F292152

General Info

Members Datasets Scaffolds Average Seq Length
190 138 380 258

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100114523|Ga0070684_1001145233
Length 289
Sequence MTAEGLVGADDVRVTPEWLALREPADAAARSIELAARAARHLPATGPLVIHDLGGGEGAMARWLAPRLPGPQHWVIHDRDVDLLELAVADRPGPASGPGPWAGRAADGTAVTVEARRGDITRLEPDDLAGASLVVASALLDMLTAEELPAMLEACIATGAPVLLALSVVGRVALTPAEPLDAAVAAAFDAHQRRTTAAGRLLGPDAVAAAAGHLGMSGAEVLVRPSPWRLDASHAALAAAWLDGWVAAACEQEPSLVADAVAYRDRRRAQAAAGRLAVTVHHADLLALP

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
10 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
17 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
18 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
61 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
62 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
63 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
69 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
70 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
71 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
72 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
73 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
81 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
82 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
83 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
84 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
85 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
95 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
96 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
97 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
98 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
106 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
107 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
108 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
109 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
110 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
111 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
134 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
135 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
138 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.63
Rhizosphere 86.84
Stem 0
Stem Tuber 0
Unclassified 1.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100114523 3300005535 Bacteria 2421
2 Ga0068868_100010469 3300005338 Bacteria 6718
3 Ga0070687_100028686 3300005343 Bacteria 2702
4 Ga0070659_100057053 3300005366 Bacteria 3079
5 Ga0070659_100322068 3300005366 Bacteria 1292
6 Ga0070714_100010713 3300005435 Bacteria 7255
7 Ga0070714_100073497 3300005435 Bacteria 2963
8 Ga0070714_100499051 3300005435 Bacteria 1160
9 Ga0070713_100221260 3300005436 Bacteria 1717
10 Ga0070711_100042434 3300005439 Bacteria 3075
11 Ga0070700_100041447 3300005441 Bacteria 2822
12 Ga0068853_100112445 3300005539 Bacteria 2420
13 Ga0070693_100125959 3300005547 Bacteria 1595
14 Ga0070665_100008370 3300005548 Bacteria 10463
15 Ga0068856_100261118 3300005614 Bacteria 1747
16 Ga0068852_100138002 3300005616 Bacteria 2253
17 Ga0068859_100221708 3300005617 Bacteria 1979
18 Ga0068859_100659866 3300005617 Bacteria 1138
19 Ga0068864_100237563 3300005618 Bacteria 1687
20 Ga0068864_100428525 3300005618 Bacteria 1261
21 Ga0068861_100069337 3300005719 Bacteria 2727
22 Ga0068860_100130627 3300005843 Bacteria 2410
23 Ga0068862_100059007 3300005844 Bacteria 3293
24 Ga0068862_100442990 3300005844 Bacteria 1223
25 Ga0081455_10055781 3300005937 Bacteria 3359
26 Ga0081538_10003020 3300005981 Bacteria 16020
27 Ga0081538_10019586 3300005981 Bacteria 5019
28 Ga0081538_10039681 3300005981 Bacteria 3015
29 Ga0081539_10011516 3300005985 Bacteria 6981
30 Ga0070712_100066604 3300006175 Bacteria 2561
31 Ga0075428_100055974 3300006844 Bacteria 4321
32 Ga0075431_100399682 3300006847 Bacteria 1375
33 Ga0097620_100221693 3300006931 Bacteria 1979
34 Ga0097620_100659817 3300006931 Bacteria 1138
35 Ga0105240_10444068 3300009093 Bacteria 1453
36 Ga0111539_10181446 3300009094 Bacteria 2458
37 Ga0105245_10386835 3300009098 Bacteria 1394
38 Ga0114129_10267298 3300009147 Bacteria 2289
39 Ga0114129_10400523 3300009147 Bacteria 1809
40 Ga0105243_10013398 3300009148 Bacteria 6200
41 Ga0105243_10169503 3300009148 Bacteria 1889
42 Ga0105237_10362977 3300009545 Bacteria 1453
43 Ga0105249_10048998 3300009553 Bacteria 3852
44 Ga0105249_10236746 3300009553 Bacteria 1803
45 Ga0105239_10550539 3300010375 Bacteria 1314
46 Ga0105246_10562123 3300011119 Bacteria 979
47 Ga0157369_10006864 3300013105 Bacteria 13135
48 Ga0163162_10254205 3300013306 Bacteria 1889
49 Ga0157375_10082690 3300013308 Bacteria 3254
50 Ga0157375_10481071 3300013308 Bacteria 1407
51 Ga0163163_10651920 3300014325 Bacteria 1116
52 Ga0157380_10095535 3300014326 Bacteria 2462
53 Ga0207692_10037037 3300025898 Bacteria 2383
54 Ga0207692_10147630 3300025898 Bacteria 1344
55 Ga0207688_10010467 3300025901 Bacteria 5047
56 Ga0207643_10139737 3300025908 Bacteria 1446
57 Ga0207693_10000956 3300025915 Bacteria 25897
58 Ga0207693_10269398 3300025915 Bacteria 1335
59 Ga0207663_10121176 3300025916 Bacteria 1791
60 Ga0207662_10045516 3300025918 Bacteria 2594
61 Ga0207681_10217929 3300025923 Bacteria 1475
62 Ga0207687_10018054 3300025927 Bacteria 4654
63 Ga0207687_10300767 3300025927 Bacteria 1292
64 Ga0207690_10152685 3300025932 Bacteria 1713
65 Ga0207709_10062831 3300025935 Bacteria 2326
66 Ga0207665_10080075 3300025939 Bacteria 2246
67 Ga0207667_10781892 3300025949 Bacteria 952
68 Ga0207712_10083113 3300025961 Bacteria 2336
69 Ga0207712_10180682 3300025961 Bacteria 1657
70 Ga0207677_10097802 3300026023 Bacteria 2151
71 Ga0207677_10418846 3300026023 Bacteria 1140
72 Ga0207708_10043474 3300026075 Bacteria 3423
73 Ga0207641_10415910 3300026088 Bacteria 1294
74 Ga0207676_10207254 3300026095 Bacteria 1737
75 Ga0207676_10348287 3300026095 Bacteria 1369
76 Ga0207675_100008126 3300026118 Bacteria 9886
77 Ga0268266_10145151 3300028379 Bacteria 2133
78 Ga0268266_10152904 3300028379 Bacteria 2082
79 Ga0268266_10197776 3300028379 Bacteria 1838
80 Ga0265320_10012357 3300031240 Bacteria 4977
81 Ga0307405_10126511 3300031731 Bacteria 1758
82 Ga0307413_10085535 3300031824 Bacteria 2036
83 Ga0307413_10225749 3300031824 Unclassified 1371
84 Ga0307413_10286303 3300031824 Bacteria 1242
85 Ga0307410_10007960 3300031852 Bacteria 5842
86 Ga0307410_10053780 3300031852 Bacteria 2726
87 Ga0307407_10023865 3300031903 Bacteria 3197
88 Ga0307409_100528294 3300031995 Bacteria 1154
89 Ga0307409_100866302 3300031995 Bacteria 915
90 Ga0307409_100872807 3300031995 Bacteria 912
91 Ga0307416_100005638 3300032002 Bacteria 7726
92 Ga0307416_100010287 3300032002 Bacteria 6172
93 Ga0307416_100372314 3300032002 Bacteria 1455
94 Ga0307416_100503551 3300032002 Bacteria 1276
95 Ga0307414_10087988 3300032004 Bacteria 2298
96 Ga0307414_10170292 3300032004 Bacteria 1740
97 Ga0307411_10044560 3300032005 Bacteria 2847
98 Ga0307415_100000305 3300032126 Bacteria 21243
99 Ga0307415_100086362 3300032126 Bacteria 2257
100 Ga0307415_100205888 3300032126 Bacteria 1565
101 Ga0373956_0027783 3300035119 Bacteria 2459
102 Ga0373957_0121686 3300035120 Bacteria 1057
103 Ga0373955_0101648 3300035172 Bacteria 1651
104 Ga0373924_0172948 3300035410 Bacteria 949
105 Ga0373937_0048138 3300036401 Bacteria 3901
106 Ga0373925_0075054 3300037068 Bacteria 2562
107 Ga0395898_0084039 3300037466 Bacteria 3068
108 Ga0395901_0188524 3300038443 Bacteria 2163
109 Ga0436365_1213768 3300039437 Bacteria 6210
110 Ga0439463_055973 3300042016 Bacteria 1007
111 Ga0466965_0277691 3300044683 Bacteria 904
112 Ga0466963_0117620 3300044694 Bacteria 1827
113 Ga0466964_0046711 3300044706 Bacteria 1766
114 Ga0466971_0013260 3300044719 Bacteria 3617
115 Ga0466970_0039902 3300044765 Bacteria 2492
116 Ga0466957_0003843 3300044842 Bacteria 8299
117 Ga0466960_0017104 3300044901 Bacteria 3156
118 Ga0466960_0070782 3300044901 Bacteria 1736
119 Ga0466967_0014860 3300045976 Bacteria 6085
120 Ga0466967_0030179 3300045976 Bacteria 4547
121 Ga0466967_0124150 3300045976 Bacteria 2389
122 Ga0466967_0213839 3300045976 Bacteria 1829
123 Ga0466967_0327280 3300045976 Bacteria 1479
124 Ga0466967_0361908 3300045976 Bacteria 1406
125 Ga0495603_0052912 3300046455 Bacteria 2410
126 Ga0495651_0003660 3300046462 Bacteria 11773
127 Ga0495653_0010180 3300046463 Bacteria 7695
128 Ga0495664_0112462 3300046477 Bacteria 1644
129 Ga0495628_0179015 3300046516 Bacteria 1604
130 Ga0495652_0056896 3300046529 Bacteria 3319
131 Ga0495667_0006388 3300046559 Bacteria 7987
132 Ga0495657_0178708 3300046675 Bacteria 1303
133 Ga0495599_0201837 3300046678 Bacteria 1221
134 Ga0495623_0009381 3300046679 Bacteria 6356
135 Ga0495646_0012226 3300046680 Bacteria 5458
136 Ga0495613_0041245 3300046689 Bacteria 3419
137 Ga0495581_0146236 3300047315 Bacteria 1380
138 Ga0495604_0005067 3300047317 Bacteria 10429
139 Ga0495674_0006439 3300047319 Bacteria 11257
140 Ga0495675_0077864 3300047444 Bacteria 2089
141 Ga0495684_0084641 3300047471 Bacteria 2405
142 Ga0495602_0027866 3300048088 Bacteria 5418
143 Ga0496100_0003855 3300048903 Bacteria 7863
144 Ga0496100_0019231 3300048903 Bacteria 4070
145 Ga0496101_0172199 3300048904 Bacteria 1664
146 Ga0496102_0430308 3300048905 Bacteria 1239
147 Ga0496104_0050161 3300048907 Bacteria 3938
148 Ga0496105_0060325 3300048908 Bacteria 3130
149 Ga0496105_0081023 3300048908 Bacteria 2681
150 Ga0496106_0151204 3300048909 Bacteria 1831
151 Ga0496106_0201653 3300048909 Bacteria 1583
152 Ga0496106_0280473 3300048909 Bacteria 1335
153 Ga0496107_0003978 3300048910 Bacteria 9948
154 Ga0496107_0100620 3300048910 Bacteria 2119
155 Ga0496108_0006728 3300048911 Bacteria 9309
156 Ga0496108_0362118 3300048911 Bacteria 1266
157 Ga0496110_0133993 3300048913 Bacteria 2238
158 Ga0496110_0198546 3300048913 Bacteria 1822
159 Ga0496111_0006198 3300048914 Bacteria 7746
160 Ga0496111_0084396 3300048914 Bacteria 2322
161 Ga0496112_0000514 3300048915 Bacteria 26280
162 Ga0496112_0047596 3300048915 Bacteria 4207
163 Ga0496112_0103056 3300048915 Bacteria 2823
164 Ga0496113_0086461 3300048916 Bacteria 2409
165 Ga0496113_0199945 3300048916 Bacteria 1588
166 Ga0496115_0014053 3300048918 Bacteria 6061
167 Ga0501036_1083806 3300049572 Bacteria 655
168 Ga0501040_0089985 3300049576 Bacteria 2133
169 Ga0501041_0194924 3300049577 Bacteria 1269
170 Ga0501042_0048239 3300049578 Bacteria 3037
171 Ga0501042_0352205 3300049578 Bacteria 1065
172 Ga0501048_0424843 3300049582 Bacteria 951
173 Ga0501067_0018868 3300049583 Bacteria 3816
174 Ga0501070_0427927 3300049586 Unclassified 1069
175 Ga0501072_0019727 3300049588 Bacteria 5215
176 Ga0501074_0571990 3300049590 Bacteria 800
177 Ga0501076_0663866 3300049592 Bacteria 860
178 Ga0501079_0085167 3300049741 Bacteria 2446
179 Ga0501079_0213107 3300049741 Bacteria 1509
180 nmdc:mga05p37_133590_c1 3300050507 Bacteria 3044
181 nmdc:mga0qj67_47953_c1 3300050509 Bacteria 3375
182 nmdc:mga06r32_310206_c1 3300050510 Bacteria 1563
183 nmdc:mga08y16_177633_c1 3300050511 Bacteria 2211
184 nmdc:mga08y16_207555_c1 3300050511 Bacteria 2029
185 Ga0495601_0033632 3300053077 Bacteria 3195
186 Ga0495655_0036227 3300053083 Bacteria 1233
187 Ga0495619_0014277 3300053085 Bacteria 5018
188 Ga0501084_0017861 3300054114 Bacteria 5905
189 Ga0501082_0114274 3300060353 Bacteria 2338
190 Ga0530510_0606834 3300061734 Bacteria 832
191 Ga0070684_100114523
192 Ga0068868_100010469
193 Ga0070687_100028686
194 Ga0070659_100057053
195 Ga0070659_100322068
196 Ga0070714_100010713
197 Ga0070714_100073497
198 Ga0070714_100499051
199 Ga0070713_100221260
200 Ga0070711_100042434
201 Ga0070700_100041447
202 Ga0068853_100112445
203 Ga0070693_100125959
204 Ga0070665_100008370
205 Ga0068856_100261118
206 Ga0068852_100138002
207 Ga0068859_100221708
208 Ga0068859_100659866
209 Ga0068864_100237563
210 Ga0068864_100428525
211 Ga0068861_100069337
212 Ga0068860_100130627
213 Ga0068862_100059007
214 Ga0068862_100442990
215 Ga0081455_10055781
216 Ga0081538_10003020
217 Ga0081538_10019586
218 Ga0081538_10039681
219 Ga0081539_10011516
220 Ga0070712_100066604
221 Ga0075428_100055974
222 Ga0075431_100399682
223 Ga0097620_100221693
224 Ga0097620_100659817
225 Ga0105240_10444068
226 Ga0111539_10181446
227 Ga0105245_10386835
228 Ga0114129_10267298
229 Ga0114129_10400523
230 Ga0105243_10013398
231 Ga0105243_10169503
232 Ga0105237_10362977
233 Ga0105249_10048998
234 Ga0105249_10236746
235 Ga0105239_10550539
236 Ga0105246_10562123
237 Ga0157369_10006864
238 Ga0163162_10254205
239 Ga0157375_10082690
240 Ga0157375_10481071
241 Ga0163163_10651920
242 Ga0157380_10095535
243 Ga0207692_10037037
244 Ga0207692_10147630
245 Ga0207688_10010467
246 Ga0207643_10139737
247 Ga0207693_10000956
248 Ga0207693_10269398
249 Ga0207663_10121176
250 Ga0207662_10045516
251 Ga0207681_10217929
252 Ga0207687_10018054
253 Ga0207687_10300767
254 Ga0207690_10152685
255 Ga0207709_10062831
256 Ga0207665_10080075
257 Ga0207667_10781892
258 Ga0207712_10083113
259 Ga0207712_10180682
260 Ga0207677_10097802
261 Ga0207677_10418846
262 Ga0207708_10043474
263 Ga0207641_10415910
264 Ga0207676_10207254
265 Ga0207676_10348287
266 Ga0207675_100008126
267 Ga0268266_10145151
268 Ga0268266_10152904
269 Ga0268266_10197776
270 Ga0265320_10012357
271 Ga0307405_10126511
272 Ga0307413_10085535
273 Ga0307413_10225749
274 Ga0307413_10286303
275 Ga0307410_10007960
276 Ga0307410_10053780
277 Ga0307407_10023865
278 Ga0307409_100528294
279 Ga0307409_100866302
280 Ga0307409_100872807
281 Ga0307416_100005638
282 Ga0307416_100010287
283 Ga0307416_100372314
284 Ga0307416_100503551
285 Ga0307414_10087988
286 Ga0307414_10170292
287 Ga0307411_10044560
288 Ga0307415_100000305
289 Ga0307415_100086362
290 Ga0307415_100205888
291 Ga0373956_0027783
292 Ga0373957_0121686
293 Ga0373955_0101648
294 Ga0373924_0172948
295 Ga0373937_0048138
296 Ga0373925_0075054
297 Ga0395898_0084039
298 Ga0395901_0188524
299 Ga0436365_1213768
300 Ga0439463_055973
301 Ga0466965_0277691
302 Ga0466963_0117620
303 Ga0466964_0046711
304 Ga0466971_0013260
305 Ga0466970_0039902
306 Ga0466957_0003843
307 Ga0466960_0017104
308 Ga0466960_0070782
309 Ga0466967_0014860
310 Ga0466967_0030179
311 Ga0466967_0124150
312 Ga0466967_0213839
313 Ga0466967_0327280
314 Ga0466967_0361908
315 Ga0495603_0052912
316 Ga0495651_0003660
317 Ga0495653_0010180
318 Ga0495664_0112462
319 Ga0495628_0179015
320 Ga0495652_0056896
321 Ga0495667_0006388
322 Ga0495657_0178708
323 Ga0495599_0201837
324 Ga0495623_0009381
325 Ga0495646_0012226
326 Ga0495613_0041245
327 Ga0495581_0146236
328 Ga0495604_0005067
329 Ga0495674_0006439
330 Ga0495675_0077864
331 Ga0495684_0084641
332 Ga0495602_0027866
333 Ga0496100_0003855
334 Ga0496100_0019231
335 Ga0496101_0172199
336 Ga0496102_0430308
337 Ga0496104_0050161
338 Ga0496105_0060325
339 Ga0496105_0081023
340 Ga0496106_0151204
341 Ga0496106_0201653
342 Ga0496106_0280473
343 Ga0496107_0003978
344 Ga0496107_0100620
345 Ga0496108_0006728
346 Ga0496108_0362118
347 Ga0496110_0133993
348 Ga0496110_0198546
349 Ga0496111_0006198
350 Ga0496111_0084396
351 Ga0496112_0000514
352 Ga0496112_0047596
353 Ga0496112_0103056
354 Ga0496113_0086461
355 Ga0496113_0199945
356 Ga0496115_0014053
357 Ga0501036_1083806
358 Ga0501040_0089985
359 Ga0501041_0194924
360 Ga0501042_0048239
361 Ga0501042_0352205
362 Ga0501048_0424843
363 Ga0501067_0018868
364 Ga0501070_0427927
365 Ga0501072_0019727
366 Ga0501074_0571990
367 Ga0501076_0663866
368 Ga0501079_0085167
369 Ga0501079_0213107
370 nmdc:mga05p37_133590_c1
371 nmdc:mga0qj67_47953_c1
372 nmdc:mga06r32_310206_c1
373 nmdc:mga08y16_177633_c1
374 nmdc:mga08y16_207555_c1
375 Ga0495601_0033632
376 Ga0495655_0036227
377 Ga0495619_0014277
378 Ga0501084_0017861
379 Ga0501082_0114274
380 Ga0530510_0606834

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wzn-assembly1.cif.gz_A crystal structure of the sam-dependent methyltransferase from pyrococcus horikoshii ot3 0.7356 24 166
6h2v-assembly1.cif.gz_A crystal structure of human mettl5-trmt112 complex, the 18s rrna m6a1832 methyltransferase at 2.5a resolution 0.7194 51 159
4qtt-assembly1.cif.gz_B structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.6966 15 215
4qtt-assembly2.cif.gz_D structure of s. cerevisiae bud23-trm112 complex involved in formation of m7g1575 on 18s rrna (apo-form) 0.6818 25 215
5ccx-assembly1.cif.gz_A-2 structure of the product complex of trna m1a58 methyltransferase with trna3lys as substrate 0.6804 35 223
ID Description Score Start End Superfamily
2gh1A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8077 48 156 3.40.50.150
af_F4JZ42_97_383_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8021 51 93 3.40.50.150
af_Q8I3G1_737_866_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7448 50 156 3.40.50.150
1af7A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7398 34 156 3.40.50.150
6fdfC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7278 50 217 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A6A7MMI0-F1-model_v4 deleted 0.983 11 281
AF-A0A6N9XXV1-F1-model_v4 deleted 0.9829 32 279
AF-A0A3E2YHS6-F1-model_v4 Methyltransferase domain protein 0.9812 19 279 GO:0008168
GO:0032259
AF-A0A7Y5TCN6-F1-model_v4 Class I SAM-dependent methyltransferase 0.9757 11 233 GO:0008168
GO:0032259
AF-A0A6N9XXV1-F1-model_v4 deleted 0.9751 32 279

Map