F292082

General Info

Members Datasets Scaffolds Average Seq Length
190 127 190 118

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10279280|Ga0070710_102792801
Length 128
Sequence MTTTNSDINEEFTPAPVKPAMTFADLDRIDVRVGTILSVEDVAGSEKLLKLTVDFGDHRRSIVAGMKKERENPREIEGRQALFVVNLEPKKMLGQLSEGMLFDVGYADGIVPALAIPERTVPNGSRLG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
74 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
75 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
76 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
77 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
78 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
79 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
80 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
84 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
99 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
102 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
103 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
104 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
105 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
107 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
108 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
114 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
115 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
116 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
117 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
118 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
125 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
126 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
127 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 98.95
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_2514071 2162886012 Bacteria 3611
2 Ga0065715_10092372 3300005293 Bacteria 5158
3 Ga0070690_101426527 3300005330 Bacteria 558
4 Ga0070687_100115928 3300005343 Bacteria 1524
5 Ga0070669_100564066 3300005353 Bacteria 950
6 Ga0070673_100308690 3300005364 Bacteria 1395
7 Ga0070673_100550509 3300005364 Unclassified 1048
8 Ga0070673_101096297 3300005364 Bacteria 744
9 Ga0070688_100060980 3300005365 Bacteria 2384
10 Ga0070709_10672804 3300005434 Unclassified 803
11 Ga0070710_10279280 3300005437 Bacteria 1083
12 Ga0070701_11053633 3300005438 Bacteria 570
13 Ga0070694_100000175 3300005444 Bacteria 33400
14 Ga0070708_100527523 3300005445 Bacteria 1114
15 Ga0070708_100876410 3300005445 Unclassified 843
16 Ga0070706_100001095 3300005467 Bacteria 29274
17 Ga0070706_100370930 3300005467 Bacteria 1333
18 Ga0070706_100517322 3300005467 Unclassified 1110
19 Ga0070707_100000209 3300005468 Bacteria 58885
20 Ga0070707_100046356 3300005468 Bacteria 4160
21 Ga0070707_100083201 3300005468 Bacteria 3092
22 Ga0070707_100333804 3300005468 Bacteria 1473
23 Ga0070707_100968554 3300005468 Bacteria 816
24 Ga0070707_101637552 3300005468 Bacteria 611
25 Ga0070698_100000943 3300005471 Bacteria 31812
26 Ga0070698_100011411 3300005471 Bacteria 9425
27 Ga0070698_100896966 3300005471 Bacteria 832
28 Ga0070699_100193697 3300005518 Bacteria 1806
29 Ga0070699_100585749 3300005518 Bacteria 1017
30 Ga0070699_100932230 3300005518 Unclassified 796
31 Ga0070699_101345244 3300005518 Bacteria 655
32 Ga0070697_100012151 3300005536 Bacteria 6743
33 Ga0070697_100143260 3300005536 Bacteria 2011
34 Ga0070697_100434270 3300005536 Unclassified 1142
35 Ga0070672_101718416 3300005543 Bacteria 564
36 Ga0070686_100766172 3300005544 Bacteria 775
37 Ga0070695_100011987 3300005545 Bacteria 5193
38 Ga0070695_101623864 3300005545 Unclassified 540
39 Ga0070704_100160125 3300005549 Bacteria 1779
40 Ga0070704_100718132 3300005549 Unclassified 888
41 Ga0070702_101144147 3300005615 Bacteria 624
42 Ga0068864_101669028 3300005618 Bacteria 642
43 Ga0068866_10341743 3300005718 Bacteria 948
44 Ga0068861_101776507 3300005719 Bacteria 611
45 Ga0068861_102150621 3300005719 Unclassified 558
46 Ga0068863_101077245 3300005841 Bacteria 808
47 Ga0068863_102361960 3300005841 Unclassified 541
48 Ga0068858_100120048 3300005842 Bacteria 2458
49 Ga0068858_100392555 3300005842 Bacteria 1332
50 Ga0070716_100055576 3300006173 Bacteria 2266
51 Ga0070716_100257619 3300006173 Bacteria 1192
52 Ga0070716_100677783 3300006173 Bacteria 785
53 Ga0070712_101174360 3300006175 Unclassified 667
54 Ga0097621_100666294 3300006237 Bacteria 956
55 Ga0075428_101726797 3300006844 Bacteria 653
56 Ga0075431_100911235 3300006847 Bacteria 848
57 Ga0075433_10457214 3300006852 Bacteria 1125
58 Ga0075434_100188085 3300006871 Bacteria 2085
59 Ga0075434_100237689 3300006871 Bacteria 1842
60 Ga0075434_100487525 3300006871 Bacteria 1253
61 Ga0075429_100207955 3300006880 Bacteria 1715
62 Ga0075429_101395243 3300006880 Bacteria 610
63 Ga0075436_100000014 3300006914 Bacteria 175616
64 Ga0075435_100000374 3300007076 Bacteria 27376
65 Ga0075435_100256336 3300007076 Bacteria 1490
66 Ga0075435_100416452 3300007076 Unclassified 1157
67 Ga0099794_10131627 3300007265 Bacteria 1263
68 Ga0099794_10160110 3300007265 Unclassified 1145
69 Ga0099794_10319844 3300007265 Unclassified 805
70 Ga0099794_10703734 3300007265 Bacteria 538
71 Ga0111539_10165483 3300009094 Bacteria 2586
72 Ga0105245_10964009 3300009098 Unclassified 896
73 Ga0105247_11700178 3300009101 Bacteria 522
74 Ga0105247_11829766 3300009101 Unclassified 506
75 Ga0114129_10200025 3300009147 Bacteria 2707
76 Ga0114129_10662767 3300009147 Unclassified 1345
77 Ga0114129_11593728 3300009147 Unclassified 800
78 Ga0105243_10000096 3300009148 Bacteria 100257
79 Ga0105242_10000144 3300009176 Bacteria 51877
80 Ga0105242_10583394 3300009176 Unclassified 1077
81 Ga0105248_10053567 3300009177 Bacteria 4526
82 Ga0105248_11664472 3300009177 Bacteria 723
83 Ga0157374_10856665 3300013296 Bacteria 926
84 Ga0157378_10083500 3300013297 Bacteria 2891
85 Ga0157380_11730921 3300014326 Bacteria 683
86 Ga0157376_11291617 3300014969 Bacteria 760
87 Ga0163161_10046087 3300017792 Bacteria 3145
88 Ga0207642_10499323 3300025899 Bacteria 745
89 Ga0207699_10420613 3300025906 Bacteria 954
90 Ga0207684_10042906 3300025910 Bacteria 3834
91 Ga0207684_10081778 3300025910 Bacteria 2749
92 Ga0207646_10000307 3300025922 Bacteria 66594
93 Ga0207646_10008373 3300025922 Bacteria 10372
94 Ga0207646_10100797 3300025922 Bacteria 2589
95 Ga0207646_11546641 3300025922 Bacteria 573
96 Ga0207646_11691090 3300025922 Bacteria 544
97 Ga0207681_11041575 3300025923 Bacteria 687
98 Ga0207686_10000026 3300025934 Bacteria 169189
99 Ga0207709_10000142 3300025935 Bacteria 100236
100 Ga0207709_11323062 3300025935 Bacteria 596
101 Ga0207670_10028824 3300025936 Bacteria 3529
102 Ga0207665_10058619 3300025939 Bacteria 2604
103 Ga0207665_10184576 3300025939 Unclassified 1512
104 Ga0207665_10330260 3300025939 Bacteria 1147
105 Ga0207665_10566372 3300025939 Bacteria 884
106 Ga0207651_10271895 3300025960 Bacteria 1396
107 Ga0207651_10990830 3300025960 Unclassified 751
108 Ga0207703_10105035 3300026035 Bacteria 2401
109 Ga0207703_10635617 3300026035 Bacteria 1012
110 Ga0207641_10077966 3300026088 Bacteria 2869
111 Ga0207676_10318961 3300026095 Bacteria 1426
112 Ga0207675_102227687 3300026118 Unclassified 563
113 Ga0209588_1006930 3300027671 Bacteria 3315
114 Ga0209588_1034130 3300027671 Unclassified 1633
115 Ga0207428_10004913 3300027907 Bacteria 12601
116 Ga0268264_10402027 3300028381 Bacteria 1316
117 Ga0307515_10216617 3300028794 Bacteria 1744
118 Ga0265330_10105695 3300031235 Unclassified 1204
119 Ga0265320_10007619 3300031240 Bacteria 6705
120 Ga0265340_10012753 3300031247 Unclassified 4437
121 Ga0265316_10026371 3300031344 Bacteria 4834
122 Ga0265316_10200675 3300031344 Unclassified 1478
123 Ga0265342_10027955 3300031712 Unclassified 3518
124 Ga0316576_10216728 3300031727 Bacteria 1440
125 Ga0373943_0037671 3300035170 Bacteria 2322
126 Ga0373946_0009863 3300035171 Bacteria 3528
127 Ga0373955_0036756 3300035172 Bacteria 2601
128 Ga0316574_0396633 3300035398 Bacteria 869
129 Ga0373935_1372919 3300035692 Bacteria 528
130 Ga0373947_0216659 3300035725 Bacteria 1257
131 Ga0316584_0041153 3300036712 Bacteria 3445
132 Ga0373925_0019456 3300037068 Bacteria 4938
133 Ga0373925_0467788 3300037068 Unclassified 1034
134 Ga0373925_1594245 3300037068 Bacteria 534
135 Ga0436360_1005947 3300039438 Bacteria 2056
136 Ga0439435_0025874 3300042436 Unclassified 1559
137 Ga0451577_0089490 3300042876 Bacteria 2747
138 Ga0453684_0003133 3300044712 Bacteria 38076
139 Ga0453684_1753704 3300044712 Unclassified 633
140 Ga0453684_2267961 3300044712 Bacteria 541
141 Ga0451576_0649062 3300045051 Bacteria 1109
142 Ga0495592_0678573 3300046454 Bacteria 622
143 Ga0495603_0417146 3300046455 Bacteria 769
144 Ga0495580_0129580 3300046472 Bacteria 1750
145 Ga0495580_0169585 3300046472 Bacteria 1509
146 Ga0495639_0000200 3300046475 Bacteria 31147
147 Ga0495639_0285787 3300046475 Bacteria 820
148 Ga0495594_0080808 3300046499 Bacteria 1815
149 Ga0495618_0681274 3300046514 Unclassified 606
150 Ga0495630_0133880 3300046517 Bacteria 1883
151 Ga0495666_0000321 3300046526 Bacteria 20895
152 Ga0495665_0529915 3300046531 Bacteria 592
153 Ga0495586_0000718 3300046535 Bacteria 18904
154 Ga0495586_0540655 3300046535 Bacteria 673
155 Ga0495659_0012373 3300046664 Bacteria 2762
156 Ga0495658_0059871 3300046683 Bacteria 2182
157 Ga0495613_0148509 3300046689 Bacteria 1673
158 Ga0495613_0209383 3300046689 Bacteria 1372
159 Ga0495670_0030874 3300046691 Bacteria 2662
160 Ga0495600_0195238 3300046809 Bacteria 1301
161 Ga0495581_0011163 3300047315 Bacteria 5192
162 Ga0495676_0000685 3300047321 Bacteria 28220
163 Ga0495675_0782155 3300047444 Unclassified 529
164 Ga0495684_0181517 3300047471 Bacteria 1560
165 Ga0495684_0437697 3300047471 Unclassified 911
166 Ga0495593_0195889 3300047673 Bacteria 1016
167 Ga0495614_0150184 3300048089 Bacteria 1039
168 Ga0496109_0000015 3300048912 Bacteria 214913
169 Ga0501039_0613975 3300049575 Bacteria 852
170 Ga0501041_0097789 3300049577 Bacteria 1815
171 Ga0501048_0053471 3300049582 Bacteria 2872
172 Ga0501071_0062573 3300049587 Bacteria 2696
173 Ga0501072_0294285 3300049588 Unclassified 1290
174 Ga0501076_0133061 3300049592 Bacteria 2017
175 Ga0501077_0133592 3300049593 Bacteria 1573
176 Ga0501079_0383249 3300049741 Unclassified 1102
177 Ga0501081_0094346 3300049743 Bacteria 2108
178 Ga0501045_0050835 3300049824 Bacteria 3025
179 nmdc:mga05p37_1427405_c1 3300050507 Unclassified 695
180 nmdc:mga05p37_830223_c1 3300050507 Bacteria 1007
181 nmdc:mga05p37_871753_c1 3300050507 Bacteria 975
182 nmdc:mga09592_887425_c1 3300050508 Bacteria 750
183 nmdc:mga06r32_510198_c1 3300050510 Bacteria 1179
184 nmdc:mga06r32_699859_c1 3300050510 Bacteria 979
185 nmdc:mga0n895_119482_c1 3300050512 Bacteria 1871
186 nmdc:mga0n895_38022_c1 3300050512 Bacteria 4660
187 nmdc:mga0rr50_5577_c1 3300050513 Bacteria 7528
188 nmdc:mga08x19_273_c1 3300050514 Bacteria 38978
189 nmdc:mga0a205_383772_c1 3300050515 Unclassified 1270
190 Ga0501084_0211020 3300054114 Bacteria 1638

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050508 nmdc:mga09592_887425_c1 nmdc:mga09592_887425_c1_395_709 104
2 3300047444 Ga0495675_0782155 Ga0495675_0782155_64_384 106
3 3300044712 Ga0453684_1753704 Ga0453684_1753704_78_431 107
4 3300005549 Ga0070704_100160125 Ga0070704_1001601252 108
5 3300009098 Ga0105245_10964009 Ga0105245_109640091 108
6 3300013296 Ga0157374_10856665 Ga0157374_108566652 108
7 3300035170 Ga0373943_0037671 Ga0373943_0037671_1682_2008 108
8 3300035171 Ga0373946_0009863 Ga0373946_0009863_1744_2070 108
9 3300035692 Ga0373935_1372919 Ga0373935_1372919_151_477 108
10 3300035725 Ga0373947_0216659 Ga0373947_0216659_538_864 108
11 3300037068 Ga0373925_0019456 Ga0373925_0019456_2095_2421 108
12 3300046455 Ga0495603_0417146 Ga0495603_0417146_179_505 108
13 3300046472 Ga0495580_0129580 Ga0495580_0129580_827_1153 108
14 3300046475 Ga0495639_0000200 Ga0495639_0000200_28448_28774 108
15 3300046499 Ga0495594_0080808 Ga0495594_0080808_1311_1637 108
16 3300046517 Ga0495630_0133880 Ga0495630_0133880_192_518 108
17 3300046526 Ga0495666_0000321 Ga0495666_0000321_18739_19065 108
18 3300046535 Ga0495586_0000718 Ga0495586_0000718_2100_2426 108
19 3300046683 Ga0495658_0059871 Ga0495658_0059871_718_1044 108
20 3300047315 Ga0495581_0011163 Ga0495581_0011163_2778_3104 108
21 3300047321 Ga0495676_0000685 Ga0495676_0000685_5617_5943 108
22 3300006852 Ga0075433_10457214 Ga0075433_104572141 111
23 3300006871 Ga0075434_100487525 Ga0075434_1004875251 111
24 3300007076 Ga0075435_100256336 Ga0075435_1002563362 111
25 3300050507 nmdc:mga05p37_1427405_c1 nmdc:mga05p37_1427405_c1_238_600 111
26 3300050512 nmdc:mga0n895_38022_c1 nmdc:mga0n895_38022_c1_2092_2454 111
27 3300050515 nmdc:mga0a205_383772_c1 nmdc:mga0a205_383772_c1_643_1005 111
28 3300025939 Ga0207665_10184576 Ga0207665_101845762 112
29 3300035172 Ga0373955_0036756 Ga0373955_0036756_1688_2026 112
30 3300005468 Ga0070707_100968554 Ga0070707_1009685542 116
31 3300005518 Ga0070699_101345244 Ga0070699_1013452441 116
32 3300006871 Ga0075434_100188085 Ga0075434_1001880853 116
33 3300006914 Ga0075436_100000014 Ga0075436_1000000148 116
34 3300025922 Ga0207646_11691090 Ga0207646_116910902 116
35 3300031235 Ga0265330_10105695 Ga0265330_101056952 116
36 3300031240 Ga0265320_10007619 Ga0265320_100076196 116
37 3300031247 Ga0265340_10012753 Ga0265340_100127535 116
38 3300031344 Ga0265316_10026371 Ga0265316_100263712 116
39 3300031344 Ga0265316_10200675 Ga0265316_102006752 116
40 3300031712 Ga0265342_10027955 Ga0265342_100279555 116
41 3300005445 Ga0070708_100876410 Ga0070708_1008764102 117
42 3300005467 Ga0070706_100517322 Ga0070706_1005173222 117
43 3300005468 Ga0070707_100333804 Ga0070707_1003338042 117
44 3300005518 Ga0070699_100585749 Ga0070699_1005857492 117
45 3300005536 Ga0070697_100434270 Ga0070697_1004342702 117
46 3300005545 Ga0070695_100011987 Ga0070695_1000119875 117
47 3300005545 Ga0070695_101623864 Ga0070695_1016238641 117
48 3300005549 Ga0070704_100718132 Ga0070704_1007181321 117
49 3300006880 Ga0075429_101395243 Ga0075429_1013952432 117
50 3300007076 Ga0075435_100416452 Ga0075435_1004164522 117
51 3300009147 Ga0114129_10200025 Ga0114129_102000251 117
52 3300009147 Ga0114129_10662767 Ga0114129_106627673 117
53 3300025906 Ga0207699_10420613 Ga0207699_104206132 117
54 3300031727 Ga0316576_10216728 Ga0316576_102167282 117
55 3300035398 Ga0316574_0396633 Ga0316574_0396633_203_556 117
56 3300036712 Ga0316584_0041153 Ga0316584_0041153_702_1055 117
57 3300037068 Ga0373925_0467788 Ga0373925_0467788_607_960 117
58 3300042876 Ga0451577_0089490 Ga0451577_0089490_708_1061 117
59 3300044712 Ga0453684_0003133 Ga0453684_0003133_10231_10584 117
60 3300047471 Ga0495684_0437697 Ga0495684_0437697_310_663 117
61 3300050507 nmdc:mga05p37_830223_c1 nmdc:mga05p37_830223_c1_327_680 117
62 3300007076 Ga0075435_100000374 Ga0075435_1000003743 119
63 3300007265 Ga0099794_10703734 Ga0099794_107037341 119
64 3300009177 Ga0105248_11664472 Ga0105248_116644722 119
65 3300050513 nmdc:mga0rr50_5577_c1 nmdc:mga0rr50_5577_c1_4963_5322 119
66 3300050514 nmdc:mga08x19_273_c1 nmdc:mga08x19_273_c1_18391_18750 119
67 2162886012 MBSR1b_contig_2514071 MBSR1b_0486.00000950 120
68 3300005293 Ga0065715_10092372 Ga0065715_100923723 120
69 3300005330 Ga0070690_101426527 Ga0070690_1014265271 120
70 3300005343 Ga0070687_100115928 Ga0070687_1001159282 120
71 3300005353 Ga0070669_100564066 Ga0070669_1005640661 120
72 3300005364 Ga0070673_100308690 Ga0070673_1003086902 120
73 3300005364 Ga0070673_100550509 Ga0070673_1005505091 120
74 3300005364 Ga0070673_101096297 Ga0070673_1010962972 120
75 3300005365 Ga0070688_100060980 Ga0070688_1000609803 120
76 3300005434 Ga0070709_10672804 Ga0070709_106728042 120
77 3300005437 Ga0070710_10279280 Ga0070710_102792801 120
78 3300005438 Ga0070701_11053633 Ga0070701_110536331 120
79 3300005444 Ga0070694_100000175 Ga0070694_1000001759 120
80 3300005445 Ga0070708_100527523 Ga0070708_1005275232 120
81 3300005467 Ga0070706_100001095 Ga0070706_10000109522 120
82 3300005467 Ga0070706_100370930 Ga0070706_1003709302 120
83 3300005468 Ga0070707_100000209 Ga0070707_10000020930 120
84 3300005468 Ga0070707_100046356 Ga0070707_1000463562 120
85 3300005468 Ga0070707_100083201 Ga0070707_1000832013 120
86 3300005468 Ga0070707_101637552 Ga0070707_1016375522 120
87 3300005471 Ga0070698_100000943 Ga0070698_10000094330 120
88 3300005471 Ga0070698_100011411 Ga0070698_1000114114 120
89 3300005471 Ga0070698_100896966 Ga0070698_1008969662 120
90 3300005518 Ga0070699_100193697 Ga0070699_1001936971 120
91 3300005518 Ga0070699_100932230 Ga0070699_1009322301 120
92 3300005536 Ga0070697_100012151 Ga0070697_1000121515 120
93 3300005536 Ga0070697_100143260 Ga0070697_1001432601 120
94 3300005543 Ga0070672_101718416 Ga0070672_1017184161 120
95 3300005544 Ga0070686_100766172 Ga0070686_1007661722 120
96 3300005615 Ga0070702_101144147 Ga0070702_1011441472 120
97 3300005618 Ga0068864_101669028 Ga0068864_1016690282 120
98 3300005718 Ga0068866_10341743 Ga0068866_103417432 120
99 3300005719 Ga0068861_101776507 Ga0068861_1017765071 120
100 3300005719 Ga0068861_102150621 Ga0068861_1021506212 120
101 3300005841 Ga0068863_101077245 Ga0068863_1010772451 120
102 3300005841 Ga0068863_102361960 Ga0068863_1023619601 120
103 3300005842 Ga0068858_100120048 Ga0068858_1001200482 120
104 3300005842 Ga0068858_100392555 Ga0068858_1003925552 120
105 3300006173 Ga0070716_100055576 Ga0070716_1000555762 120
106 3300006173 Ga0070716_100257619 Ga0070716_1002576192 120
107 3300006173 Ga0070716_100677783 Ga0070716_1006777832 120
108 3300006175 Ga0070712_101174360 Ga0070712_1011743602 120
109 3300006237 Ga0097621_100666294 Ga0097621_1006662942 120
110 3300006844 Ga0075428_101726797 Ga0075428_1017267972 120
111 3300006847 Ga0075431_100911235 Ga0075431_1009112351 120
112 3300006871 Ga0075434_100237689 Ga0075434_1002376892 120
113 3300006880 Ga0075429_100207955 Ga0075429_1002079551 120
114 3300007265 Ga0099794_10131627 Ga0099794_101316272 120
115 3300007265 Ga0099794_10160110 Ga0099794_101601102 120
116 3300007265 Ga0099794_10319844 Ga0099794_103198442 120
117 3300009094 Ga0111539_10165483 Ga0111539_101654832 120
118 3300009101 Ga0105247_11700178 Ga0105247_117001781 120
119 3300009101 Ga0105247_11829766 Ga0105247_118297661 120
120 3300009147 Ga0114129_11593728 Ga0114129_115937282 120
121 3300009148 Ga0105243_10000096 Ga0105243_1000009626 120
122 3300009176 Ga0105242_10000144 Ga0105242_1000014432 120
123 3300009176 Ga0105242_10583394 Ga0105242_105833941 120
124 3300009177 Ga0105248_10053567 Ga0105248_100535675 120
125 3300013297 Ga0157378_10083500 Ga0157378_100835002 120
126 3300014326 Ga0157380_11730921 Ga0157380_117309211 120
127 3300014969 Ga0157376_11291617 Ga0157376_112916171 120
128 3300017792 Ga0163161_10046087 Ga0163161_100460872 120
129 3300025899 Ga0207642_10499323 Ga0207642_104993231 120
130 3300025910 Ga0207684_10042906 Ga0207684_100429063 120
131 3300025910 Ga0207684_10081778 Ga0207684_100817782 120
132 3300025922 Ga0207646_10000307 Ga0207646_1000030740 120
133 3300025922 Ga0207646_10008373 Ga0207646_100083735 120
134 3300025922 Ga0207646_10100797 Ga0207646_101007972 120
135 3300025922 Ga0207646_11546641 Ga0207646_115466411 120
136 3300025923 Ga0207681_11041575 Ga0207681_110415752 120
137 3300025934 Ga0207686_10000026 Ga0207686_1000002626 120
138 3300025935 Ga0207709_10000142 Ga0207709_1000014226 120
139 3300025935 Ga0207709_11323062 Ga0207709_113230622 120
140 3300025936 Ga0207670_10028824 Ga0207670_100288242 120
141 3300025939 Ga0207665_10058619 Ga0207665_100586192 120
142 3300025939 Ga0207665_10330260 Ga0207665_103302602 120
143 3300025939 Ga0207665_10566372 Ga0207665_105663722 120
144 3300025960 Ga0207651_10271895 Ga0207651_102718953 120
145 3300025960 Ga0207651_10990830 Ga0207651_109908302 120
146 3300026035 Ga0207703_10105035 Ga0207703_101050352 120
147 3300026035 Ga0207703_10635617 Ga0207703_106356172 120
148 3300026088 Ga0207641_10077966 Ga0207641_100779662 120
149 3300026095 Ga0207676_10318961 Ga0207676_103189612 120
150 3300026118 Ga0207675_102227687 Ga0207675_1022276871 120
151 3300027671 Ga0209588_1006930 Ga0209588_10069302 120
152 3300027671 Ga0209588_1034130 Ga0209588_10341303 120
153 3300027907 Ga0207428_10004913 Ga0207428_100049139 120
154 3300028381 Ga0268264_10402027 Ga0268264_104020272 120
155 3300028794 Ga0307515_10216617 Ga0307515_102166172 120
156 3300037068 Ga0373925_1594245 Ga0373925_1594245_91_456 120
157 3300039438 Ga0436360_1005947 Ga0436360_1005947_382_747 120
158 3300042436 Ga0439435_0025874 Ga0439435_0025874_1024_1413 120
159 3300044712 Ga0453684_2267961 Ga0453684_2267961_16_381 120
160 3300045051 Ga0451576_0649062 Ga0451576_0649062_448_813 120
161 3300046454 Ga0495592_0678573 Ga0495592_0678573_178_543 120
162 3300046472 Ga0495580_0169585 Ga0495580_0169585_856_1230 120
163 3300046475 Ga0495639_0285787 Ga0495639_0285787_352_717 120
164 3300046514 Ga0495618_0681274 Ga0495618_0681274_202_567 120
165 3300046531 Ga0495665_0529915 Ga0495665_0529915_48_422 120
166 3300046535 Ga0495586_0540655 Ga0495586_0540655_64_429 120
167 3300046664 Ga0495659_0012373 Ga0495659_0012373_1958_2323 120
168 3300046689 Ga0495613_0148509 Ga0495613_0148509_740_1105 120
169 3300046689 Ga0495613_0209383 Ga0495613_0209383_774_1148 120
170 3300046691 Ga0495670_0030874 Ga0495670_0030874_1230_1595 120
171 3300046809 Ga0495600_0195238 Ga0495600_0195238_115_480 120
172 3300047471 Ga0495684_0181517 Ga0495684_0181517_655_1020 120
173 3300047673 Ga0495593_0195889 Ga0495593_0195889_458_832 120
174 3300048089 Ga0495614_0150184 Ga0495614_0150184_558_923 120
175 3300048912 Ga0496109_0000015 Ga0496109_0000015_178574_178936 120
176 3300049575 Ga0501039_0613975 Ga0501039_0613975_110_475 120
177 3300049577 Ga0501041_0097789 Ga0501041_0097789_1148_1510 120
178 3300049582 Ga0501048_0053471 Ga0501048_0053471_1666_2028 120
179 3300049587 Ga0501071_0062573 Ga0501071_0062573_1083_1445 120
180 3300049588 Ga0501072_0294285 Ga0501072_0294285_894_1256 120
181 3300049592 Ga0501076_0133061 Ga0501076_0133061_774_1136 120
182 3300049593 Ga0501077_0133592 Ga0501077_0133592_491_853 120
183 3300049741 Ga0501079_0383249 Ga0501079_0383249_629_991 120
184 3300049743 Ga0501081_0094346 Ga0501081_0094346_477_839 120
185 3300049824 Ga0501045_0050835 Ga0501045_0050835_765_1127 120
186 3300050507 nmdc:mga05p37_871753_c1 nmdc:mga05p37_871753_c1_93_455 120
187 3300050510 nmdc:mga06r32_510198_c1 nmdc:mga06r32_510198_c1_542_904 120
188 3300050510 nmdc:mga06r32_699859_c1 nmdc:mga06r32_699859_c1_237_602 120
189 3300050512 nmdc:mga0n895_119482_c1 nmdc:mga0n895_119482_c1_316_678 120
190 3300054114 Ga0501084_0211020 Ga0501084_0211020_592_954 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

31

126

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkh-assembly1.cif.gz_A-2 c-terminal domain of methionyl-trna synthetase from pyrococcus abyssi 0.9586 11 120
5h34-assembly1.cif.gz_A crystal structure of the c-terminal domain of methionyl-trna synthetase (metrs-c) in nanoarchaeum equitans 0.9577 7 120
1mkh-assembly1.cif.gz_A-2 c-terminal domain of methionyl-trna synthetase from pyrococcus abyssi 0.9499 11 120
5h34-assembly1.cif.gz_A crystal structure of the c-terminal domain of methionyl-trna synthetase (metrs-c) in nanoarchaeum equitans 0.9495 7 120
7d8r-assembly2.cif.gz_C mitf hlhlz structure 0.947 15 120
ID Description Score Start End Superfamily
5h34A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9577 7 120 2.40.50.140
5h34A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9495 7 120 2.40.50.140
af_Q2G1R9_548_656_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9361 8 119 2.40.50.140
af_P00959_568_677_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9327 10 120 2.40.50.140
2cwpA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9296 10 120 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A0F9ZRP8-F1-model_v4 EMAP domain protein 0.9951 26 120 GO:0000049
AF-A0A7Y2AVB9-F1-model_v4 tRNA-binding protein 0.9903 5 120 GO:0000049
AF-A0A2V8LE17-F1-model_v4 tRNA-binding protein 0.9899 5 120 GO:0000049
AF-A0A0C5WNZ1-F1-model_v4 tRNA-binding domain-containing protein 0.9862 2 120 GO:0000049
AF-A0A2N6CQ93-F1-model_v4 tRNA-binding protein 0.9855 37 120 GO:0000049

Feature Viewer

pLDDT pTM Quality
91.42 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map