F291512

General Info

Members Datasets Scaffolds Average Seq Length
189 152 378 389

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0010874|Ga0496117_0010874_3939_5207
Length 422
Sequence LIIKSLCVFSLIPYFIKLQPGEEDLMMHNDCPKNARIPQPIRSDGAGGIDKGPRDVMRDLQNPDMLVPPVTDNGLITNMRFSFSDAHMQLNHGGWSREVTVRELPIATTLAGVNMSLTPGGVRELHWHQQAEWSYMLLGSARITAVDQNGRNFIADVGPGDLWYFPPGIPHSIQGLEDGCEFLLVFDDGSFSDLNTLSISDWFAHTPKDVLSANFGVPEADFAAIPQDQVYIYQDSVPGSIQSQAVPSPYGTLPQSFKHELLAQPPIKTPGGSVRIVDSSNFPISKTIAAALVEIEPGAMREMHWHPNNDEWQYYLTGQGRMTVFGGNGAARTFDFRAGDVGYVPFAYGHYIQNTGSSSLWFLEMFKSDRFADVSLNQWMALTPTELIQSNLHVGTDVISNLRKVKWPVVKYPGYSYDPKKK

Samples

Sample ID Description Type Environment
1 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
4 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
5 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
6 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
9 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
10 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
11 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
13 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
14 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
15 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
16 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
18 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
19 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
20 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
21 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
22 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
23 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
24 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
25 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
26 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
27 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
28 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
29 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
30 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
31 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
32 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
33 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
34 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
35 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
36 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
37 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
38 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
39 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
40 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
41 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
42 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
43 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
44 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
45 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
46 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
47 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
48 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
49 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
50 2643221729 Bacillus sp. Root11 Isolate Unclassified
51 2643221730 Bacillus sp. Root131 Isolate Unclassified
52 2671180694 Paenibacillus sp. A3 Isolate Unclassified
53 2684622632 Bacillus cereus 905 Isolate Unclassified
54 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
55 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
56 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
57 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
58 2738543010 Bacillus sp. YR335 Isolate Unclassified
59 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
60 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
61 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
62 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
63 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
64 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
65 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
66 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
67 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
68 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
69 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
70 2818991459 Paenibacillus sp. 597 Isolate Unclassified
71 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
72 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
73 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
74 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
75 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
76 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
77 2857472729 Cohnella sp. R-74144 Isolate Unclassified
78 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
79 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
80 2858882152 Micromonospora noduli MED15 Isolate Nodule
81 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
82 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
83 2860837431 Bacillus sp. WR11 Isolate Unclassified
84 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
85 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
86 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
87 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
88 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
89 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
90 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
91 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
92 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
93 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
94 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
95 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
96 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
97 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
98 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
99 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
100 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
101 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
102 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
103 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
104 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
105 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
106 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
107 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
108 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
109 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
110 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
111 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
112 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
113 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
114 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
115 2938917290 Bacillus sp. CR71 Isolate Unclassified
116 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
117 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
118 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
119 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
120 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
121 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
122 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
123 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
124 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
125 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
126 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
127 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
128 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
129 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
130 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
131 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
132 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
133 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
134 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
135 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
136 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
137 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
138 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
139 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
140 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
141 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
142 8022653035 Bacillus sp. Rc4 Isolate Unclassified
143 8023444577 Bacillus sp. BH32 Isolate Unclassified
144 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
145 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
146 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
147 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
148 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
149 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
150 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
151 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
152 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 39.15
Metatranscriptomes 0
Isolates 60.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.7
Nodule 3.7
Rhizoplane 2.12
Rhizosphere 34.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496117_0010874 3300048920 Bacteria 8209
2 JGI25151J46595_10002917 3300003187 Bacteria 9791
3 JGI25151J46595_10012308 3300003187 Bacteria 3898
4 JGI25151J46595_10013325 3300003187 Bacteria 3704
5 JGI25151J46595_10035213 3300003187 Bacteria 1904
6 JGI25151J46595_10036783 3300003187 Bacteria 1843
7 Ga0055538_1000159 3300003751 Bacteria 44844
8 Ga0055538_1000696 3300003751 Bacteria 10257
9 Ga0055532_1000145 3300003758 Bacteria 69355
10 Ga0055532_1000490 3300003758 Bacteria 17635
11 Ga0055541_1007346 3300003841 Bacteria 1815
12 Ga0081538_10005853 3300005981 Bacteria 10951
13 Ga0081539_10000062 3300005985 Bacteria 249871
14 Ga0105251_10024777 3300009011 Bacteria 3078
15 Ga0105250_10045020 3300009092 Bacteria 1769
16 Ga0105246_10007795 3300011119 Bacteria 6571
17 Ga0209784_100090 3300025224 Bacteria 119291
18 Ga0209784_100963 3300025224 Bacteria 5479
19 Ga0209566_100052 3300025225 Bacteria 231848
20 Ga0209566_100156 3300025225 Bacteria 77137
21 Ga0209566_102807 3300025225 Bacteria 2983
22 Ga0209147_100014 3300025229 Bacteria 597841
23 Ga0209147_100057 3300025229 Bacteria 253870
24 Ga0209147_103660 3300025229 Bacteria 2875
25 Ga0209676_1008049 3300025292 Bacteria 4794
26 Ga0209676_1008991 3300025292 Bacteria 4374
27 Ga0209676_1034598 3300025292 Bacteria 1492
28 Ga0209025_1000041 3300025294 Bacteria 373694
29 Ga0209025_1003470 3300025294 Bacteria 14880
30 Ga0209025_1014884 3300025294 Bacteria 4742
31 Ga0207655_1012592 3300025728 Bacteria 4931
32 Ga0237817_10389 3300030083 Bacteria 7573
33 Ga0307407_10062175 3300031903 Bacteria 2186
34 Ga0237819_03250 3300038705 Bacteria 2942
35 Ga0439436_0003006 3300041404 Bacteria 5117
36 Ga0439439_0002518 3300041406 Bacteria 3906
37 Ga0439433_0006602 3300041999 Bacteria 2499
38 Ga0439433_0009986 3300041999 Bacteria 2072
39 Ga0439449_0009929 3300042007 Bacteria 3600
40 Ga0439462_0006178 3300042015 Bacteria 2972
41 Ga0439462_0010800 3300042015 Bacteria 2317
42 Ga0466967_0000127 3300045976 Bacteria 28993
43 Ga0496102_0231963 3300048905 Bacteria 1740
44 Ga0496103_0126941 3300048906 Bacteria 1627
45 Ga0496116_0000949 3300048919 Bacteria 35686
46 Ga0496116_0001248 3300048919 Bacteria 29538
47 Ga0496116_0011123 3300048919 Bacteria 7481
48 Ga0496117_0023034 3300048920 Bacteria 4977
49 Ga0496118_0006051 3300048921 Bacteria 13479
50 Ga0496119_0000890 3300048922 Bacteria 39116
51 Ga0496119_0014132 3300048922 Bacteria 6274
52 Ga0496120_0000700 3300048923 Bacteria 49102
53 Ga0496120_0029552 3300048923 Bacteria 3345
54 Ga0496121_0025454 3300048924 Bacteria 5612
55 Ga0496121_0026178 3300048924 Bacteria 5507
56 Ga0496122_0003308 3300048925 Bacteria 21323
57 Ga0496122_0027107 3300048925 Bacteria 4910
58 Ga0496122_0038926 3300048925 Bacteria 3800
59 Ga0496123_0022602 3300048926 Bacteria 4840
60 Ga0496123_0157377 3300048926 Bacteria 1216
61 Ga0496124_0000207 3300048927 Bacteria 116491
62 Ga0496124_0001602 3300048927 Bacteria 32542
63 Ga0496124_0019633 3300048927 Bacteria 6281
64 Ga0496124_0032984 3300048927 Bacteria 4564
65 Ga0496124_0041235 3300048927 Bacteria 3986
66 Ga0496125_0001843 3300048928 Bacteria 29237
67 Ga0496125_0005938 3300048928 Bacteria 13374
68 Ga0496125_0008509 3300048928 Bacteria 10729
69 Ga0496125_0029186 3300048928 Bacteria 4962
70 Ga0496125_0108305 3300048928 Bacteria 2022
71 Ga0496125_0194443 3300048928 Bacteria 1336
72 Ga0496126_0000730 3300048929 Bacteria 59731
73 Ga0496126_0002092 3300048929 Bacteria 27950
74 Ga0496126_0006821 3300048929 Bacteria 12669
75 2512639590 2512564013 Bacteria 6286191
76 2540606998 2540341094 Bacteria 4061186
77 2550899952 2548877040 Bacteria 7507281
78 2553392866 2551306519 Bacteria 5465154
79 2563928259 2563366752 Bacteria 4961801
80 2571527612 2571042143 Bacteria 6986194
81 2573040207 2571042588 Bacteria 5045676
82 2587742659 2585428059 Bacteria 8696589
83 2595319093 2593339198 Bacteria 7267884
84 2601640216 2600255286 Bacteria 5390125
85 2643737671 2643221543 Bacteria 6628015
86 2644421921 2643221676 Bacteria 8119172
87 2644703360 2643221729 Bacteria 6621700
88 2644713444 2643221730 Bacteria 6523787
89 2673821996 2671180694 Bacteria 7506943
90 2685148953 2684622632 Bacteria 5380049
91 2698324213 2695420987 Bacteria 6152737
92 2721504357 2718218445 Bacteria 5113413
93 2723603857 2721755693 Bacteria 6126117
94 2728531313 2728368933 Bacteria 7044283
95 2739232772 2738543010 Bacteria 5583595
96 2745168908 2744054657 Bacteria 5016802
97 2753810714 2751185905 Bacteria 6142767
98 2757566429 2757320391 Bacteria 4746095
99 2772642003 2772190715 Bacteria 6959372
100 2791213764 2788500588 Bacteria 4584915
101 2793181633 2791355222 Bacteria 5898266
102 2802440290 2802428803 Bacteria 5806948
103 2809056849 2808606399 Bacteria 4021018
104 2817619958 2816332336 Bacteria 5207640
105 2819585258 2818991443 Bacteria 6598732
106 2819629598 2818991451 Bacteria 4697364
107 2819668593 2818991459 Bacteria 8736032
108 2821113861 2821111986 Bacteria 6894338
109 2855676167 2855670206 Bacteria 7120389
110 2855681154 2855676851 Bacteria 7063653
111 2857294104 2857288857 Bacteria 7189066
112 2857456237 2857453340 Bacteria 8090534
113 2857467281 2857465823 Bacteria 6772595
114 2857479030 2857472729 Bacteria 6568124
115 2857592077 2857591370 Bacteria 6569758
116 2858851741 2858848962 Bacteria 6963058
117 2858882764 2858882152 Bacteria 7230291
118 2858894939 2858888857 Bacteria 7060307
119 2858899950 2858895516 Bacteria 7378898
120 2860839467 2860837431 Bacteria 4202080
121 2864733885 2864733723 Bacteria 6770668
122 2865000059 2864997549 Bacteria 5139696
123 2869048475 2869048445 Bacteria 6875584
124 2869066248 2869061728 Bacteria 7112407
125 2869075028 2869068681 Bacteria 7205615
126 2880490572 2880489317 Bacteria 7096270
127 2880501949 2880495981 Bacteria 7340502
128 2885527228 2885526491 Bacteria 7164189
129 2888583058 2888578766 Bacteria 6743310
130 2889044539 2889042446 Bacteria 7618936
131 2889054726 2889049205 Bacteria 7524325
132 2889279791 2889276214 Bacteria 5979355
133 2889297594 2889295896 Bacteria 4704906
134 2904115223 2904113452 Bacteria 7796941
135 2904165758 2904162308 Bacteria 7086713
136 2904491425 2904490793 Bacteria 7046938
137 2904600710 2904595352 Bacteria 6124848
138 2904607495 2904606771 Bacteria 4684500
139 2904759599 2904755435 Bacteria 7986759
140 2907204151 2907202186 Bacteria 6632024
141 2915597477 2915597211 Bacteria 6475886
142 2919160685 2919160200 Bacteria 6929020
143 2919426823 2919425241 Bacteria 8055701
144 2925327082 2925326138 Bacteria 9652120
145 2928513747 2928510474 Bacteria 4815308
146 2929188949 2929183550 Bacteria 6377511
147 2929207429 2929206907 Bacteria 5918291
148 2929230475 2929226422 Bacteria 7248583
149 2929234218 2929233124 Bacteria 5948380
150 2931387974 2931384279 Bacteria 7299545
151 2938654257 2938649242 Bacteria 7118381
152 2938918397 2938917290 Bacteria 5914775
153 2939594111 2939593269 Bacteria 4798695
154 2939681663 2939679117 Bacteria 6921672
155 2939707725 2939702853 Bacteria 5139229
156 2945993421 2945991243 Bacteria 7008369
157 2946056174 2946053406 Bacteria 6978655
158 2947427750 2947426588 Bacteria 5357194
159 2968564418 2968558590 Bacteria 6956864
160 2969138850 2969136845 Bacteria 3923176
161 2969766901 2969765954 Bacteria 4216713
162 2969774640 2969770375 Bacteria 4271280
163 2971411802 2971410472 Bacteria 8311090
164 2980129011 2980125574 Bacteria 5567337
165 2980494650 2980492589 Bacteria 4072961
166 2981286069 2981284811 Bacteria 4641497
167 2981291020 2981289755 Bacteria 4641509
168 2981981719 2981980479 Bacteria 4641628
169 2981986615 2981985349 Bacteria 4641497
170 2988227182 2988225383 Bacteria 7221625
171 2996635288 2996632988 Bacteria 6921523
172 2996708403 2996706504 Bacteria 5757485
173 3001275123 3001272096 Bacteria 4729684
174 3006982861 3006978542 Bacteria 5328100
175 3006985154 3006984091 Bacteria 4207523
176 648170155 648028048 Bacteria 5394884
177 8003831117 8003830390 Bacteria 6541657
178 8022622178 8022621104 Bacteria 5241040
179 8022654069 8022653035 Bacteria 4035078
180 8023449256 8023444577 Bacteria 5661597
181 8054471076 8054465665 Bacteria 7323556
182 8054705593 8054704163 Bacteria 7247792
183 8054733980 8054727385 Bacteria 7558670
184 8054735531 8054734606 Bacteria 6947278
185 8054796106 8054795415 Bacteria 9785225
186 8055534660 8055531788 Bacteria 5249694
187 8055637751 8055632911 Bacteria 5283357
188 8056538092 8056533031 Bacteria 8964429
189 8057981723 8057977335 Bacteria 5694872
190 Ga0496117_0010874
191 JGI25151J46595_10002917
192 JGI25151J46595_10012308
193 JGI25151J46595_10013325
194 JGI25151J46595_10035213
195 JGI25151J46595_10036783
196 Ga0055538_1000159
197 Ga0055538_1000696
198 Ga0055532_1000145
199 Ga0055532_1000490
200 Ga0055541_1007346
201 Ga0081538_10005853
202 Ga0081539_10000062
203 Ga0105251_10024777
204 Ga0105250_10045020
205 Ga0105246_10007795
206 Ga0209784_100090
207 Ga0209784_100963
208 Ga0209566_100052
209 Ga0209566_100156
210 Ga0209566_102807
211 Ga0209147_100014
212 Ga0209147_100057
213 Ga0209147_103660
214 Ga0209676_1008049
215 Ga0209676_1008991
216 Ga0209676_1034598
217 Ga0209025_1000041
218 Ga0209025_1003470
219 Ga0209025_1014884
220 Ga0207655_1012592
221 Ga0237817_10389
222 Ga0307407_10062175
223 Ga0237819_03250
224 Ga0439436_0003006
225 Ga0439439_0002518
226 Ga0439433_0006602
227 Ga0439433_0009986
228 Ga0439449_0009929
229 Ga0439462_0006178
230 Ga0439462_0010800
231 Ga0466967_0000127
232 Ga0496102_0231963
233 Ga0496103_0126941
234 Ga0496116_0000949
235 Ga0496116_0001248
236 Ga0496116_0011123
237 Ga0496117_0023034
238 Ga0496118_0006051
239 Ga0496119_0000890
240 Ga0496119_0014132
241 Ga0496120_0000700
242 Ga0496120_0029552
243 Ga0496121_0025454
244 Ga0496121_0026178
245 Ga0496122_0003308
246 Ga0496122_0027107
247 Ga0496122_0038926
248 Ga0496123_0022602
249 Ga0496123_0157377
250 Ga0496124_0000207
251 Ga0496124_0001602
252 Ga0496124_0019633
253 Ga0496124_0032984
254 Ga0496124_0041235
255 Ga0496125_0001843
256 Ga0496125_0005938
257 Ga0496125_0008509
258 Ga0496125_0029186
259 Ga0496125_0108305
260 Ga0496125_0194443
261 Ga0496126_0000730
262 Ga0496126_0002092
263 Ga0496126_0006821
264 2512639590
265 2540606998
266 2550899952
267 2553392866
268 2563928259
269 2571527612
270 2573040207
271 2587742659
272 2595319093
273 2601640216
274 2643737671
275 2644421921
276 2644703360
277 2644713444
278 2673821996
279 2685148953
280 2698324213
281 2721504357
282 2723603857
283 2728531313
284 2739232772
285 2745168908
286 2753810714
287 2757566429
288 2772642003
289 2791213764
290 2793181633
291 2802440290
292 2809056849
293 2817619958
294 2819585258
295 2819629598
296 2819668593
297 2821113861
298 2855676167
299 2855681154
300 2857294104
301 2857456237
302 2857467281
303 2857479030
304 2857592077
305 2858851741
306 2858882764
307 2858894939
308 2858899950
309 2860839467
310 2864733885
311 2865000059
312 2869048475
313 2869066248
314 2869075028
315 2880490572
316 2880501949
317 2885527228
318 2888583058
319 2889044539
320 2889054726
321 2889279791
322 2889297594
323 2904115223
324 2904165758
325 2904491425
326 2904600710
327 2904607495
328 2904759599
329 2907204151
330 2915597477
331 2919160685
332 2919426823
333 2925327082
334 2928513747
335 2929188949
336 2929207429
337 2929230475
338 2929234218
339 2931387974
340 2938654257
341 2938918397
342 2939594111
343 2939681663
344 2939707725
345 2945993421
346 2946056174
347 2947427750
348 2968564418
349 2969138850
350 2969766901
351 2969774640
352 2971411802
353 2980129011
354 2980494650
355 2981286069
356 2981291020
357 2981981719
358 2981986615
359 2988227182
360 2996635288
361 2996708403
362 3001275123
363 3006982861
364 3006985154
365 648170155
366 8003831117
367 8022622178
368 8022654069
369 8023449256
370 8054471076
371 8054705593
372 8054733980
373 8054735531
374 8054796106
375 8055534660
376 8055637751
377 8056538092
378 8057981723

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

291

366

0.93

PF07883

Cupin_2

Cupin domain

113

186

0.86

PF00190

Cupin_1

Cupin

82

221

0.85

PF00190

Cupin_1

Cupin

259

400

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6l9i-assembly1.cif.gz_A crystal structure of lactobacillus farciminis oxalate decarboxylase formate complex 0.9761 43 379
6l9i-assembly1.cif.gz_A crystal structure of lactobacillus farciminis oxalate decarboxylase formate complex 0.9704 43 379
2vqa-assembly1.cif.gz_C protein-folding location can regulate mn versus cu- or zn-binding. crystal structure of mnca. 0.9604 52 386
5hi0-assembly1.cif.gz_A the substrate binding mode and chemical basis of a reaction specificity switch in oxalate decarboxylase 0.9494 12 388
2uya-assembly1.cif.gz_A del162-163 mutant of bacillus subtilis oxalate decarboxylase oxdc 0.9493 12 388
ID Description Score Start End Superfamily
1l3jA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9879 63 234 2.60.120.10
1l3jA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9711 63 234 2.60.120.10
2vqaB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9585 63 234 2.60.120.10
4i4aA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9404 262 341 2.60.120.10
2vqaC01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9385 236 386 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A285UJZ1-F1-model_v4 Oxalate decarboxylase family bicupin protein 0.9963 242 386 GO:0046872
AF-A0A4Y9UBF9-F1-model_v4 Cupin domain-containing protein 0.9911 268 387 GO:0046872
AF-J4GS19-F1-model_v4 Cupin type-1 domain-containing protein 0.9892 240 386 GO:0046872
AF-A0A0B7FV09-F1-model_v4 Oxalate decarboxylase (EC 4.1.1.2) 0.988 81 317 GO:0033609
GO:0046564
GO:0046872
AF-M5C3S9-F1-model_v4 Oxalate decarboxylase (EC 4.1.1.2) 0.9871 81 390 GO:0033609
GO:0046564
GO:0046872

Map