F292481

General Info

Members Datasets Scaffolds Average Seq Length
190 141 380 119

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10196018|Ga0105246_101960182
Length 145
Sequence VNSPVSISRGPVCLIGDHSNPHEEDPMRYLLLIHQGETPTPRDPEAWARLSDAEQQAVFADYQAINQTPGVTPGEQMGPPEAATTVRVEDGRPLVTDGPFAAMKEALGGYLFYEADDLDAAIALAARIPAARLGGAVEVRPVGGW

Samples

Sample ID Description Type Environment
1 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
27 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
28 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
68 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
70 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
74 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
75 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
76 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
77 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
90 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
91 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
101 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
129 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
140 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.74
Nodule 0
Rhizoplane 14.21
Rhizosphere 80.53
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105246_10196018 3300011119 Bacteria 1567
2 JGI25407J50210_10012473 3300003373 Bacteria 2179
3 JGI25407J50210_10058311 3300003373 Bacteria 972
4 JGI25407J50210_10089051 3300003373 Unclassified 764
5 JGI25405J52794_10140721 3300003911 Bacteria 548
6 Ga0068869_101540619 3300005334 Bacteria 591
7 Ga0068868_100245103 3300005338 Bacteria 1507
8 Ga0070691_11063663 3300005341 Bacteria 508
9 Ga0070687_101173493 3300005343 Bacteria 565
10 Ga0070671_100416913 3300005355 Bacteria 1150
11 Ga0070673_102051766 3300005364 Bacteria 543
12 Ga0070713_100814053 3300005436 Bacteria 896
13 Ga0070701_10761023 3300005438 Bacteria 657
14 Ga0070705_100000534 3300005440 Bacteria 21958
15 Ga0070708_100590568 3300005445 Bacteria 1047
16 Ga0070678_100813602 3300005456 Bacteria 849
17 Ga0070706_100046263 3300005467 Bacteria 4017
18 Ga0070707_101822729 3300005468 Bacteria 576
19 Ga0070698_100001207 3300005471 Bacteria 28694
20 Ga0070699_100682768 3300005518 Bacteria 938
21 Ga0070679_100374551 3300005530 Bacteria 1370
22 Ga0070696_100107862 3300005546 Bacteria 2003
23 Ga0068857_100977885 3300005577 Bacteria 814
24 Ga0068861_101140248 3300005719 Bacteria 751
25 Ga0081455_10004805 3300005937 Bacteria 15008
26 Ga0081455_10151729 3300005937 Bacteria 1786
27 Ga0081455_10306136 3300005937 Bacteria 1138
28 Ga0081455_10707456 3300005937 Bacteria 641
29 Ga0081538_10000158 3300005981 Bacteria 71138
30 Ga0081538_10000413 3300005981 Bacteria 48274
31 Ga0081538_10019035 3300005981 Bacteria 5125
32 Ga0081538_10040598 3300005981 Bacteria 2965
33 Ga0081538_10138944 3300005981 Bacteria 1125
34 Ga0081538_10251499 3300005981 Bacteria 673
35 Ga0075365_10042398 3300006038 Bacteria 2975
36 Ga0075363_100010375 3300006048 Bacteria 4420
37 Ga0075364_10083590 3300006051 Bacteria 2113
38 Ga0075432_10105569 3300006058 Bacteria 1045
39 Ga0070712_100592354 3300006175 Bacteria 938
40 Ga0075367_10370988 3300006178 Bacteria 904
41 Ga0075370_10257709 3300006353 Bacteria 1034
42 Ga0075431_100002101 3300006847 Bacteria 19043
43 Ga0075431_100357828 3300006847 Bacteria 1467
44 Ga0075429_100017250 3300006880 Bacteria 6245
45 Ga0075436_100124057 3300006914 Bacteria 1809
46 Ga0075436_100125628 3300006914 Bacteria 1797
47 Ga0075435_100334573 3300007076 Bacteria 1297
48 Ga0099794_10613748 3300007265 Bacteria 576
49 Ga0111539_10010286 3300009094 Bacteria 11778
50 Ga0105245_12791079 3300009098 Bacteria 541
51 Ga0105247_11361520 3300009101 Bacteria 573
52 Ga0114129_10064956 3300009147 Bacteria 5093
53 Ga0114129_10152217 3300009147 Bacteria 3165
54 Ga0114129_10420557 3300009147 Bacteria 1758
55 Ga0105243_10401584 3300009148 Bacteria 1273
56 Ga0105242_10703083 3300009176 Bacteria 989
57 Ga0105237_11889916 3300009545 Bacteria 605
58 Ga0105249_10786647 3300009553 Bacteria 1015
59 Ga0105239_10196422 3300010375 Bacteria 2259
60 Ga0105239_11306785 3300010375 Bacteria 837
61 Ga0105239_13214531 3300010375 Bacteria 532
62 Ga0157373_10620079 3300013100 Bacteria 788
63 Ga0163162_11822329 3300013306 Bacteria 696
64 Ga0157372_10667067 3300013307 Bacteria 1211
65 Ga0163163_10114496 3300014325 Bacteria 2728
66 Ga0163163_10210374 3300014325 Bacteria 1994
67 Ga0207642_10038847 3300025899 Bacteria 2063
68 Ga0207688_10188232 3300025901 Bacteria 1233
69 Ga0207647_10589863 3300025904 Bacteria 614
70 Ga0207684_10408217 3300025910 Bacteria 1167
71 Ga0207684_10981187 3300025910 Bacteria 707
72 Ga0207693_10453183 3300025915 Bacteria 1002
73 Ga0207687_11197506 3300025927 Bacteria 653
74 Ga0207700_10000001 3300025928 Bacteria 1122509
75 Ga0207644_10492846 3300025931 Bacteria 1010
76 Ga0207686_10051176 3300025934 Bacteria 2572
77 Ga0207709_10035419 3300025935 Bacteria 2951
78 Ga0207709_10227133 3300025935 Bacteria 1350
79 Ga0207709_10384468 3300025935 Bacteria 1069
80 Ga0207704_10182306 3300025938 Bacteria 1518
81 Ga0207711_10598357 3300025941 Bacteria 1029
82 Ga0207689_10466797 3300025942 Bacteria 1056
83 Ga0207689_10974461 3300025942 Bacteria 715
84 Ga0207640_10411565 3300025981 Bacteria 1104
85 Ga0207677_10057005 3300026023 Bacteria 2680
86 Ga0207674_10312566 3300026116 Bacteria 1520
87 Ga0207675_100166584 3300026118 Bacteria 2105
88 Ga0207428_10158300 3300027907 Bacteria 1721
89 Ga0268265_10536077 3300028380 Bacteria 1109
90 Ga0307406_10260424 3300031901 Bacteria 1312
91 Ga0307407_10358307 3300031903 Bacteria 1035
92 Ga0307409_100545635 3300031995 Bacteria 1137
93 Ga0307416_100468862 3300032002 Bacteria 1316
94 Ga0307415_100048390 3300032126 Bacteria 2869
95 Ga0307415_100075986 3300032126 Bacteria 2380
96 Ga0373943_0006879 3300035170 Bacteria 5100
97 Ga0373946_0159803 3300035171 Bacteria 1057
98 Ga0373935_0286119 3300035692 Bacteria 1162
99 Ga0373927_0219031 3300035695 Bacteria 1250
100 Ga0373947_0001154 3300035725 Bacteria 16203
101 Ga0373937_0811787 3300036401 Bacteria 883
102 Ga0373937_1190286 3300036401 Bacteria 710
103 Ga0373925_0346597 3300037068 Bacteria 1205
104 Ga0395899_0028737 3300037312 Bacteria 4184
105 Ga0395899_0745724 3300037312 Bacteria 610
106 Ga0395900_0014893 3300037418 Bacteria 7923
107 Ga0395900_0258921 3300037418 Bacteria 1738
108 Ga0395900_0311443 3300037418 Bacteria 1557
109 Ga0395898_0010759 3300037466 Bacteria 9556
110 Ga0395898_0039219 3300037466 Bacteria 4689
111 Ga0395898_0326111 3300037466 Bacteria 1464
112 Ga0395898_0721284 3300037466 Bacteria 939
113 Ga0395898_0867938 3300037466 Bacteria 841
114 Ga0395905_0167920 3300037471 Bacteria 2062
115 Ga0395905_0367174 3300037471 Bacteria 1332
116 Ga0395905_0474124 3300037471 Bacteria 1151
117 Ga0395901_0021222 3300038443 Bacteria 6652
118 Ga0395901_0035909 3300038443 Bacteria 5121
119 Ga0395901_0114625 3300038443 Bacteria 2831
120 Ga0395901_0186610 3300038443 Bacteria 2175
121 Ga0395901_0370071 3300038443 Bacteria 1476
122 Ga0395901_0697417 3300038443 Bacteria 1013
123 Ga0436365_1072009 3300039437 Bacteria 2113
124 Ga0451804_0138471 3300041463 Bacteria 706
125 Ga0466966_0839012 3300044684 Unclassified 554
126 Ga0466970_0600765 3300044765 Bacteria 638
127 Ga0466967_0474269 3300045976 Bacteria 1225
128 Ga0495603_0086244 3300046455 Bacteria 1838
129 Ga0495603_0142008 3300046455 Bacteria 1396
130 Ga0495653_0333369 3300046463 Bacteria 980
131 Ga0495580_0520451 3300046472 Bacteria 793
132 Ga0495582_0507218 3300046473 Bacteria 697
133 Ga0495609_0239283 3300046538 Bacteria 750
134 Ga0495635_0235948 3300046663 Bacteria 1235
135 Ga0495657_0332955 3300046675 Bacteria 901
136 Ga0495604_0458139 3300047317 Bacteria 832
137 Ga0495680_0116676 3300047322 Bacteria 1974
138 Ga0495677_0271667 3300047445 Bacteria 665
139 Ga0495677_0400865 3300047445 Bacteria 543
140 Ga0495684_0797418 3300047471 Bacteria 617
141 Ga0495593_0248478 3300047673 Bacteria 891
142 Ga0496100_0519533 3300048903 Bacteria 919
143 Ga0496101_0046662 3300048904 Bacteria 3108
144 Ga0496102_0033223 3300048905 Bacteria 4635
145 Ga0496103_0328694 3300048906 Bacteria 983
146 Ga0496104_0021140 3300048907 Bacteria 5971
147 Ga0496104_0122984 3300048907 Bacteria 2491
148 Ga0496104_0444780 3300048907 Bacteria 1208
149 Ga0496105_0002474 3300048908 Bacteria 13371
150 Ga0496105_0152262 3300048908 Bacteria 1900
151 Ga0496106_0691833 3300048909 Bacteria 813
152 Ga0496107_0220707 3300048910 Bacteria 1410
153 Ga0496108_0095370 3300048911 Bacteria 2533
154 Ga0496108_0156374 3300048911 Bacteria 1969
155 Ga0496109_0034976 3300048912 Bacteria 4529
156 Ga0496109_0382318 3300048912 Bacteria 1330
157 Ga0496110_0054703 3300048913 Bacteria 3511
158 Ga0496110_0390675 3300048913 Bacteria 1268
159 Ga0496111_0053622 3300048914 Bacteria 2914
160 Ga0496111_0259578 3300048914 Bacteria 1289
161 Ga0496112_0066228 3300048915 Bacteria 3564
162 Ga0496112_0114651 3300048915 Bacteria 2665
163 Ga0496112_0210225 3300048915 Bacteria 1903
164 Ga0496113_0158359 3300048916 Bacteria 1789
165 Ga0496113_0684736 3300048916 Bacteria 819
166 Ga0496114_0325358 3300048917 Bacteria 1359
167 Ga0496115_0279149 3300048918 Bacteria 1372
168 Ga0501034_0570359 3300049571 Bacteria 1040
169 Ga0501038_0080262 3300049574 Bacteria 2750
170 Ga0501040_0417707 3300049576 Bacteria 964
171 Ga0501046_1071185 3300049580 Bacteria 558
172 Ga0501047_0292205 3300049581 Bacteria 1473
173 Ga0501067_0076348 3300049583 Bacteria 1856
174 Ga0501068_0792846 3300049584 Bacteria 621
175 Ga0501070_1346200 3300049586 Bacteria 544
176 Ga0501071_1225864 3300049587 Bacteria 580
177 Ga0501073_0906702 3300049589 Unclassified 607
178 Ga0501077_0125336 3300049593 Bacteria 1628
179 Ga0501079_0903737 3300049741 Bacteria 695
180 nmdc:mga03n38_570952_c1 3300050490 Bacteria 642
181 nmdc:mga00v17_369909_c1 3300050491 Bacteria 932
182 nmdc:mga06z11_156568_c1 3300050494 Bacteria 1299
183 nmdc:mga07m45_151403_c1 3300050496 Bacteria 1345
184 nmdc:mga05p37_370979_c1 3300050507 Bacteria 1679
185 nmdc:mga09592_10767_c1 3300050508 Bacteria 7435
186 nmdc:mga06r32_254560_c1 3300050510 Bacteria 1743
187 nmdc:mga0n895_1057350_c1 3300050512 Bacteria 791
188 Ga0495601_0087576 3300053077 Bacteria 2002
189 Ga0495612_0059442 3300053078 Bacteria 1581
190 Ga0590075_015308 3300059424 Bacteria 1882
191 Ga0105246_10196018
192 JGI25407J50210_10012473
193 JGI25407J50210_10058311
194 JGI25407J50210_10089051
195 JGI25405J52794_10140721
196 Ga0068869_101540619
197 Ga0068868_100245103
198 Ga0070691_11063663
199 Ga0070687_101173493
200 Ga0070671_100416913
201 Ga0070673_102051766
202 Ga0070713_100814053
203 Ga0070701_10761023
204 Ga0070705_100000534
205 Ga0070708_100590568
206 Ga0070678_100813602
207 Ga0070706_100046263
208 Ga0070707_101822729
209 Ga0070698_100001207
210 Ga0070699_100682768
211 Ga0070679_100374551
212 Ga0070696_100107862
213 Ga0068857_100977885
214 Ga0068861_101140248
215 Ga0081455_10004805
216 Ga0081455_10151729
217 Ga0081455_10306136
218 Ga0081455_10707456
219 Ga0081538_10000158
220 Ga0081538_10000413
221 Ga0081538_10019035
222 Ga0081538_10040598
223 Ga0081538_10138944
224 Ga0081538_10251499
225 Ga0075365_10042398
226 Ga0075363_100010375
227 Ga0075364_10083590
228 Ga0075432_10105569
229 Ga0070712_100592354
230 Ga0075367_10370988
231 Ga0075370_10257709
232 Ga0075431_100002101
233 Ga0075431_100357828
234 Ga0075429_100017250
235 Ga0075436_100124057
236 Ga0075436_100125628
237 Ga0075435_100334573
238 Ga0099794_10613748
239 Ga0111539_10010286
240 Ga0105245_12791079
241 Ga0105247_11361520
242 Ga0114129_10064956
243 Ga0114129_10152217
244 Ga0114129_10420557
245 Ga0105243_10401584
246 Ga0105242_10703083
247 Ga0105237_11889916
248 Ga0105249_10786647
249 Ga0105239_10196422
250 Ga0105239_11306785
251 Ga0105239_13214531
252 Ga0157373_10620079
253 Ga0163162_11822329
254 Ga0157372_10667067
255 Ga0163163_10114496
256 Ga0163163_10210374
257 Ga0207642_10038847
258 Ga0207688_10188232
259 Ga0207647_10589863
260 Ga0207684_10408217
261 Ga0207684_10981187
262 Ga0207693_10453183
263 Ga0207687_11197506
264 Ga0207700_10000001
265 Ga0207644_10492846
266 Ga0207686_10051176
267 Ga0207709_10035419
268 Ga0207709_10227133
269 Ga0207709_10384468
270 Ga0207704_10182306
271 Ga0207711_10598357
272 Ga0207689_10466797
273 Ga0207689_10974461
274 Ga0207640_10411565
275 Ga0207677_10057005
276 Ga0207674_10312566
277 Ga0207675_100166584
278 Ga0207428_10158300
279 Ga0268265_10536077
280 Ga0307406_10260424
281 Ga0307407_10358307
282 Ga0307409_100545635
283 Ga0307416_100468862
284 Ga0307415_100048390
285 Ga0307415_100075986
286 Ga0373943_0006879
287 Ga0373946_0159803
288 Ga0373935_0286119
289 Ga0373927_0219031
290 Ga0373947_0001154
291 Ga0373937_0811787
292 Ga0373937_1190286
293 Ga0373925_0346597
294 Ga0395899_0028737
295 Ga0395899_0745724
296 Ga0395900_0014893
297 Ga0395900_0258921
298 Ga0395900_0311443
299 Ga0395898_0010759
300 Ga0395898_0039219
301 Ga0395898_0326111
302 Ga0395898_0721284
303 Ga0395898_0867938
304 Ga0395905_0167920
305 Ga0395905_0367174
306 Ga0395905_0474124
307 Ga0395901_0021222
308 Ga0395901_0035909
309 Ga0395901_0114625
310 Ga0395901_0186610
311 Ga0395901_0370071
312 Ga0395901_0697417
313 Ga0436365_1072009
314 Ga0451804_0138471
315 Ga0466966_0839012
316 Ga0466970_0600765
317 Ga0466967_0474269
318 Ga0495603_0086244
319 Ga0495603_0142008
320 Ga0495653_0333369
321 Ga0495580_0520451
322 Ga0495582_0507218
323 Ga0495609_0239283
324 Ga0495635_0235948
325 Ga0495657_0332955
326 Ga0495604_0458139
327 Ga0495680_0116676
328 Ga0495677_0271667
329 Ga0495677_0400865
330 Ga0495684_0797418
331 Ga0495593_0248478
332 Ga0496100_0519533
333 Ga0496101_0046662
334 Ga0496102_0033223
335 Ga0496103_0328694
336 Ga0496104_0021140
337 Ga0496104_0122984
338 Ga0496104_0444780
339 Ga0496105_0002474
340 Ga0496105_0152262
341 Ga0496106_0691833
342 Ga0496107_0220707
343 Ga0496108_0095370
344 Ga0496108_0156374
345 Ga0496109_0034976
346 Ga0496109_0382318
347 Ga0496110_0054703
348 Ga0496110_0390675
349 Ga0496111_0053622
350 Ga0496111_0259578
351 Ga0496112_0066228
352 Ga0496112_0114651
353 Ga0496112_0210225
354 Ga0496113_0158359
355 Ga0496113_0684736
356 Ga0496114_0325358
357 Ga0496115_0279149
358 Ga0501034_0570359
359 Ga0501038_0080262
360 Ga0501040_0417707
361 Ga0501046_1071185
362 Ga0501047_0292205
363 Ga0501067_0076348
364 Ga0501068_0792846
365 Ga0501070_1346200
366 Ga0501071_1225864
367 Ga0501073_0906702
368 Ga0501077_0125336
369 Ga0501079_0903737
370 nmdc:mga03n38_570952_c1
371 nmdc:mga00v17_369909_c1
372 nmdc:mga06z11_156568_c1
373 nmdc:mga07m45_151403_c1
374 nmdc:mga05p37_370979_c1
375 nmdc:mga09592_10767_c1
376 nmdc:mga06r32_254560_c1
377 nmdc:mga0n895_1057350_c1
378 Ga0495601_0087576
379 Ga0495612_0059442
380 Ga0590075_015308

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

27

145

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7418 1 117
1s7i-assembly1.cif.gz_A-2 1.8 a crystal structure of a protein of unknown function pa1349 from pseudomonas aeruginosa 0.7154 1 117
2ivm-assembly1.cif.gz_A crystal structure of a transcriptional regulator 0.6225 2 118
1mli-assembly1.cif.gz_A crystal structure of muconolactone isomerase at 3.3 angstroms resolution 0.622 1 118
4fpi-assembly1.cif.gz_C crystal structure of 5-chloromuconolactone isomerase from rhodococcus opacus 1cp 0.6189 1 118
ID Description Score Start End Superfamily
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7418 1 117 3.30.70.1060
1s7iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7154 1 117 3.30.70.1060
2cyyA02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6467 2 117 3.30.70.920
af_O07243_1_96_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.6373 1 118 3.30.70.1060
4pcqD02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.6309 2 115 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A534CTY2-F1-model_v4 Amidohydrolase-related domain-containing protein 0.9295 1 117 GO:0016810
AF-A0A2V8FUL4-F1-model_v4 YCII-related domain-containing protein 0.9293 1 118
AF-A0A534G938-F1-model_v4 YCII-related domain-containing protein 0.9166 1 118
AF-A0A514X0U4-F1-model_v4 Uncharacterized protein 0.9123 1 117
AF-A0A2V8FUL4-F1-model_v4 YCII-related domain-containing protein 0.9069 1 118

Map