F292188

General Info

Members Datasets Scaffolds Average Seq Length
190 111 380 259

Family's Representative Sequence

Representative Sequence 3300005549|Ga0070704_100059445|Ga0070704_1000594453
Length 299
Sequence MGRWSASFPVNSLFPLIHSILTEINLHLVSGDAICYEYSFMKKSTVVSLILLIGLLSANAELHTQTIEYKQGDTVLEGFLAYDKAIHGKRPGVLIVHQWKGLGSYEKKRAEMLANLGYTVFALDIYGKGIRADNPKDASALAAKYKNDRALLRERAKSGLGILKKHELTDPERIAAIGYCFGGTTVLELARSGADLDGIVSFHGALGTPDPKDARNIKGKVLALHGADDPFVPPAEVTAFEEEMRQAKVDWQLVSYGSAVHSFTDWDAGNDNSKGAAYNEKADKRSWEAMKLFFAEIFR

Samples

Sample ID Description Type Environment
1 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
20 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
37 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
51 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
52 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
53 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
56 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
57 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
58 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
59 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
63 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
67 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
69 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
70 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
71 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
72 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
73 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
79 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
80 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
81 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
82 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
93 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
94 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
95 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
96 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
97 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
98 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
99 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
106 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
107 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
110 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.42
Stem 0
Stem Tuber 0
Unclassified 25.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070704_100059445 3300005549 Bacteria 2727
2 rootH1_10025378 3300003323 Bacteria 14771
3 Ga0068869_100056805 3300005334 Bacteria 2855
4 Ga0068869_100437920 3300005334 Unclassified 1081
5 Ga0070675_100093117 3300005354 Bacteria 2527
6 Ga0070701_10038348 3300005438 Unclassified 2425
7 Ga0070705_100424648 3300005440 Bacteria 991
8 Ga0070694_100061171 3300005444 Bacteria 2569
9 Ga0070694_100072120 3300005444 Bacteria 2382
10 Ga0070694_100210342 3300005444 Unclassified 1454
11 Ga0070708_100485146 3300005445 Unclassified 1166
12 Ga0070681_10049615 3300005458 Bacteria 4191
13 Ga0070707_100064086 3300005468 Unclassified 3528
14 Ga0070698_100028946 3300005471 Bacteria 5750
15 Ga0070697_100004492 3300005536 Bacteria 10727
16 Ga0070697_100198000 3300005536 Bacteria 1707
17 Ga0070697_100393289 3300005536 Bacteria 1202
18 Ga0070686_100010088 3300005544 Bacteria 5315
19 Ga0070686_100094826 3300005544 Unclassified 2003
20 Ga0070665_100450679 3300005548 Bacteria 1296
21 Ga0070704_100276624 3300005549 Unclassified 1389
22 Ga0068859_100102366 3300005617 Unclassified 2921
23 Ga0068860_100009062 3300005843 Bacteria 9905
24 Ga0068860_100213724 3300005843 Bacteria 1871
25 Ga0068862_100306326 3300005844 Unclassified 1463
26 Ga0070717_10374984 3300006028 Bacteria 1275
27 Ga0097621_100664450 3300006237 Bacteria 957
28 Ga0075428_100004195 3300006844 Bacteria 15867
29 Ga0075428_100248917 3300006844 Bacteria 1916
30 Ga0075431_100180265 3300006847 Bacteria 2168
31 Ga0075431_100329029 3300006847 Bacteria 1539
32 Ga0075431_100358921 3300006847 Bacteria 1464
33 Ga0075433_10130011 3300006852 Bacteria 2237
34 Ga0075434_101027247 3300006871 Bacteria 838
35 Ga0097620_100102366 3300006931 Unclassified 2921
36 Ga0105251_10000092 3300009011 Bacteria 86905
37 Ga0105240_10067958 3300009093 Unclassified 4415
38 Ga0105240_10073805 3300009093 Unclassified 4212
39 Ga0111539_10006209 3300009094 Bacteria 15420
40 Ga0111539_10008564 3300009094 Bacteria 12987
41 Ga0111539_10044760 3300009094 Bacteria 5300
42 Ga0111539_10075953 3300009094 Bacteria 3957
43 Ga0105245_10264481 3300009098 Bacteria 1675
44 Ga0114129_10384760 3300009147 Bacteria 1852
45 Ga0114129_10416497 3300009147 Bacteria 1768
46 Ga0114129_10873153 3300009147 Unclassified 1142
47 Ga0105241_10839604 3300009174 Unclassified 849
48 Ga0105237_10304204 3300009545 Unclassified 1597
49 Ga0105249_10149484 3300009553 Unclassified 2247
50 Ga0105249_10305505 3300009553 Unclassified 1597
51 Ga0157374_10107430 3300013296 Unclassified 2682
52 Ga0163162_10716335 3300013306 Bacteria 1121
53 Ga0157375_10000071 3300013308 Bacteria 107825
54 Ga0163163_10000127 3300014325 Bacteria 79389
55 Ga0213876_10005924 3300021384 Bacteria 6677
56 Ga0207684_10536296 3300025910 Bacteria 1002
57 Ga0207707_10157058 3300025912 Bacteria 1989
58 Ga0207695_10049055 3300025913 Unclassified 4453
59 Ga0207695_10049742 3300025913 Unclassified 4415
60 Ga0207671_10271910 3300025914 Unclassified 1335
61 Ga0207659_10110282 3300025926 Bacteria 2091
62 Ga0207687_10421594 3300025927 Unclassified 1101
63 Ga0207670_10077726 3300025936 Bacteria 2313
64 Ga0207712_10133342 3300025961 Unclassified 1896
65 Ga0207428_10026688 3300027907 Unclassified 4816
66 Ga0268266_10345641 3300028379 Bacteria 1397
67 Ga0268264_10005868 3300028381 Bacteria 10392
68 Ga0265337_1028975 3300028556 Bacteria 1658
69 Ga0265338_10002166 3300028800 Bacteria 30168
70 Ga0265338_10002628 3300028800 Bacteria 26498
71 Ga0265338_10006831 3300028800 Bacteria 14375
72 Ga0265338_10061591 3300028800 Bacteria 3288
73 Ga0265338_10086734 3300028800 Bacteria 2603
74 Ga0265338_10095811 3300028800 Unclassified 2437
75 Ga0265338_10249378 3300028800 Unclassified 1310
76 Ga0265324_10000998 3300029957 Bacteria 17403
77 Ga0265324_10065157 3300029957 Bacteria 1243
78 Ga0265329_10004908 3300031242 Bacteria 5477
79 Ga0265340_10000309 3300031247 Bacteria 25713
80 Ga0265339_10027824 3300031249 Unclassified 3220
81 Ga0265316_10018589 3300031344 Bacteria 5968
82 Ga0265316_10058039 3300031344 Bacteria 3017
83 Ga0307408_100000017 3300031548 Bacteria 355890
84 Ga0265313_10012824 3300031595 Bacteria 5085
85 Ga0316579_10000652 3300031691 Bacteria 11766
86 Ga0316579_10096981 3300031691 Bacteria 1410
87 Ga0265314_10000073 3300031711 Bacteria 148691
88 Ga0265314_10007901 3300031711 Bacteria 9178
89 Ga0265342_10027795 3300031712 Unclassified 3529
90 Ga0265342_10034951 3300031712 Bacteria 3080
91 Ga0307410_10000014 3300031852 Bacteria 74664
92 Ga0307407_10236563 3300031903 Unclassified 1243
93 Ga0307412_10091655 3300031911 Unclassified 2128
94 Ga0307412_10194044 3300031911 Unclassified 1537
95 Ga0307409_100000030 3300031995 Bacteria 49142
96 Ga0307416_100003833 3300032002 Bacteria 8938
97 Ga0316583_10018746 3300032133 Bacteria 2485
98 Ga0316593_10049206 3300032168 Unclassified 1420
99 Ga0373951_0044591 3300035091 Unclassified 1077
100 Ga0373954_0100550 3300035118 Bacteria 1395
101 Ga0373960_0042589 3300035121 Bacteria 1319
102 Ga0373961_0056913 3300035241 Bacteria 1175
103 Ga0316582_0035663 3300036647 Bacteria 3073
104 Ga0316582_0096950 3300036647 Bacteria 1948
105 Ga0316584_0290692 3300036712 Unclassified 1186
106 Ga0373925_0283781 3300037068 Bacteria 1334
107 Ga0395905_0002815 3300037471 Bacteria 19060
108 Ga0316581_0031592 3300037588 Unclassified 1596
109 Ga0436365_0291325 3300039437 Bacteria 16577
110 Ga0451577_0001704 3300042876 Bacteria 28341
111 Ga0451577_0005350 3300042876 Bacteria 13179
112 Ga0451577_0105661 3300042876 Bacteria 2517
113 Ga0451577_0116894 3300042876 Bacteria 2389
114 Ga0451577_0120364 3300042876 Unclassified 2351
115 Ga0451577_0176336 3300042876 Bacteria 1927
116 Ga0451577_0229473 3300042876 Bacteria 1678
117 Ga0451577_0259160 3300042876 Bacteria 1575
118 Ga0451577_0339931 3300042876 Bacteria 1361
119 Ga0451577_0382108 3300042876 Unclassified 1278
120 Ga0451577_0455584 3300042876 Bacteria 1162
121 Ga0451577_0470343 3300042876 Bacteria 1141
122 Ga0451577_0858335 3300042876 Bacteria 819
123 Ga0453683_0000511 3300044673 Bacteria 43933
124 Ga0453683_0001088 3300044673 Bacteria 25007
125 Ga0453683_0001189 3300044673 Bacteria 23493
126 Ga0453683_0001227 3300044673 Bacteria 22952
127 Ga0453683_0035966 3300044673 Unclassified 3118
128 Ga0453683_0182849 3300044673 Unclassified 1330
129 Ga0453684_0000633 3300044712 Bacteria 127483
130 Ga0453684_0000704 3300044712 Bacteria 118782
131 Ga0453684_0043922 3300044712 Bacteria 5994
132 Ga0453684_0137517 3300044712 Bacteria 2922
133 Ga0453684_0158530 3300044712 Bacteria 2679
134 Ga0453684_0352296 3300044712 Bacteria 1659
135 Ga0453684_0491146 3300044712 Bacteria 1361
136 Ga0451576_0001079 3300045051 Bacteria 49994
137 Ga0451576_0003123 3300045051 Bacteria 23226
138 Ga0451576_0025250 3300045051 Bacteria 6403
139 Ga0451576_0190125 3300045051 Bacteria 2144
140 Ga0451576_0279363 3300045051 Bacteria 1746
141 Ga0451576_0323592 3300045051 Bacteria 1614
142 Ga0451576_0821540 3300045051 Bacteria 976
143 Ga0495592_0000243 3300046454 Bacteria 46498
144 Ga0495592_0208845 3300046454 Bacteria 1312
145 Ga0495662_0047130 3300046476 Bacteria 2081
146 Ga0495618_0007465 3300046514 Bacteria 6612
147 Ga0495618_0095588 3300046514 Unclassified 1900
148 Ga0495628_0000588 3300046516 Bacteria 33447
149 Ga0495628_0071959 3300046516 Unclassified 2694
150 Ga0495628_0132540 3300046516 Bacteria 1905
151 Ga0495628_0283806 3300046516 Bacteria 1229
152 Ga0495630_0000635 3300046517 Bacteria 25422
153 Ga0495630_0015037 3300046517 Bacteria 5647
154 Ga0495666_0044079 3300046526 Unclassified 2154
155 Ga0495666_0063673 3300046526 Bacteria 1760
156 Ga0495652_0268549 3300046529 Unclassified 1255
157 Ga0495654_0042882 3300046530 Bacteria 2243
158 Ga0495640_0019693 3300046533 Bacteria 4977
159 Ga0495586_0000249 3300046535 Bacteria 35735
160 Ga0495586_0002765 3300046535 Bacteria 9486
161 Ga0495586_0044672 3300046535 Unclassified 2387
162 Ga0495586_0377253 3300046535 Unclassified 815
163 Ga0495667_0090319 3300046559 Bacteria 1985
164 Ga0495634_0002565 3300046642 Bacteria 15002
165 Ga0495634_0182554 3300046642 Bacteria 1312
166 Ga0495635_0005242 3300046663 Bacteria 9018
167 Ga0495647_0173594 3300046681 Unclassified 934
168 Ga0495658_0012261 3300046683 Bacteria 4335
169 Ga0495613_0772604 3300046689 Bacteria 628
170 Ga0495624_0005167 3300046690 Bacteria 9431
171 Ga0495600_0024770 3300046809 Bacteria 3864
172 Ga0495674_0009641 3300047319 Bacteria 9172
173 Ga0495676_0287629 3300047321 Unclassified 1111
174 Ga0495684_0006214 3300047471 Bacteria 9289
175 Ga0495684_0406187 3300047471 Bacteria 955
176 Ga0501034_0024624 3300049571 Bacteria 6121
177 Ga0501034_0058403 3300049571 Bacteria 3877
178 Ga0501044_0040414 3300049823 Bacteria 4860
179 nmdc:mga05p37_216935_c1 3300050507 Bacteria 2310
180 nmdc:mga06r32_126777_c1 3300050510 Unclassified 2522
181 nmdc:mga06r32_169457_c1 3300050510 Bacteria 2167
182 nmdc:mga06r32_310868_c1 3300050510 Bacteria 1561
183 nmdc:mga08y16_14729_c1 3300050511 Bacteria 8222
184 nmdc:mga08y16_385176_c1 3300050511 Bacteria 1437
185 nmdc:mga08y16_5304_c1 3300050511 Bacteria 13482
186 nmdc:mga0n895_260357_c1 3300050512 Bacteria 1760
187 nmdc:mga0n895_519600_c1 3300050512 Bacteria 1198
188 nmdc:mga0a205_225431_c1 3300050515 Bacteria 1759
189 Ga0495612_0026095 3300053078 Bacteria 2348
190 Ga0495619_0041679 3300053085 Bacteria 3004
191 Ga0070704_100059445
192 rootH1_10025378
193 Ga0068869_100056805
194 Ga0068869_100437920
195 Ga0070675_100093117
196 Ga0070701_10038348
197 Ga0070705_100424648
198 Ga0070694_100061171
199 Ga0070694_100072120
200 Ga0070694_100210342
201 Ga0070708_100485146
202 Ga0070681_10049615
203 Ga0070707_100064086
204 Ga0070698_100028946
205 Ga0070697_100004492
206 Ga0070697_100198000
207 Ga0070697_100393289
208 Ga0070686_100010088
209 Ga0070686_100094826
210 Ga0070665_100450679
211 Ga0070704_100276624
212 Ga0068859_100102366
213 Ga0068860_100009062
214 Ga0068860_100213724
215 Ga0068862_100306326
216 Ga0070717_10374984
217 Ga0097621_100664450
218 Ga0075428_100004195
219 Ga0075428_100248917
220 Ga0075431_100180265
221 Ga0075431_100329029
222 Ga0075431_100358921
223 Ga0075433_10130011
224 Ga0075434_101027247
225 Ga0097620_100102366
226 Ga0105251_10000092
227 Ga0105240_10067958
228 Ga0105240_10073805
229 Ga0111539_10006209
230 Ga0111539_10008564
231 Ga0111539_10044760
232 Ga0111539_10075953
233 Ga0105245_10264481
234 Ga0114129_10384760
235 Ga0114129_10416497
236 Ga0114129_10873153
237 Ga0105241_10839604
238 Ga0105237_10304204
239 Ga0105249_10149484
240 Ga0105249_10305505
241 Ga0157374_10107430
242 Ga0163162_10716335
243 Ga0157375_10000071
244 Ga0163163_10000127
245 Ga0213876_10005924
246 Ga0207684_10536296
247 Ga0207707_10157058
248 Ga0207695_10049055
249 Ga0207695_10049742
250 Ga0207671_10271910
251 Ga0207659_10110282
252 Ga0207687_10421594
253 Ga0207670_10077726
254 Ga0207712_10133342
255 Ga0207428_10026688
256 Ga0268266_10345641
257 Ga0268264_10005868
258 Ga0265337_1028975
259 Ga0265338_10002166
260 Ga0265338_10002628
261 Ga0265338_10006831
262 Ga0265338_10061591
263 Ga0265338_10086734
264 Ga0265338_10095811
265 Ga0265338_10249378
266 Ga0265324_10000998
267 Ga0265324_10065157
268 Ga0265329_10004908
269 Ga0265340_10000309
270 Ga0265339_10027824
271 Ga0265316_10018589
272 Ga0265316_10058039
273 Ga0307408_100000017
274 Ga0265313_10012824
275 Ga0316579_10000652
276 Ga0316579_10096981
277 Ga0265314_10000073
278 Ga0265314_10007901
279 Ga0265342_10027795
280 Ga0265342_10034951
281 Ga0307410_10000014
282 Ga0307407_10236563
283 Ga0307412_10091655
284 Ga0307412_10194044
285 Ga0307409_100000030
286 Ga0307416_100003833
287 Ga0316583_10018746
288 Ga0316593_10049206
289 Ga0373951_0044591
290 Ga0373954_0100550
291 Ga0373960_0042589
292 Ga0373961_0056913
293 Ga0316582_0035663
294 Ga0316582_0096950
295 Ga0316584_0290692
296 Ga0373925_0283781
297 Ga0395905_0002815
298 Ga0316581_0031592
299 Ga0436365_0291325
300 Ga0451577_0001704
301 Ga0451577_0005350
302 Ga0451577_0105661
303 Ga0451577_0116894
304 Ga0451577_0120364
305 Ga0451577_0176336
306 Ga0451577_0229473
307 Ga0451577_0259160
308 Ga0451577_0339931
309 Ga0451577_0382108
310 Ga0451577_0455584
311 Ga0451577_0470343
312 Ga0451577_0858335
313 Ga0453683_0000511
314 Ga0453683_0001088
315 Ga0453683_0001189
316 Ga0453683_0001227
317 Ga0453683_0035966
318 Ga0453683_0182849
319 Ga0453684_0000633
320 Ga0453684_0000704
321 Ga0453684_0043922
322 Ga0453684_0137517
323 Ga0453684_0158530
324 Ga0453684_0352296
325 Ga0453684_0491146
326 Ga0451576_0001079
327 Ga0451576_0003123
328 Ga0451576_0025250
329 Ga0451576_0190125
330 Ga0451576_0279363
331 Ga0451576_0323592
332 Ga0451576_0821540
333 Ga0495592_0000243
334 Ga0495592_0208845
335 Ga0495662_0047130
336 Ga0495618_0007465
337 Ga0495618_0095588
338 Ga0495628_0000588
339 Ga0495628_0071959
340 Ga0495628_0132540
341 Ga0495628_0283806
342 Ga0495630_0000635
343 Ga0495630_0015037
344 Ga0495666_0044079
345 Ga0495666_0063673
346 Ga0495652_0268549
347 Ga0495654_0042882
348 Ga0495640_0019693
349 Ga0495586_0000249
350 Ga0495586_0002765
351 Ga0495586_0044672
352 Ga0495586_0377253
353 Ga0495667_0090319
354 Ga0495634_0002565
355 Ga0495634_0182554
356 Ga0495635_0005242
357 Ga0495647_0173594
358 Ga0495658_0012261
359 Ga0495613_0772604
360 Ga0495624_0005167
361 Ga0495600_0024770
362 Ga0495674_0009641
363 Ga0495676_0287629
364 Ga0495684_0006214
365 Ga0495684_0406187
366 Ga0501034_0024624
367 Ga0501034_0058403
368 Ga0501044_0040414
369 nmdc:mga05p37_216935_c1
370 nmdc:mga06r32_126777_c1
371 nmdc:mga06r32_169457_c1
372 nmdc:mga06r32_310868_c1
373 nmdc:mga08y16_14729_c1
374 nmdc:mga08y16_385176_c1
375 nmdc:mga08y16_5304_c1
376 nmdc:mga0n895_260357_c1
377 nmdc:mga0n895_519600_c1
378 nmdc:mga0a205_225431_c1
379 Ga0495612_0026095
380 Ga0495619_0041679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

76

298

0.92

PF02230

Abhydrolase_2

Phospholipase/Carboxylesterase

125

266

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.961 27 264
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9607 28 264
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9532 27 264
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9452 28 264
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9449 28 264
ID Description Score Start End Superfamily
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9469 27 264 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9445 28 264 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9389 25 262 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9292 28 264 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9289 29 264 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7C4I5E5-F1-model_v4 Dienelactone hydrolase family protein 0.9939 183 264 GO:0016787
AF-A0A4V2AZY9-F1-model_v4 Dienelactone hydrolase family protein 0.9937 144 264 GO:0052689
AF-A0A3N9MMN3-F1-model_v4 Dienelactone hydrolase family protein 0.9921 91 264 GO:0052689
AF-I4BWR3-F1-model_v4 Dienelactone hydrolase-like enzyme 0.9915 29 263 GO:0052689
AF-A0A4V2AZY9-F1-model_v4 Dienelactone hydrolase family protein 0.9856 144 264 GO:0052689

Map