bacteria 506
109 Ga0495635_0013568 3300046663 Bacteria 5702
110 Ga0495588_0097258 3300046674 Bacteria 1545
111 Ga0495657_0010372 3300046675 Bacteria 7012
112 Ga0495657_0129007 3300046675 Bacteria 1586
113 Ga0495657_0147644 3300046675 Bacteria 1462
114 Ga0495646_0184146 3300046680 Bacteria 1145
115 Ga0495647_0047055 3300046681 Bacteria 1663
116 Ga0495613_0067085 3300046689 Bacteria 2619
117 Ga0495613_0554396 3300046689 Bacteria 769
118 Ga0495624_0217191 3300046690 Unclassified 1160
119 Ga0495600_0040140 3300046809 Bacteria 3048
120 Ga0495674_0025125 3300047319 Bacteria 5466
121 Ga0495676_0021082 3300047321 Bacteria 5703
122 Ga0495676_0073288 3300047321 Bacteria 2626
123 Ga0495680_0019903 3300047322 Bacteria 5657
124 Ga0495680_0177850 3300047322 Bacteria 1537
125 Ga0495684_0011683 3300047471 Bacteria 6778
126 Ga0495684_0213244 3300047471 Bacteria 1419
127 Ga0495593_0326509 3300047673 Bacteria 767
128 Ga0496102_0373987 3300048905 Bacteria 1341
129 Ga0496106_0653973 3300048909 Unclassified 840
130 Ga0496109_1226125 3300048912 Bacteria 687
131 Ga0496110_0680589 3300048913 Unclassified 929
132 Ga0496110_1618520 3300048913 Bacteria 558
133 Ga0496112_0388129 3300048915 Bacteria 1337
134 Ga0501031_0229385 3300049568 Unclassified 1208
135 Ga0501032_0085929 3300049569 Unclassified 2091
136 Ga0501033_0251962 3300049570 Bacteria 1251
137 Ga0501036_0089539 3300049572 Bacteria 2600
138 Ga0501036_0588890 3300049572 Bacteria 923
139 Ga0501037_0248333 3300049573 Bacteria 1246
140 Ga0501038_0199140 3300049574 Bacteria 1608
141 Ga0501038_0622761 3300049574 Bacteria 815
142 Ga0501038_0667934 3300049574 Bacteria 781
143 Ga0501039_0110183 3300049575 Bacteria 2152
144 Ga0501040_0042592 3300049576 Bacteria 3093
145 Ga0501040_0187353 3300049576 Bacteria 1468
146 Ga0501041_0159832 3300049577 Bacteria 1408
147 Ga0501042_0035352 3300049578 Bacteria 3545
148 Ga0501042_0142195 3300049578 Bacteria 1730
149 Ga0501046_0098660 3300049580 Bacteria 2243
150 Ga0501046_0577051 3300049580 Bacteria 800
151 Ga0501048_0047848 3300049582 Bacteria 3051
152 Ga0501048_0558466 3300049582 Bacteria 821
153 Ga0501048_0968470 3300049582 Bacteria 612
154 Ga0501068_0629375 3300049584 Bacteria 700
155 Ga0501070_0142840 3300049586 Bacteria 1976
156 Ga0501071_0019356 3300049587 Bacteria 4723
157 Ga0501071_0124637 3300049587 Bacteria 1911
158 Ga0501071_0205749 3300049587 Unclassified 1479
159 Ga0501071_0215143 3300049587 Bacteria 1446
160 Ga0501072_0052230 3300049588 Bacteria 3218
161 Ga0501072_0642848 3300049588 Bacteria 835
162 Ga0501074_0083172 3300049590 Bacteria 2295
163 Ga0501075_0301299 3300049591 Bacteria 1221
164 Ga0501076_0124010 3300049592 Bacteria 2092
165 Ga0501077_0107471 3300049593 Unclassified 1768
166 Ga0501079_0074127 3300049741 Bacteria 2631
167 Ga0501079_0250591 3300049741 Bacteria 1384
168 Ga0501079_0842470 3300049741 Bacteria 722
169 Ga0501080_0705057 3300049742 Bacteria 890
170 Ga0501080_1277452 3300049742 Bacteria 629
171 Ga0501081_0025646 3300049743 Bacteria 3968
172 Ga0501081_0820866 3300049743 Bacteria 700
173 Ga0501045_0161139 3300049824 Bacteria 1670
174 Ga0501045_0210825 3300049824 Bacteria 1447
175 Ga0501045_0389308 3300049824 Bacteria 1037
176 Ga0501045_0455187 3300049824 Bacteria 951
177 nmdc:mga05p37_124766_c1 3300050507 Bacteria 3162
178 nmdc:mga08y16_64175_c1 3300050511 Bacteria 3835
179 Ga0495612_0056570 3300053078 Bacteria 1619
180 Ga0495619_0579288 3300053085 Unclassified 769
181 Ga0501084_0062340 3300054114 Bacteria 3121
182 Ga0501084_0133013 3300054114 Bacteria 2094
183 Ga0590077_020018 3300059426 Bacteria 1419
184 Ga0501082_0050145 3300060353 Bacteria 3600
185 Ga0466962_0139470 3300061719 Bacteria 1174
186 Ga0530510_0052652 3300061734 Bacteria 2941
187 Ga0530510_0235181 3300061734 Unclassified 1363
188 Ga0530510_0281683 3300061734 Bacteria 1242
189 Ga0530510_0342257 3300061734 Bacteria 1123
190 2644446711 2643221679 Bacteria 3839507
191 Ga0207676_11056649
192 JGI24739J22299_10004759
193 JGI24737J22298_10011155
194 JGI24751J29686_10058215
195 rootL2_10084442
196 Ga0070683_100854199
197 Ga0070670_100278309
198 Ga0070682_101458828
199 Ga0070692_10913369
200 Ga0070668_100093407
201 Ga0070703_10000465
202 Ga0070713_100650050
203 Ga0070700_100907095
204 Ga0070708_100012495
205 Ga0070663_100153633
206 Ga0070662_100024573
207 Ga0070706_100003001
208 Ga0070707_101200759
209 Ga0070684_100540023
210 Ga0068853_100395211
211 Ga0070695_101103702
212 Ga0068855_101164047
213 Ga0068857_100148665
214 Ga0068854_100817881
215 Ga0068859_100959660
216 Ga0068858_100721667
217 Ga0068860_100537013
218 Ga0068862_101405235
219 Ga0081455_10328608
220 Ga0070717_10088741
221 Ga0070712_100650968
222 Ga0075428_101091918
223 Ga0097620_100959621
224 Ga0111539_10021944
225 Ga0111539_10062174
226 Ga0111539_10905835
227 Ga0111539_11357210
228 Ga0105245_10360830
229 Ga0114129_10040759
230 Ga0114129_11247465
231 Ga0105242_12549333
232 Ga0105239_12142575
233 Ga0105246_10441932
234 Ga0157314_1012075
235 Ga0157372_10066241
236 Ga0157372_10101043
237 Ga0213874_10040887
238 Ga0207653_10000233
239 Ga0207647_10045425
240 Ga0207684_10000233
241 Ga0207646_10183765
242 Ga0207650_10642150
243 Ga0207687_10237110
244 Ga0207700_10392603
245 Ga0207664_10192313
246 Ga0207706_10007024
247 Ga0207704_10964928
248 Ga0207661_10397851
249 Ga0207712_10829704
250 Ga0207668_10076810
251 Ga0207640_10654365
252 Ga0207658_10603727
253 Ga0207703_10690884
254 Ga0207703_11060106
255 Ga0207639_10354762
256 Ga0207708_10072354
257 Ga0207676_11747721
258 Ga0207674_10166520
259 Ga0207428_10130032
260 Ga0316576_10152044
261 Ga0307405_10265400
262 Ga0307406_10778907
263 Ga0373926_0003980
264 Ga0373936_0066276
265 Ga0373945_0000475
266 Ga0373943_0001814
267 Ga0373943_0028079
268 Ga0373946_0000714
269 Ga0373946_0399395
270 Ga0373935_0007568
271 Ga0373927_0000523
272 Ga0373927_0497412
273 Ga0373947_0000882
274 Ga0373937_0265028
275 Ga0316584_0054752
276 Ga0373925_0000851
277 Ga0395898_0732328
278 Ga0395898_1749656
279 Ga0395901_0987783
280 Ga0436363_0163142
281 Ga0439451_000617
282 Ga0466966_0260907
283 Ga0466963_0317043
284 Ga0466963_0554513
285 Ga0466970_0089340
286 Ga0466959_0384262
287 Ga0466958_0249974
288 Ga0495603_0480609
289 Ga0495641_0014489
290 Ga0495651_0154580
291 Ga0495582_0121142
292 Ga0495664_0006465
293 Ga0495608_0105531
294 Ga0495666_0242446
295 Ga0495667_0047000
296 Ga0495667_0065799
297 Ga0495667_0488693
298 Ga0495634_0883616
299 Ga0495635_0013568
300 Ga0495588_0097258
301 Ga0495657_0010372
302 Ga0495657_0129007
303 Ga0495657_0147644
304 Ga0495646_0184146
305 Ga0495647_0047055
306 Ga0495613_0067085
307 Ga0495613_0554396
308 Ga0495624_0217191
309 Ga0495600_0040140
310 Ga0495674_0025125
311 Ga0495676_0021082
312 Ga0495676_0073288
313 Ga0495680_0019903
314 Ga0495680_0177850
315 Ga0495684_0011683
316 Ga0495684_0213244
317 Ga0495593_0326509
318 Ga0496102_0373987
319 Ga0496106_0653973
320 Ga0496109_1226125
321 Ga0496110_0680589
322 Ga0496110_1618520
323 Ga0496112_0388129
324 Ga0501031_0229385
325 Ga0501032_0085929
326 Ga0501033_0251962
327 Ga0501036_0089539
328 Ga0501036_0588890
329 Ga0501037_0248333
330 Ga0501038_0199140
331 Ga0501038_0622761
332 Ga0501038_0667934
333 Ga0501039_0110183
334 Ga0501040_0042592
335 Ga0501040_0187353
336 Ga0501041_0159832
337 Ga0501042_0035352
338 Ga0501042_0142195
339 Ga0501046_0098660
340 Ga0501046_0577051
341 Ga0501048_0047848
342 Ga0501048_0558466
343 Ga0501048_0968470
344 Ga0501068_0629375
345 Ga0501070_0142840
346 Ga0501071_0019356
347 Ga0501071_0124637
348 Ga0501071_0205749
349 Ga0501071_0215143
350 Ga0501072_0052230
351 Ga0501072_0642848
352 Ga0501074_0083172
353 Ga0501075_0301299
354 Ga0501076_0124010
355 Ga0501077_0107471
356 Ga0501079_0074127
357 Ga0501079_0250591
358 Ga0501079_0842470
359 Ga0501080_0705057
360 Ga0501080_1277452
361 Ga0501081_0025646
362 Ga0501081_0820866
363 Ga0501045_0161139
364 Ga0501045_0210825
365 Ga0501045_0389308
366 Ga0501045_0455187
367 nmdc:mga05p37_124766_c1
368 nmdc:mga08y16_64175_c1
369 Ga0495612_0056570
370 Ga0495619_0579288
371 Ga0501084_0062340
372 Ga0501084_0133013
373 Ga0590077_020018
374 Ga0501082_0050145
375 Ga0466962_0139470
376 Ga0530510_0052652
377 Ga0530510_0235181
378 Ga0530510_0281683
379 Ga0530510_0342257
380 2644446711

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

38

158

0.93

PF02629

CoA_binding

CoA binding domain

37

124

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9282 2 131
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9162 2 129
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.9105 15 124
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.8768 1 139
3ff4-assembly1.cif.gz_A crystal structure of uncharacterized protein chu_1412 0.8738 15 132
ID Description Score Start End Superfamily
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9162 2 129 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9105 15 124 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8611 5 129 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8512 15 138 3.40.50.720
2duwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8402 9 132 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A3N0GL28-F1-model_v4 CoA-binding protein 0.9949 1 156
AF-A0A3N0GL28-F1-model_v4 CoA-binding protein 0.9885 1 156
AF-A0A7Y1Y8B2-F1-model_v4 CoA-binding protein 0.9869 7 111
AF-A0A511JAM3-F1-model_v4 CoA-binding domain-containing protein 0.9824 1 156
AF-A0A538PRK0-F1-model_v4 CoA-binding protein 0.9783 2 156 GO:0016020

Map