F292554

General Info

Members Datasets Scaffolds Average Seq Length
190 119 189 185

Family's Representative Sequence

Representative Sequence 3300014968|Ga0157379_10532008|Ga0157379_105320082
Length 204
Sequence VSKAVLLKAKAKAKSYIMPNPRLAGRYAKSLIDLAIEQNQLDVVYNDMRYLQAVCKSSPEFVTVLRSPVISADKKLKILSAITEANMGQLSILFNKLLVSKTREEYLPEIVTAFIEQYNHMKGIHTVKLTTATPVGEELKQSIVAKIKAETSLQHIELETAVKESLVGGFVLEFDNNLVDASIERDLRDIKKQFSQNIYVQQIR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
92 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
101 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
108 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
113 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
114 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
115 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
116 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
117 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
118 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
119 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.79
Nodule 0
Rhizoplane 0
Rhizosphere 85.26
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3309035 2162886007 Bacteria 1395
2 rootH2_10013229 3300003320 Bacteria 2443
3 rootL2_10079059 3300003322 Bacteria 6338
4 rootL2_10222234 3300003322 Bacteria 1037
5 rootH1_10254719 3300003323 Bacteria 2271
6 Ga0065714_10003358 3300005288 Bacteria 12661
7 Ga0065714_10076304 3300005288 Bacteria 2801
8 Ga0065704_10070203 3300005289 Bacteria 85863
9 Ga0070658_10050640 3300005327 Bacteria 3366
10 Ga0070658_10822204 3300005327 Bacteria 807
11 Ga0070670_100030638 3300005331 Bacteria 4632
12 Ga0070670_100270633 3300005331 Bacteria 1482
13 Ga0068869_100077848 3300005334 Bacteria 2468
14 Ga0070666_10000019 3300005335 Bacteria 185877
15 Ga0068868_100004587 3300005338 Bacteria 9700
16 Ga0068868_100037917 3300005338 Bacteria 3739
17 Ga0068868_100242703 3300005338 Bacteria 1514
18 Ga0070671_100236759 3300005355 Bacteria 1550
19 Ga0070673_100040344 3300005364 Bacteria 3580
20 Ga0070673_100056439 3300005364 Bacteria 3098
21 Ga0070688_100135387 3300005365 Bacteria 1667
22 Ga0070688_100586895 3300005365 Bacteria 851
23 Ga0070667_100004773 3300005367 Bacteria 11350
24 Ga0070667_100156372 3300005367 Bacteria 2005
25 Ga0070667_100698334 3300005367 Bacteria 939
26 Ga0070663_101244587 3300005455 Bacteria 655
27 Ga0070678_100591921 3300005456 Bacteria 989
28 Ga0070679_100076499 3300005530 Bacteria 3336
29 Ga0070684_101024660 3300005535 Bacteria 775
30 Ga0068853_100332689 3300005539 Bacteria 1410
31 Ga0068853_100401876 3300005539 Bacteria 1282
32 Ga0070672_100789414 3300005543 Bacteria 835
33 Ga0070686_100010657 3300005544 Bacteria 5194
34 Ga0070665_100933235 3300005548 Bacteria 880
35 Ga0068857_100329160 3300005577 Bacteria 1412
36 Ga0068857_100706336 3300005577 Bacteria 958
37 Ga0068854_100531876 3300005578 Bacteria 994
38 Ga0068852_100024432 3300005616 Bacteria 4883
39 Ga0068852_100292631 3300005616 Unclassified 1574
40 Ga0068852_100635342 3300005616 Bacteria 1074
41 Ga0068859_100000013 3300005617 Bacteria 291126
42 Ga0068859_100123725 3300005617 Bacteria 2654
43 Ga0068864_100162410 3300005618 Bacteria 2031
44 Ga0068851_10148856 3300005834 Bacteria 1278
45 Ga0068863_100092338 3300005841 Bacteria 2872
46 Ga0068863_100279552 3300005841 Bacteria 1617
47 Ga0068863_100906045 3300005841 Unclassified 882
48 Ga0068858_100011514 3300005842 Bacteria 8346
49 Ga0068860_100000983 3300005843 Bacteria 31545
50 Ga0068860_100004513 3300005843 Bacteria 14204
51 Ga0081539_10000037 3300005985 Bacteria 296160
52 Ga0075366_10070199 3300006195 Bacteria 2086
53 Ga0097621_100003114 3300006237 Bacteria 11380
54 Ga0097621_100220398 3300006237 Bacteria 1653
55 Ga0068871_100001084 3300006358 Bacteria 18266
56 Ga0068871_100375716 3300006358 Bacteria 1262
57 Ga0068871_100783064 3300006358 Bacteria 878
58 Ga0068865_100100677 3300006881 Bacteria 2115
59 Ga0097620_100000013 3300006931 Bacteria 291126
60 Ga0097620_100123729 3300006931 Bacteria 2654
61 Ga0105245_10107478 3300009098 Bacteria 2590
62 Ga0105245_10323809 3300009098 Bacteria 1519
63 Ga0105247_10006772 3300009101 Bacteria 7066
64 Ga0105247_11286670 3300009101 Bacteria 586
65 Ga0105241_10002606 3300009174 Bacteria 13525
66 Ga0105241_10029655 3300009174 Bacteria 4084
67 Ga0105241_10114532 3300009174 Bacteria 2163
68 Ga0105242_10046175 3300009176 Bacteria 3533
69 Ga0105242_10919871 3300009176 Bacteria 876
70 Ga0105237_10004379 3300009545 Bacteria 16371
71 Ga0105237_10005846 3300009545 Bacteria 13803
72 Ga0105237_10717759 3300009545 Bacteria 1006
73 Ga0105238_11155880 3300009551 Bacteria 798
74 Ga0105249_10004185 3300009553 Bacteria 12460
75 Ga0105239_10010375 3300010375 Bacteria 10427
76 Ga0105239_10058529 3300010375 Bacteria 4229
77 Ga0105246_10067018 3300011119 Bacteria 2515
78 Ga0105246_10119038 3300011119 Bacteria 1953
79 Ga0105246_10212485 3300011119 Bacteria 1511
80 Ga0105246_10549130 3300011119 Bacteria 990
81 Ga0157373_10000074 3300013100 Bacteria 86431
82 Ga0157373_10091190 3300013100 Bacteria 2146
83 Ga0157371_10005309 3300013102 Bacteria 10913
84 Ga0157371_10098848 3300013102 Bacteria 2069
85 Ga0157370_10078342 3300013104 Bacteria 3112
86 Ga0157370_11131839 3300013104 Bacteria 707
87 Ga0157369_10118127 3300013105 Bacteria 2815
88 Ga0157369_10366294 3300013105 Bacteria 1496
89 Ga0157369_10883104 3300013105 Unclassified 917
90 Ga0157374_10045802 3300013296 Bacteria 4048
91 Ga0157374_10048094 3300013296 Bacteria 3957
92 Ga0157378_10007505 3300013297 Bacteria 9523
93 Ga0157378_10013361 3300013297 Bacteria 7176
94 Ga0157378_10072790 3300013297 Bacteria 3089
95 Ga0157378_10431710 3300013297 Bacteria 1304
96 Ga0157378_11735557 3300013297 Bacteria 672
97 Ga0163162_10009024 3300013306 Bacteria 9692
98 Ga0157372_10051810 3300013307 Bacteria 4568
99 Ga0157372_10143092 3300013307 Bacteria 2757
100 Ga0157372_10279557 3300013307 Bacteria 1941
101 Ga0157372_10453489 3300013307 Bacteria 1494
102 Ga0157372_10638033 3300013307 Bacteria 1241
103 Ga0157372_10886416 3300013307 Bacteria 1035
104 Ga0157372_12274985 3300013307 Unclassified 623
105 Ga0157375_10416959 3300013308 Bacteria 1509
106 Ga0163163_10209843 3300014325 Bacteria 1996
107 Ga0163163_10981436 3300014325 Bacteria 908
108 Ga0157380_10269648 3300014326 Bacteria 1551
109 Ga0182008_10000002 3300014497 Bacteria 480216
110 Ga0157379_10005200 3300014968 Bacteria 11178
111 Ga0157379_10532008 3300014968 Bacteria 1092
112 Ga0157379_11274832 3300014968 Bacteria 709
113 Ga0157376_10019032 3300014969 Bacteria 5282
114 Ga0157376_11076673 3300014969 Bacteria 829
115 Ga0182006_1004202 3300015261 Bacteria 7145
116 Ga0163161_10079110 3300017792 Bacteria 2417
117 Ga0213876_10008531 3300021384 Bacteria 5548
118 Ga0207426_1000023 3300025302 Bacteria 545465
119 Ga0207426_1100819 3300025302 Bacteria 746
120 Ga0207656_10005561 3300025321 Bacteria 4464
121 Ga0207680_10000094 3300025903 Bacteria 41323
122 Ga0207647_10180106 3300025904 Bacteria 1228
123 Ga0207705_10028007 3300025909 Bacteria 4017
124 Ga0207654_10044802 3300025911 Bacteria 2515
125 Ga0207654_10091427 3300025911 Bacteria 1856
126 Ga0207650_10098306 3300025925 Bacteria 2248
127 Ga0207650_10673515 3300025925 Bacteria 873
128 Ga0207650_11287486 3300025925 Bacteria 622
129 Ga0207687_10270888 3300025927 Bacteria 1357
130 Ga0207704_10070544 3300025938 Bacteria 2213
131 Ga0207691_10315166 3300025940 Bacteria 1342
132 Ga0207691_10416901 3300025940 Bacteria 1144
133 Ga0207689_10000782 3300025942 Bacteria 30527
134 Ga0207651_10043987 3300025960 Bacteria 2985
135 Ga0207712_10004130 3300025961 Bacteria 9169
136 Ga0207640_10597299 3300025981 Bacteria 934
137 Ga0207658_10039973 3300025986 Bacteria 3387
138 Ga0207658_10329123 3300025986 Bacteria 1325
139 Ga0207641_10000159 3300026088 Bacteria 96072
140 Ga0207641_10005767 3300026088 Bacteria 10517
141 Ga0207648_10212494 3300026089 Bacteria 1717
142 Ga0207648_11095825 3300026089 Unclassified 747
143 Ga0207676_10018566 3300026095 Bacteria 5058
144 Ga0207676_10731332 3300026095 Unclassified 961
145 Ga0207674_10420392 3300026116 Bacteria 1291
146 Ga0207683_10621581 3300026121 Bacteria 1000
147 Ga0207698_10113761 3300026142 Bacteria 2275
148 Ga0207698_10490853 3300026142 Bacteria 1193
149 Ga0268264_10001326 3300028381 Bacteria 23282
150 Ga0268264_10003723 3300028381 Bacteria 13100
151 Ga0307515_10000021 3300028794 Bacteria 406008
152 Ga0265338_10043101 3300028800 Bacteria 4191
153 Ga0265325_10262463 3300031241 Bacteria 779
154 Ga0265327_10000030 3300031251 Bacteria 333531
155 Ga0265327_10000497 3300031251 Bacteria 68318
156 Ga0307513_10086994 3300031456 Bacteria 3201
157 Ga0307513_10306541 3300031456 Bacteria 1352
158 Ga0307509_10124528 3300031507 Bacteria 2547
159 Ga0307508_10000981 3300031616 Bacteria 33137
160 Ga0265314_10044350 3300031711 Bacteria 3153
161 Ga0307412_10000038 3300031911 Bacteria 187857
162 Ga0307414_10001512 3300032004 Bacteria 12082
163 Ga0436365_0316918 3300039437 Bacteria 6127
164 Ga0436365_0564152 3300039437 Bacteria 1166
165 Ga0436365_0816951 3300039437 Bacteria 1139
166 Ga0436365_1197929 3300039437 Unclassified 764
167 Ga0436365_1833314 3300039437 Bacteria 5370
168 Ga0436363_1038856 3300039450 Bacteria 648
169 Ga0451849_0608941 3300041505 Unclassified 991
170 Ga0495585_0213431 3300046492 Bacteria 977
171 Ga0495642_0104853 3300046528 Bacteria 1206
172 Ga0495622_0042372 3300046557 Bacteria 2116
173 Ga0495625_0046312 3300046660 Bacteria 3139
174 Ga0495670_0097183 3300046691 Bacteria 1513
175 Ga0495636_0000083 3300047318 Bacteria 39815
176 Ga0501300_004046 3300049523 Bacteria 2179
177 Ga0501034_0000004 3300049571 Bacteria 382255
178 Ga0501037_0131835 3300049573 Bacteria 1792
179 Ga0501038_0610771 3300049574 Bacteria 824
180 Ga0501080_0597999 3300049742 Bacteria 979
181 Ga0501044_0062860 3300049823 Bacteria 3794
182 nmdc:mga0k408_24462_c1 3300050493 Bacteria 3413
183 Ga0500646_0003349 3300053090 Bacteria 4115
184 Ga0500646_0028975 3300053090 Bacteria 1514
185 Ga0500651_0000229 3300053093 Bacteria 34863
186 Ga0500559_0014548 3300053136 Bacteria 3326
187 Ga0500588_0025042 3300053146 Bacteria 1654
188 Ga0500616_0006212 3300053153 Bacteria 7882
189 Ga0500622_0325782 3300053156 Unclassified 646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053136 Ga0500559_0014548 Ga0500559_0014548_762_1325 142
2 3300014325 Ga0163163_10981436 Ga0163163_109814361 143
3 3300005577 Ga0068857_100329160 Ga0068857_1003291602 144
4 3300009101 Ga0105247_11286670 Ga0105247_112866701 144
5 3300009176 Ga0105242_10919871 Ga0105242_109198711 144
6 3300011119 Ga0105246_10549130 Ga0105246_105491301 144
7 3300026116 Ga0207674_10420392 Ga0207674_104203922 144
8 3300031616 Ga0307508_10000981 Ga0307508_1000098125 150
9 3300041505 Ga0451849_0608941 Ga0451849_0608941_12_575 151
10 iso_pu_bacteria 2914759650 2914762645 153
11 3300014497 Ga0182008_10000002 Ga0182008_10000002245 154
12 3300053093 Ga0500651_0000229 Ga0500651_0000229_27146_27694 155
13 2162886007 SwRhRL2b_contig_3309035 SwRhRL2b_0570.00003060 157
14 3300003320 rootH2_10013229 rootH2_100132292 157
15 3300003322 rootL2_10079059 rootL2_100790596 157
16 3300003322 rootL2_10222234 rootL2_102222342 157
17 3300003323 rootH1_10254719 rootH1_102547191 157
18 3300005288 Ga0065714_10003358 Ga0065714_1000335811 157
19 3300005288 Ga0065714_10076304 Ga0065714_100763041 157
20 3300005289 Ga0065704_10070203 Ga0065704_1007020362 157
21 3300005327 Ga0070658_10050640 Ga0070658_100506402 157
22 3300005327 Ga0070658_10822204 Ga0070658_108222042 157
23 3300005331 Ga0070670_100030638 Ga0070670_1000306384 157
24 3300005331 Ga0070670_100270633 Ga0070670_1002706332 157
25 3300005334 Ga0068869_100077848 Ga0068869_1000778481 157
26 3300005335 Ga0070666_10000019 Ga0070666_1000001931 157
27 3300005338 Ga0068868_100004587 Ga0068868_1000045877 157
28 3300005338 Ga0068868_100037917 Ga0068868_1000379176 157
29 3300005338 Ga0068868_100242703 Ga0068868_1002427032 157
30 3300005355 Ga0070671_100236759 Ga0070671_1002367592 157
31 3300005364 Ga0070673_100040344 Ga0070673_1000403443 157
32 3300005364 Ga0070673_100056439 Ga0070673_1000564391 157
33 3300005365 Ga0070688_100135387 Ga0070688_1001353872 157
34 3300005365 Ga0070688_100586895 Ga0070688_1005868951 157
35 3300005367 Ga0070667_100004773 Ga0070667_1000047734 157
36 3300005367 Ga0070667_100156372 Ga0070667_1001563722 157
37 3300005367 Ga0070667_100698334 Ga0070667_1006983341 157
38 3300005455 Ga0070663_101244587 Ga0070663_1012445871 157
39 3300005456 Ga0070678_100591921 Ga0070678_1005919212 157
40 3300005530 Ga0070679_100076499 Ga0070679_1000764992 157
41 3300005535 Ga0070684_101024660 Ga0070684_1010246601 157
42 3300005539 Ga0068853_100332689 Ga0068853_1003326892 157
43 3300005539 Ga0068853_100401876 Ga0068853_1004018762 157
44 3300005543 Ga0070672_100789414 Ga0070672_1007894141 157
45 3300005544 Ga0070686_100010657 Ga0070686_1000106576 157
46 3300005548 Ga0070665_100933235 Ga0070665_1009332352 157
47 3300005577 Ga0068857_100706336 Ga0068857_1007063362 157
48 3300005578 Ga0068854_100531876 Ga0068854_1005318761 157
49 3300005616 Ga0068852_100024432 Ga0068852_1000244324 157
50 3300005616 Ga0068852_100292631 Ga0068852_1002926312 157
51 3300005616 Ga0068852_100635342 Ga0068852_1006353422 157
52 3300005617 Ga0068859_100000013 Ga0068859_10000001371 157
53 3300005617 Ga0068859_100123725 Ga0068859_1001237252 157
54 3300005618 Ga0068864_100162410 Ga0068864_1001624101 157
55 3300005834 Ga0068851_10148856 Ga0068851_101488562 157
56 3300005841 Ga0068863_100092338 Ga0068863_1000923382 157
57 3300005841 Ga0068863_100279552 Ga0068863_1002795523 157
58 3300005841 Ga0068863_100906045 Ga0068863_1009060452 157
59 3300005842 Ga0068858_100011514 Ga0068858_1000115141 157
60 3300005843 Ga0068860_100000983 Ga0068860_1000009834 157
61 3300005843 Ga0068860_100004513 Ga0068860_10000451310 157
62 3300005985 Ga0081539_10000037 Ga0081539_10000037140 157
63 3300006195 Ga0075366_10070199 Ga0075366_100701993 157
64 3300006237 Ga0097621_100003114 Ga0097621_10000311411 157
65 3300006237 Ga0097621_100220398 Ga0097621_1002203982 157
66 3300006358 Ga0068871_100001084 Ga0068871_10000108410 157
67 3300006358 Ga0068871_100375716 Ga0068871_1003757162 157
68 3300006358 Ga0068871_100783064 Ga0068871_1007830642 157
69 3300006881 Ga0068865_100100677 Ga0068865_1001006772 157
70 3300006931 Ga0097620_100000013 Ga0097620_10000001371 157
71 3300006931 Ga0097620_100123729 Ga0097620_1001237292 157
72 3300009098 Ga0105245_10107478 Ga0105245_101074784 157
73 3300009098 Ga0105245_10323809 Ga0105245_103238092 157
74 3300009101 Ga0105247_10006772 Ga0105247_100067721 157
75 3300009174 Ga0105241_10002606 Ga0105241_100026064 157
76 3300009174 Ga0105241_10029655 Ga0105241_100296553 157
77 3300009174 Ga0105241_10114532 Ga0105241_101145324 157
78 3300009176 Ga0105242_10046175 Ga0105242_100461752 157
79 3300009545 Ga0105237_10004379 Ga0105237_100043792 157
80 3300009545 Ga0105237_10005846 Ga0105237_1000584613 157
81 3300009545 Ga0105237_10717759 Ga0105237_107177591 157
82 3300009551 Ga0105238_11155880 Ga0105238_111558801 157
83 3300009553 Ga0105249_10004185 Ga0105249_100041854 157
84 3300010375 Ga0105239_10010375 Ga0105239_100103758 157
85 3300010375 Ga0105239_10058529 Ga0105239_100585292 157
86 3300011119 Ga0105246_10067018 Ga0105246_100670183 157
87 3300011119 Ga0105246_10119038 Ga0105246_101190381 157
88 3300011119 Ga0105246_10212485 Ga0105246_102124853 157
89 3300013100 Ga0157373_10000074 Ga0157373_1000007416 157
90 3300013100 Ga0157373_10091190 Ga0157373_100911901 157
91 3300013102 Ga0157371_10005309 Ga0157371_1000530912 157
92 3300013102 Ga0157371_10098848 Ga0157371_100988482 157
93 3300013104 Ga0157370_10078342 Ga0157370_100783423 157
94 3300013104 Ga0157370_11131839 Ga0157370_111318391 157
95 3300013105 Ga0157369_10118127 Ga0157369_101181272 157
96 3300013105 Ga0157369_10366294 Ga0157369_103662942 157
97 3300013105 Ga0157369_10883104 Ga0157369_108831042 157
98 3300013296 Ga0157374_10045802 Ga0157374_100458024 157
99 3300013296 Ga0157374_10048094 Ga0157374_100480943 157
100 3300013297 Ga0157378_10007505 Ga0157378_100075058 157
101 3300013297 Ga0157378_10013361 Ga0157378_100133612 157
102 3300013297 Ga0157378_10072790 Ga0157378_100727902 157
103 3300013297 Ga0157378_10431710 Ga0157378_104317101 157
104 3300013297 Ga0157378_11735557 Ga0157378_117355571 157
105 3300013306 Ga0163162_10009024 Ga0163162_100090244 157
106 3300013307 Ga0157372_10051810 Ga0157372_100518104 157
107 3300013307 Ga0157372_10143092 Ga0157372_101430924 157
108 3300013307 Ga0157372_10279557 Ga0157372_102795573 157
109 3300013307 Ga0157372_10453489 Ga0157372_104534892 157
110 3300013307 Ga0157372_10638033 Ga0157372_106380331 157
111 3300013307 Ga0157372_10886416 Ga0157372_108864162 157
112 3300013307 Ga0157372_12274985 Ga0157372_122749851 157
113 3300013308 Ga0157375_10416959 Ga0157375_104169592 157
114 3300014325 Ga0163163_10209843 Ga0163163_102098432 157
115 3300014326 Ga0157380_10269648 Ga0157380_102696482 157
116 3300014968 Ga0157379_10005200 Ga0157379_1000520010 157
117 3300014968 Ga0157379_10532008 Ga0157379_105320082 157
118 3300014968 Ga0157379_11274832 Ga0157379_112748321 157
119 3300014969 Ga0157376_10019032 Ga0157376_100190323 157
120 3300014969 Ga0157376_11076673 Ga0157376_110766731 157
121 3300015261 Ga0182006_1004202 Ga0182006_10042023 157
122 3300017792 Ga0163161_10079110 Ga0163161_100791102 157
123 3300021384 Ga0213876_10008531 Ga0213876_100085312 157
124 3300025302 Ga0207426_1000023 Ga0207426_1000023309 157
125 3300025302 Ga0207426_1100819 Ga0207426_11008192 157
126 3300025321 Ga0207656_10005561 Ga0207656_100055616 157
127 3300025903 Ga0207680_10000094 Ga0207680_1000009431 157
128 3300025904 Ga0207647_10180106 Ga0207647_101801062 157
129 3300025909 Ga0207705_10028007 Ga0207705_100280072 157
130 3300025911 Ga0207654_10044802 Ga0207654_100448022 157
131 3300025911 Ga0207654_10091427 Ga0207654_100914272 157
132 3300025925 Ga0207650_10098306 Ga0207650_100983064 157
133 3300025925 Ga0207650_10673515 Ga0207650_106735151 157
134 3300025925 Ga0207650_11287486 Ga0207650_112874861 157
135 3300025927 Ga0207687_10270888 Ga0207687_102708882 157
136 3300025938 Ga0207704_10070544 Ga0207704_100705442 157
137 3300025940 Ga0207691_10315166 Ga0207691_103151661 157
138 3300025940 Ga0207691_10416901 Ga0207691_104169012 157
139 3300025942 Ga0207689_10000782 Ga0207689_1000078215 157
140 3300025960 Ga0207651_10043987 Ga0207651_100439873 157
141 3300025961 Ga0207712_10004130 Ga0207712_100041304 157
142 3300025981 Ga0207640_10597299 Ga0207640_105972992 157
143 3300025986 Ga0207658_10039973 Ga0207658_100399734 157
144 3300025986 Ga0207658_10329123 Ga0207658_103291231 157
145 3300026088 Ga0207641_10000159 Ga0207641_100001595 157
146 3300026088 Ga0207641_10005767 Ga0207641_100057672 157
147 3300026089 Ga0207648_10212494 Ga0207648_102124943 157
148 3300026089 Ga0207648_11095825 Ga0207648_110958251 157
149 3300026095 Ga0207676_10018566 Ga0207676_100185662 157
150 3300026095 Ga0207676_10731332 Ga0207676_107313322 157
151 3300026121 Ga0207683_10621581 Ga0207683_106215812 157
152 3300026142 Ga0207698_10113761 Ga0207698_101137612 157
153 3300026142 Ga0207698_10490853 Ga0207698_104908531 157
154 3300028381 Ga0268264_10001326 Ga0268264_1000132611 157
155 3300028381 Ga0268264_10003723 Ga0268264_100037236 157
156 3300028794 Ga0307515_10000021 Ga0307515_10000021335 157
157 3300028800 Ga0265338_10043101 Ga0265338_100431013 157
158 3300031241 Ga0265325_10262463 Ga0265325_102624631 157
159 3300031251 Ga0265327_10000030 Ga0265327_10000030276 157
160 3300031251 Ga0265327_10000497 Ga0265327_100004977 157
161 3300031456 Ga0307513_10086994 Ga0307513_100869942 157
162 3300031456 Ga0307513_10306541 Ga0307513_103065413 157
163 3300031507 Ga0307509_10124528 Ga0307509_101245282 157
164 3300031711 Ga0265314_10044350 Ga0265314_100443504 157
165 3300031911 Ga0307412_10000038 Ga0307412_10000038107 157
166 3300032004 Ga0307414_10001512 Ga0307414_100015125 157
167 3300039437 Ga0436365_0316918 Ga0436365_0316918_4290_4853 157
168 3300039437 Ga0436365_0564152 Ga0436365_0564152_480_1046 157
169 3300039437 Ga0436365_0816951 Ga0436365_0816951_347_913 157
170 3300039437 Ga0436365_1197929 Ga0436365_1197929_171_737 157
171 3300039437 Ga0436365_1833314 Ga0436365_1833314_3465_4031 157
172 3300039450 Ga0436363_1038856 Ga0436363_1038856_33_599 157
173 3300046492 Ga0495585_0213431 Ga0495585_0213431_90_653 157
174 3300046528 Ga0495642_0104853 Ga0495642_0104853_311_874 157
175 3300046557 Ga0495622_0042372 Ga0495622_0042372_1304_1867 157
176 3300046660 Ga0495625_0046312 Ga0495625_0046312_101_664 157
177 3300046691 Ga0495670_0097183 Ga0495670_0097183_685_1248 157
178 3300047318 Ga0495636_0000083 Ga0495636_0000083_12351_12914 157
179 3300049523 Ga0501300_004046 Ga0501300_004046_1021_1584 157
180 3300049571 Ga0501034_0000004 Ga0501034_0000004_377055_377618 157
181 3300049573 Ga0501037_0131835 Ga0501037_0131835_593_1159 157
182 3300049574 Ga0501038_0610771 Ga0501038_0610771_67_633 157
183 3300049742 Ga0501080_0597999 Ga0501080_0597999_36_602 157
184 3300049823 Ga0501044_0062860 Ga0501044_0062860_1635_2201 157
185 3300050493 nmdc:mga0k408_24462_c1 nmdc:mga0k408_24462_c1_2608_3171 157
186 3300053090 Ga0500646_0003349 Ga0500646_0003349_2709_3272 157
187 3300053090 Ga0500646_0028975 Ga0500646_0028975_391_954 157
188 3300053146 Ga0500588_0025042 Ga0500588_0025042_496_1059 157
189 3300053153 Ga0500616_0006212 Ga0500616_0006212_5271_5834 157
190 3300053156 Ga0500622_0325782 Ga0500622_0325782_20_583 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

23

194

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ojc-assembly1.cif.gz_A saftsz(q48a) complexed with gdp 0.8034 80 132
3voa-assembly1.cif.gz_A staphylococcus aureus ftsz 12-316 gdp-form 0.7994 80 132
7ojb-assembly1.cif.gz_A saftsz(r143k) complexed with gdp 0.799 80 132
7ojd-assembly1.cif.gz_A saftsz(d46a) complexed with gdp 0.7935 80 132
7ohk-assembly1.cif.gz_A saftsz complexed with gdp, bef3- and mg2+ 0.7882 80 132
ID Description Score Start End Superfamily
af_P9WNL3_375_455_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.897 84 121 3.30.300.20
af_Q84R40_123_196_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.8346 82 150 3.30.2320.30
af_Q0IZQ8_101_346_3.40.50.1440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tubulin/FtsZ, GTPase domain 0.8275 81 130 3.40.50.1440
af_Q6F6B5_116_365_3.40.50.1440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tubulin/FtsZ, GTPase domain 0.8204 81 132 3.40.50.1440
af_K7LLW6_114_369_3.40.50.1440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Tubulin/FtsZ, GTPase domain 0.8176 82 132 3.40.50.1440
ID Description Score Start End GO Terms
AF-A0A7S2SXE2-F1-model_v4 Uncharacterized protein 0.9159 45 138 GO:0016020
GO:0046933
AF-A0A7S3MIY8-F1-model_v4 ATP synthase subunit O, mitochondrial 0.9095 39 133 GO:0016020
GO:0046933
AF-A0A4D9BFE9-F1-model_v4 deleted 0.888 30 143
AF-A0A822ZW30-F1-model_v4 Uncharacterized protein 0.8822 61 139 GO:0016020
GO:0046933
AF-A0A7S2SXE2-F1-model_v4 Uncharacterized protein 0.8569 45 138 GO:0016020
GO:0046933

Feature Viewer

pLDDT pTM Quality
76.64 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map