F292260

General Info

Members Datasets Scaffolds Average Seq Length
190 122 380 545

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10008622|Ga0081539_100086226
Length 592
Sequence MQVALQRVWACRRHRSVTAPFPRPHPYADVLSRIGWLSPSELRIGLGCMRLSTDGVTIFDTARSYGHGPEELGHNERLLARALRACGADATARIVTKGGMARPGGAWIADGRAKTLRADCEASLAALDGLPIDLYLIHAPDPRTPWRTSVRALAGLADAGLVRHVGISNVNRPQLDEALELAPVAAVQVALSPFEDRALRGGVLERCDERGVAVIAHSPLGGPRRAGRLAREETLVGVADAHGATPHEVALAWLLALQPNVVAIPGARRPETAASAARAAELELSDDERGALTRAFRGARPAARARPVKDGEVVLVMGIPGAGKTRVAEDYVARGYVRLNRDERGGSLRELADALDAHLVAGTRRIVLDNTYLTRASRSYVVEAAARHGLAARCVWLDTPLAQAQVNLVERMLDRLGRLPTAEELPALARAQQGVMAPTSQMRTQRELEPPTADEGWIEMEQMPFARAPWAGRARAGVFVAASALEGPGWQDVVHEQTDAPHLVFDWIPDGTVEALQAAAARVEAEIAGPVERAVCPHGGGPPRCWCRPPLPGLLLQFARAHDVDPSRSTLVGTSSAHRTLAATLGARAIVL

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
36 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
37 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
54 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
59 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
60 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
61 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
62 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
68 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
73 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
74 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
75 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
76 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
77 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
78 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
79 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
80 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
81 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
82 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
83 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
84 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
85 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
86 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
87 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
88 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
89 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
102 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
103 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
106 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
107 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
108 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
109 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
110 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
114 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
115 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
116 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
117 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.42
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 4.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10008622 3300005985 Bacteria 8802
2 JGI25407J50210_10000881 3300003373 Bacteria 6470
3 Ga0070683_100095223 3300005329 Bacteria 2799
4 Ga0070675_100107862 3300005354 Bacteria 2352
5 Ga0070674_100058741 3300005356 Bacteria 2675
6 Ga0070659_100012568 3300005366 Bacteria 6277
7 Ga0070659_100055275 3300005366 Bacteria 3128
8 Ga0070714_100110450 3300005435 Bacteria 2434
9 Ga0070713_100003499 3300005436 Bacteria 10367
10 Ga0070713_100028814 3300005436 Bacteria 4388
11 Ga0070710_10008329 3300005437 Bacteria 5045
12 Ga0070711_100043377 3300005439 Bacteria 3046
13 Ga0070708_100037536 3300005445 Bacteria 4227
14 Ga0070662_100093432 3300005457 Bacteria 2263
15 Ga0070681_10094790 3300005458 Bacteria 2933
16 Ga0070706_100117275 3300005467 Bacteria 2480
17 Ga0070698_100105897 3300005471 Bacteria 2781
18 Ga0070679_100059378 3300005530 Bacteria 3812
19 Ga0070684_100051396 3300005535 Bacteria 3581
20 Ga0070684_100066344 3300005535 Bacteria 3168
21 Ga0070665_100002592 3300005548 Bacteria 19745
22 Ga0068854_100073504 3300005578 Bacteria 2506
23 Ga0068856_100073319 3300005614 Bacteria 3390
24 Ga0070702_100039901 3300005615 Bacteria 2623
25 Ga0068852_100065308 3300005616 Bacteria 3174
26 Ga0081455_10009181 3300005937 Bacteria 10191
27 Ga0081455_10058941 3300005937 Unclassified 3245
28 Ga0081538_10000115 3300005981 Bacteria 80560
29 Ga0081538_10002429 3300005981 Bacteria 18262
30 Ga0081538_10011864 3300005981 Bacteria 7035
31 Ga0081538_10054599 3300005981 Bacteria 2361
32 Ga0081539_10000957 3300005985 Bacteria 54155
33 Ga0081539_10003883 3300005985 Bacteria 17446
34 Ga0081539_10004671 3300005985 Bacteria 14864
35 Ga0070717_10047753 3300006028 Bacteria 3508
36 Ga0075433_10013589 3300006852 Bacteria 6627
37 Ga0075434_100001386 3300006871 Bacteria 20336
38 Ga0075434_100061141 3300006871 Bacteria 3747
39 Ga0075434_100084036 3300006871 Bacteria 3182
40 Ga0075435_100009680 3300007076 Bacteria 6999
41 Ga0111539_10016639 3300009094 Bacteria 9113
42 Ga0111539_10053339 3300009094 Bacteria 4813
43 Ga0105245_10105919 3300009098 Bacteria 2608
44 Ga0105239_10041927 3300010375 Bacteria 5015
45 Ga0157371_10007707 3300013102 Bacteria 8662
46 Ga0157372_10128800 3300013307 Bacteria 2911
47 Ga0182008_10005637 3300014497 Bacteria 7093
48 Ga0157377_10055723 3300014745 Bacteria 2242
49 Ga0182006_1009260 3300015261 Bacteria 4422
50 Ga0182007_10008453 3300015262 Bacteria 4229
51 Ga0213875_10015618 3300021388 Bacteria 3694
52 Ga0207693_10001201 3300025915 Bacteria 23106
53 Ga0207693_10009745 3300025915 Bacteria 7822
54 Ga0207652_10064806 3300025921 Bacteria 3162
55 Ga0207687_10036919 3300025927 Bacteria 3331
56 Ga0207700_10000001 3300025928 Bacteria 1122509
57 Ga0207700_10154924 3300025928 Bacteria 1897
58 Ga0207690_10028036 3300025932 Bacteria 3565
59 Ga0207706_10116585 3300025933 Bacteria 2349
60 Ga0207706_10126100 3300025933 Bacteria 2252
61 Ga0207689_10103489 3300025942 Bacteria 2339
62 Ga0207679_10025736 3300025945 Unclassified 4051
63 Ga0207677_10023780 3300026023 Bacteria 3791
64 Ga0207639_10018306 3300026041 Bacteria 4977
65 Ga0207708_10029148 3300026075 Bacteria 4181
66 Ga0207702_10061027 3300026078 Bacteria 3215
67 Ga0207683_10019430 3300026121 Bacteria 5802
68 Ga0268266_10027717 3300028379 Bacteria 4816
69 Ga0373927_0011720 3300035695 Bacteria 5837
70 Ga0373937_0061705 3300036401 Bacteria 3446
71 Ga0395900_0008436 3300037418 Bacteria 10600
72 Ga0395900_0036806 3300037418 Bacteria 5044
73 Ga0395900_0090169 3300037418 Bacteria 3151
74 Ga0395900_0154663 3300037418 Bacteria 2343
75 Ga0395898_0002030 3300037466 Bacteria 25361
76 Ga0395898_0019332 3300037466 Bacteria 6935
77 Ga0395898_0081407 3300037466 Unclassified 3122
78 Ga0395905_0004865 3300037471 Bacteria 13844
79 Ga0395905_0057480 3300037471 Bacteria 3639
80 Ga0436364_0575821 3300037853 Bacteria 4554
81 Ga0436364_1564312 3300037853 Bacteria 3156
82 Ga0395901_0007853 3300038443 Bacteria 10761
83 Ga0395901_0027331 3300038443 Bacteria 5861
84 Ga0395901_0040668 3300038443 Bacteria 4816
85 Ga0395901_0086593 3300038443 Bacteria 3276
86 Ga0439451_004740 3300042009 Bacteria 2766
87 Ga0439446_0001652 3300042156 Bacteria 5167
88 Ga0439434_0005542 3300042435 Bacteria 3688
89 Ga0466963_0005743 3300044694 Bacteria 7293
90 Ga0466963_0019283 3300044694 Bacteria 4275
91 Ga0466963_0143244 3300044694 Unclassified 1657
92 Ga0466968_0029533 3300044735 Unclassified 2268
93 Ga0466957_0031273 3300044842 Bacteria 3180
94 Ga0466960_0012790 3300044901 Bacteria 3551
95 Ga0466967_0006436 3300045976 Bacteria 8308
96 Ga0466967_0054725 3300045976 Unclassified 3514
97 Ga0466967_0071812 3300045976 Bacteria 3100
98 Ga0495603_0016769 3300046455 Bacteria 4431
99 Ga0495653_0029189 3300046463 Bacteria 4407
100 Ga0495608_0012534 3300046511 Bacteria 5882
101 Ga0495618_0024877 3300046514 Bacteria 3712
102 Ga0495667_0008924 3300046559 Bacteria 6816
103 Ga0495657_0005277 3300046675 Bacteria 10226
104 Ga0495623_0022007 3300046679 Bacteria 4118
105 Ga0495604_0045371 3300047317 Bacteria 3430
106 Ga0495680_0019636 3300047322 Bacteria 5701
107 Ga0495684_0100378 3300047471 Bacteria 2188
108 Ga0495602_0024635 3300048088 Bacteria 5836
109 Ga0496101_0004261 3300048904 Bacteria 8972
110 Ga0496101_0044113 3300048904 Bacteria 3190
111 Ga0496102_0193816 3300048905 Bacteria 1915
112 Ga0496104_0101245 3300048907 Bacteria 2758
113 Ga0496104_0194001 3300048907 Bacteria 1943
114 Ga0496105_0041892 3300048908 Bacteria 3774
115 Ga0496106_0035370 3300048909 Bacteria 3735
116 Ga0496107_0014644 3300048910 Bacteria 5491
117 Ga0496107_0044903 3300048910 Bacteria 3177
118 Ga0496110_0048375 3300048913 Bacteria 3728
119 Ga0496112_0000705 3300048915 Bacteria 23172
120 Ga0496112_0004138 3300048915 Bacteria 12209
121 Ga0496112_0007081 3300048915 Bacteria 9911
122 Ga0496114_0001927 3300048917 Bacteria 15793
123 Ga0496115_0000507 3300048918 Bacteria 30530
124 Ga0496115_0008195 3300048918 Bacteria 7720
125 Ga0501031_0001988 3300049568 Bacteria 12920
126 Ga0501031_0009070 3300049568 Bacteria 6467
127 Ga0501031_0064460 3300049568 Bacteria 2386
128 Ga0501032_0064621 3300049569 Bacteria 2449
129 Ga0501033_0104686 3300049570 Bacteria 2063
130 Ga0501037_0016954 3300049573 Bacteria 5360
131 Ga0501038_0075970 3300049574 Bacteria 2838
132 Ga0501039_0002249 3300049575 Bacteria 14311
133 Ga0501039_0007087 3300049575 Bacteria 8539
134 Ga0501039_0008239 3300049575 Bacteria 7945
135 Ga0501040_0005966 3300049576 Bacteria 7883
136 Ga0501040_0015451 3300049576 Bacteria 5046
137 Ga0501041_0036329 3300049577 Bacteria 2985
138 Ga0501042_0004072 3300049578 Bacteria 9276
139 Ga0501042_0005159 3300049578 Bacteria 8388
140 Ga0501042_0009622 3300049578 Bacteria 6453
141 Ga0501042_0016550 3300049578 Bacteria 5064
142 Ga0501043_0038319 3300049579 Bacteria 3769
143 Ga0501046_0073878 3300049580 Bacteria 2645
144 Ga0501048_0001078 3300049582 Bacteria 20452
145 Ga0501048_0002970 3300049582 Bacteria 12941
146 Ga0501048_0088253 3300049582 Unclassified 2187
147 Ga0501069_0031516 3300049585 Archaea 2916
148 Ga0501071_0008373 3300049587 Bacteria 6834
149 Ga0501071_0125445 3300049587 Bacteria 1905
150 Ga0501072_0019075 3300049588 Bacteria 5296
151 Ga0501074_0028546 3300049590 Bacteria 4044
152 Ga0501074_0102430 3300049590 Bacteria 2049
153 Ga0501075_0098772 3300049591 Unclassified 2216
154 Ga0501075_0169504 3300049591 Bacteria 1665
155 Ga0501076_0009899 3300049592 Bacteria 7045
156 Ga0501076_0121137 3300049592 Bacteria 2118
157 Ga0501077_0000849 3300049593 Bacteria 18453
158 Ga0501079_0007334 3300049741 Bacteria 8335
159 Ga0501079_0058683 3300049741 Bacteria 2969
160 Ga0501080_0004401 3300049742 Bacteria 12517
161 Ga0501080_0013008 3300049742 Bacteria 7641
162 Ga0501080_0017487 3300049742 Bacteria 6631
163 Ga0501080_0069364 3300049742 Bacteria 3278
164 Ga0501080_0128840 3300049742 Bacteria 2343
165 Ga0501081_0005488 3300049743 Bacteria 8187
166 Ga0501083_0032161 3300049744 Bacteria 3599
167 Ga0501083_0050750 3300049744 Bacteria 2791
168 Ga0501035_0009846 3300049822 Bacteria 8879
169 Ga0501035_0053788 3300049822 Bacteria 3599
170 Ga0501035_0072169 3300049822 Bacteria 3056
171 Ga0501035_0092853 3300049822 Bacteria 2655
172 Ga0501045_0002913 3300049824 Bacteria 11693
173 Ga0501045_0007415 3300049824 Bacteria 7624
174 Ga0501045_0007730 3300049824 Bacteria 7477
175 nmdc:mga08y16_221755_c1 3300050511 Bacteria 1957
176 nmdc:mga08y16_33448_c1 3300050511 Archaea 5399
177 nmdc:mga0n895_4436_c1 3300050512 Bacteria 11532
178 nmdc:mga0n895_60446_c1 3300050512 Bacteria 3739
179 nmdc:mga0rr50_14801_c1 3300050513 Bacteria 5131
180 nmdc:mga08x19_25125_c1 3300050514 Bacteria 3710
181 nmdc:mga0a205_3249_c1 3300050515 Bacteria 12272
182 Ga0495612_0022296 3300053078 Bacteria 2539
183 Ga0501084_0013946 3300054114 Bacteria 6651
184 Ga0501084_0042338 3300054114 Bacteria 3809
185 Ga0501082_0003320 3300060353 Bacteria 14053
186 Ga0501082_0010733 3300060353 Bacteria 7884
187 Ga0530510_0012024 3300061734 Bacteria 6071
188 Ga0530510_0019840 3300061734 Bacteria 4778
189 Ga0530510_0036270 3300061734 Bacteria 3554
190 Ga0530510_0076572 3300061734 Bacteria 2431
191 Ga0081539_10008622
192 JGI25407J50210_10000881
193 Ga0070683_100095223
194 Ga0070675_100107862
195 Ga0070674_100058741
196 Ga0070659_100012568
197 Ga0070659_100055275
198 Ga0070714_100110450
199 Ga0070713_100003499
200 Ga0070713_100028814
201 Ga0070710_10008329
202 Ga0070711_100043377
203 Ga0070708_100037536
204 Ga0070662_100093432
205 Ga0070681_10094790
206 Ga0070706_100117275
207 Ga0070698_100105897
208 Ga0070679_100059378
209 Ga0070684_100051396
210 Ga0070684_100066344
211 Ga0070665_100002592
212 Ga0068854_100073504
213 Ga0068856_100073319
214 Ga0070702_100039901
215 Ga0068852_100065308
216 Ga0081455_10009181
217 Ga0081455_10058941
218 Ga0081538_10000115
219 Ga0081538_10002429
220 Ga0081538_10011864
221 Ga0081538_10054599
222 Ga0081539_10000957
223 Ga0081539_10003883
224 Ga0081539_10004671
225 Ga0070717_10047753
226 Ga0075433_10013589
227 Ga0075434_100001386
228 Ga0075434_100061141
229 Ga0075434_100084036
230 Ga0075435_100009680
231 Ga0111539_10016639
232 Ga0111539_10053339
233 Ga0105245_10105919
234 Ga0105239_10041927
235 Ga0157371_10007707
236 Ga0157372_10128800
237 Ga0182008_10005637
238 Ga0157377_10055723
239 Ga0182006_1009260
240 Ga0182007_10008453
241 Ga0213875_10015618
242 Ga0207693_10001201
243 Ga0207693_10009745
244 Ga0207652_10064806
245 Ga0207687_10036919
246 Ga0207700_10000001
247 Ga0207700_10154924
248 Ga0207690_10028036
249 Ga0207706_10116585
250 Ga0207706_10126100
251 Ga0207689_10103489
252 Ga0207679_10025736
253 Ga0207677_10023780
254 Ga0207639_10018306
255 Ga0207708_10029148
256 Ga0207702_10061027
257 Ga0207683_10019430
258 Ga0268266_10027717
259 Ga0373927_0011720
260 Ga0373937_0061705
261 Ga0395900_0008436
262 Ga0395900_0036806
263 Ga0395900_0090169
264 Ga0395900_0154663
265 Ga0395898_0002030
266 Ga0395898_0019332
267 Ga0395898_0081407
268 Ga0395905_0004865
269 Ga0395905_0057480
270 Ga0436364_0575821
271 Ga0436364_1564312
272 Ga0395901_0007853
273 Ga0395901_0027331
274 Ga0395901_0040668
275 Ga0395901_0086593
276 Ga0439451_004740
277 Ga0439446_0001652
278 Ga0439434_0005542
279 Ga0466963_0005743
280 Ga0466963_0019283
281 Ga0466963_0143244
282 Ga0466968_0029533
283 Ga0466957_0031273
284 Ga0466960_0012790
285 Ga0466967_0006436
286 Ga0466967_0054725
287 Ga0466967_0071812
288 Ga0495603_0016769
289 Ga0495653_0029189
290 Ga0495608_0012534
291 Ga0495618_0024877
292 Ga0495667_0008924
293 Ga0495657_0005277
294 Ga0495623_0022007
295 Ga0495604_0045371
296 Ga0495680_0019636
297 Ga0495684_0100378
298 Ga0495602_0024635
299 Ga0496101_0004261
300 Ga0496101_0044113
301 Ga0496102_0193816
302 Ga0496104_0101245
303 Ga0496104_0194001
304 Ga0496105_0041892
305 Ga0496106_0035370
306 Ga0496107_0014644
307 Ga0496107_0044903
308 Ga0496110_0048375
309 Ga0496112_0000705
310 Ga0496112_0004138
311 Ga0496112_0007081
312 Ga0496114_0001927
313 Ga0496115_0000507
314 Ga0496115_0008195
315 Ga0501031_0001988
316 Ga0501031_0009070
317 Ga0501031_0064460
318 Ga0501032_0064621
319 Ga0501033_0104686
320 Ga0501037_0016954
321 Ga0501038_0075970
322 Ga0501039_0002249
323 Ga0501039_0007087
324 Ga0501039_0008239
325 Ga0501040_0005966
326 Ga0501040_0015451
327 Ga0501041_0036329
328 Ga0501042_0004072
329 Ga0501042_0005159
330 Ga0501042_0009622
331 Ga0501042_0016550
332 Ga0501043_0038319
333 Ga0501046_0073878
334 Ga0501048_0001078
335 Ga0501048_0002970
336 Ga0501048_0088253
337 Ga0501069_0031516
338 Ga0501071_0008373
339 Ga0501071_0125445
340 Ga0501072_0019075
341 Ga0501074_0028546
342 Ga0501074_0102430
343 Ga0501075_0098772
344 Ga0501075_0169504
345 Ga0501076_0009899
346 Ga0501076_0121137
347 Ga0501077_0000849
348 Ga0501079_0007334
349 Ga0501079_0058683
350 Ga0501080_0004401
351 Ga0501080_0013008
352 Ga0501080_0017487
353 Ga0501080_0069364
354 Ga0501080_0128840
355 Ga0501081_0005488
356 Ga0501083_0032161
357 Ga0501083_0050750
358 Ga0501035_0009846
359 Ga0501035_0053788
360 Ga0501035_0072169
361 Ga0501035_0092853
362 Ga0501045_0002913
363 Ga0501045_0007415
364 Ga0501045_0007730
365 nmdc:mga08y16_221755_c1
366 nmdc:mga08y16_33448_c1
367 nmdc:mga0n895_4436_c1
368 nmdc:mga0n895_60446_c1
369 nmdc:mga0rr50_14801_c1
370 nmdc:mga08x19_25125_c1
371 nmdc:mga0a205_3249_c1
372 Ga0495612_0022296
373 Ga0501084_0013946
374 Ga0501084_0042338
375 Ga0501082_0003320
376 Ga0501082_0010733
377 Ga0530510_0012024
378 Ga0530510_0019840
379 Ga0530510_0036270
380 Ga0530510_0076572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

50

296

0.95

PF13671

AAA_33

AAA domain

313

434

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.908 7 256
4ast-assembly1.cif.gz_A the apo structure of a bacterial aldo-keto reductase akr14a1 0.8927 7 255
3v0u-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8896 4 255
4aub-assembly1.cif.gz_F the complex structure of the bacterial aldo-keto reductase akr14a1 with nadp and citrate 0.8891 7 255
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.8866 1 255
ID Description Score Start End Superfamily
af_F4HPY8_8_325_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9074 11 255 3.20.20.100
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9062 10 255 3.20.20.100
af_Q09923_6_337_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8968 10 255 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8923 11 184 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8896 4 255 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A534VS21-F1-model_v4 Aldo/keto reductase 0.9688 54 182 GO:0004033
GO:0005737
AF-A0A7V9SHP7-F1-model_v4 Aldo/keto reductase 0.9515 65 255 GO:0004033
GO:0005737
AF-A0A536ENF2-F1-model_v4 NADP-dependent oxidoreductase domain-containing protein 0.9475 4 553 GO:0004033
GO:0005737
AF-A0A535Z6N2-F1-model_v4 Aldo/keto reductase 0.9453 4 186 GO:0004033
GO:0005737
AF-A0A011AD11-F1-model_v4 Putative oxidoreductase, aryl-alcohol dehydrogenase like protein 0.9453 10 255 GO:0004033
GO:0005737

Map