F291305

General Info

Members Datasets Scaffolds Average Seq Length
189 143 153 204

Family's Representative Sequence

Representative Sequence 3300041486|Ga0451807_1264441|Ga0451807_1264441_16_627
Length 203
Sequence MAQYNPAVDEYIARSADFAKPVLEYLRTVVHETCPDVEEVVKWGYPHFDYKGDMMCILGSFKSHISFSIYKAELMDDPKLVESVKAGKKMGYMDKVKSMEDLPSKEVLISYIKEGMALNEKGIKKVRPVSDKPKVIEMPDYFQQQLEANPKAKAVFESKSDSFRKEYLVWIIDAKTEATRLKRMEQSLEWIAEGKGRFWQYVK

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
6 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
7 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
12 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
13 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
14 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
15 2643221559 Lysobacter sp. Root559 Isolate Unclassified
16 2643221586 Lysobacter sp. Root667 Isolate Unclassified
17 2643221612 Lysobacter sp. Root76 Isolate Unclassified
18 2643221727 Lysobacter sp. Root96 Isolate Unclassified
19 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
20 2738541283 Pedobacter sp. OK701 Isolate Unclassified
21 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
22 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
23 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
24 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
25 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
26 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
27 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
28 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
29 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
30 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
31 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
32 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
33 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
34 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
35 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
36 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
37 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
38 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
41 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
42 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
43 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
44 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
45 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
78 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
91 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
92 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
96 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
99 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
100 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
104 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
105 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
106 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
107 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
108 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
109 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
112 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
113 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
135 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
136 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
137 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
138 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
139 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
140 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
143 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.95
Metatranscriptomes 0
Isolates 19.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 0.53
Rhizoplane 3.17
Rhizosphere 65.08
Stem 0
Stem Tuber 0
Unclassified 20.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001002 3300001915 Bacteria 8474
2 JGI24739J22299_10005386 3300001989 Bacteria 4869
3 JGI25162J39368_1001166 3300002737 Bacteria 15605
4 JGI25164J39214_1001361 3300002772 Bacteria 5926
5 JGI25165J46597_1001011 3300003214 Bacteria 18622
6 rootH2_10270571 3300003320 Bacteria 1284
7 rootL2_10040356 3300003322 Bacteria 2679
8 rootL2_10075459 3300003322 Bacteria 1911
9 Ga0055534_1002139 3300003784 Bacteria 7076
10 Ga0065714_10065362 3300005288 Bacteria 10622
11 Ga0065714_10071719 3300005288 Bacteria 3507
12 Ga0070682_100000065 3300005337 Bacteria 100147
13 Ga0070668_100122934 3300005347 Bacteria 2076
14 Ga0070668_100134750 3300005347 Bacteria 1985
15 Ga0070674_100097000 3300005356 Bacteria 2140
16 Ga0070667_100002807 3300005367 Bacteria 15027
17 Ga0068853_100494695 3300005539 Bacteria 1154
18 Ga0068855_100242365 3300005563 Bacteria 2014
19 Ga0068855_100787997 3300005563 Bacteria 1011
20 Ga0068857_100292064 3300005577 Bacteria 1501
21 Ga0068856_100035986 3300005614 Bacteria 4855
22 Ga0068856_100308095 3300005614 Bacteria 1601
23 Ga0068860_100004577 3300005843 Bacteria 14118
24 Ga0075366_10002731 3300006195 Bacteria 9117
25 Ga0075366_10059273 3300006195 Bacteria 2274
26 Ga0105244_10000005 3300009036 Bacteria 481412
27 Ga0105240_10212206 3300009093 Bacteria 2261
28 Ga0105240_10272734 3300009093 Unclassified 1947
29 Ga0105240_10783599 3300009093 Bacteria 1034
30 Ga0105243_10000021 3300009148 Bacteria 213782
31 Ga0105241_10065832 3300009174 Bacteria 2801
32 Ga0105237_10000901 3300009545 Bacteria 40025
33 Ga0105237_10014296 3300009545 Bacteria 8308
34 Ga0105237_10156141 3300009545 Bacteria 2279
35 Ga0105238_10405605 3300009551 Bacteria 1357
36 Ga0105239_10000002 3300010375 Bacteria 610298
37 Ga0105239_10000186 3300010375 Bacteria 90998
38 Ga0105239_10058965 3300010375 Bacteria 4213
39 Ga0157371_10003985 3300013102 Bacteria 13086
40 Ga0157370_10003093 3300013104 Bacteria 19700
41 Ga0157370_10007845 3300013104 Bacteria 11567
42 Ga0157369_10145777 3300013105 Bacteria 2503
43 Ga0157378_10007416 3300013297 Bacteria 9583
44 Ga0163162_10000564 3300013306 Bacteria 34206
45 Ga0157372_11085200 3300013307 Bacteria 926
46 Ga0157375_10000417 3300013308 Bacteria 38744
47 Ga0157375_10025424 3300013308 Bacteria 5501
48 Ga0157375_10081972 3300013308 Bacteria 3267
49 Ga0182008_10000500 3300014497 Bacteria 29578
50 Ga0182006_1000001 3300015261 Bacteria 1091090
51 Ga0182006_1000751 3300015261 Bacteria 22191
52 Ga0163161_10006946 3300017792 Bacteria 7825
53 Ga0209563_103044 3300025230 Bacteria 3581
54 Ga0207427_100199 3300025231 Bacteria 57386
55 Ga0209437_100048 3300025233 Bacteria 405107
56 Ga0209026_1000441 3300025250 Bacteria 33774
57 Ga0209233_1000029 3300025261 Bacteria 641642
58 Ga0209675_1000066 3300025291 Bacteria 171883
59 Ga0207655_1000016 3300025728 Bacteria 551476
60 Ga0207647_10113609 3300025904 Bacteria 1600
61 Ga0207695_10566736 3300025913 Unclassified 1017
62 Ga0207695_10729330 3300025913 Bacteria 871
63 Ga0207671_10000494 3300025914 Bacteria 53548
64 Ga0207671_10002456 3300025914 Bacteria 19812
65 Ga0207694_10278735 3300025924 Bacteria 1373
66 Ga0207709_10000281 3300025935 Bacteria 58322
67 Ga0207667_10109433 3300025949 Bacteria 2850
68 Ga0207668_10068694 3300025972 Bacteria 2520
69 Ga0207658_10043490 3300025986 Bacteria 3265
70 Ga0207702_10355079 3300026078 Unclassified 1403
71 Ga0207702_11394161 3300026078 Unclassified 695
72 Ga0207674_10733524 3300026116 Bacteria 954
73 Ga0307517_10030143 3300028786 Bacteria 6372
74 Ga0307515_10000675 3300028794 Bacteria 78628
75 Ga0307412_10000027 3300031911 Bacteria 214663
76 Ga0307412_10001905 3300031911 Bacteria 11537
77 Ga0307412_10032747 3300031911 Bacteria 3297
78 Ga0307416_100000006 3300032002 Bacteria 466074
79 Ga0307414_10000061 3300032004 Bacteria 109693
80 Ga0307414_10447376 3300032004 Bacteria 1132
81 Ga0439439_0021135 3300041406 Bacteria 1620
82 Ga0439465_0000001 3300041413 Bacteria 82718
83 Ga0439465_0202142 3300041413 Bacteria 724
84 Ga0451807_1264441 3300041486 Unclassified 824
85 Ga0439445_0000096 3300042004 Bacteria 14081
86 Ga0439462_0021861 3300042015 Bacteria 1673
87 Ga0450905_028573 3300042142 Bacteria 851
88 Ga0495651_0071331 3300046462 Bacteria 2641
89 Ga0495585_0002448 3300046492 Bacteria 13297
90 Ga0495606_0000074 3300046507 Bacteria 170848
91 Ga0495606_0001076 3300046507 Bacteria 39269
92 Ga0495606_0023801 3300046507 Bacteria 4428
93 Ga0495606_0033246 3300046507 Bacteria 3559
94 Ga0495610_0000005 3300046512 Bacteria 924111
95 Ga0495610_0001474 3300046512 Bacteria 20725
96 Ga0495610_0003350 3300046512 Bacteria 12569
97 Ga0495616_0007655 3300046513 Bacteria 6461
98 Ga0495631_0099508 3300046518 Bacteria 1252
99 Ga0495643_0049133 3300046522 Bacteria 2276
100 Ga0495648_0005242 3300046524 Bacteria 10834
101 Ga0495648_0095452 3300046524 Bacteria 1654
102 Ga0495663_0000614 3300046525 Bacteria 12396
103 Ga0495609_0000003 3300046538 Bacteria 711547
104 Ga0495609_0160693 3300046538 Bacteria 952
105 Ga0495622_0010125 3300046557 Bacteria 4361
106 Ga0495633_0048498 3300046558 Unclassified 2005
107 Ga0495633_0141454 3300046558 Unclassified 1112
108 Ga0495668_0006454 3300046616 Bacteria 7677
109 Ga0495625_0000005 3300046660 Bacteria 596135
110 Ga0495625_0000376 3300046660 Bacteria 68173
111 Ga0495625_0000634 3300046660 Bacteria 50477
112 Ga0495661_0020355 3300046665 Bacteria 4333
113 Ga0495658_0069091 3300046683 Bacteria 2047
114 Ga0495671_0136618 3300046692 Bacteria 1195
115 Ga0495649_0000003 3300046694 Bacteria 880817
116 Ga0495660_0066865 3300046810 Bacteria 1916
117 Ga0495687_001274 3300047443 Bacteria 23725
118 Ga0495614_0018535 3300048089 Bacteria 3015
119 Ga0496102_0061026 3300048905 Bacteria 3450
120 Ga0496103_0129133 3300048906 Bacteria 1613
121 Ga0496105_0166914 3300048908 Bacteria 1806
122 Ga0496113_0069603 3300048916 Bacteria 2673
123 Ga0496116_0000029 3300048919 Bacteria 422187
124 Ga0496117_0000007 3300048920 Bacteria 720505
125 Ga0496118_0001189 3300048921 Bacteria 40153
126 Ga0496119_0000007 3300048922 Bacteria 475920
127 Ga0496122_0000089 3300048925 Bacteria 206107
128 Ga0496122_0000151 3300048925 Bacteria 162224
129 Ga0496122_0000153 3300048925 Bacteria 161087
130 Ga0496122_0001168 3300048925 Bacteria 44890
131 Ga0496122_0001890 3300048925 Bacteria 31698
132 Ga0496123_0001687 3300048926 Bacteria 29564
133 Ga0496123_0002751 3300048926 Bacteria 21039
134 Ga0496123_0004599 3300048926 Bacteria 14364
135 Ga0496123_0019504 3300048926 Bacteria 5342
136 Ga0496123_0122939 3300048926 Bacteria 1455
137 Ga0496124_0012031 3300048927 Bacteria 8597
138 Ga0496125_0000661 3300048928 Bacteria 57455
139 Ga0496125_0011373 3300048928 Bacteria 8908
140 Ga0496125_0057102 3300048928 Bacteria 3164
141 Ga0496125_0153924 3300048928 Unclassified 1574
142 Ga0496126_0001535 3300048929 Bacteria 35570
143 Ga0496126_0022551 3300048929 Bacteria 6123
144 Ga0501269_000002 3300049766 Bacteria 118370
145 nmdc:mga0k408_28806_c1 3300050493 Bacteria 3158
146 nmdc:mga0k408_543_c2 3300050493 Bacteria 13160
147 Ga0500635_0001085 3300053080 Bacteria 6499
148 Ga0500607_022071 3300053121 Bacteria 3581
149 Ga0500614_006552 3300053123 Bacteria 2447
150 Ga0500618_000067 3300053125 Bacteria 89154
151 Ga0500568_0102049 3300053139 Bacteria 1076
152 Ga0500634_0076338 3300053161 Bacteria 1740
153 Ga0500636_0137737 3300053177 Bacteria 1354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0001076 Ga0495606_0001076_495_1100 184
2 3300042142 Ga0450905_028573 Ga0450905_028573_230_841 190
3 iso_pu_bacteria 2643221559 2643817512 196
4 iso_pu_bacteria 2643221586 2643940166 196
5 iso_pu_bacteria 2643221612 2644079294 196
6 iso_pu_bacteria 2643221727 2644694738 196
7 3300015261 Ga0182006_1000001 Ga0182006_1000001604 197
8 3300046525 Ga0495663_0000614 Ga0495663_0000614_679_1290 197
9 iso_pu_bacteria 2599185184 2599479941 197
10 iso_pu_bacteria 2919437846 2919441613 197
11 iso_pu_bacteria 2928078545 2928081071 197
12 iso_pu_bacteria 2928147474 2928152509 197
13 3300041406 Ga0439439_0021135 Ga0439439_0021135_607_1212 199
14 3300041413 Ga0439465_0202142 Ga0439465_0202142_89_694 199
15 3300042015 Ga0439462_0021861 Ga0439462_0021861_509_1114 199
16 iso_pu_bacteria 2511231000 2511231384 199
17 iso_pu_bacteria 2582581278 2585141123 199
18 iso_pu_bacteria 2582581281 2585157348 199
19 iso_pu_bacteria 2582581282 2585161617 199
20 iso_pu_bacteria 2585428045 2587676991 199
21 iso_pu_bacteria 2585428060 2587746483 199
22 iso_pu_bacteria 2585428182 2588211247 199
23 iso_pu_bacteria 2585428183 2588215622 199
24 iso_pu_bacteria 2585428184 2588219034 199
25 iso_pu_bacteria 2585428185 2588224529 199
26 iso_pu_bacteria 2588253712 2588447312 199
27 iso_pu_bacteria 2588254255 2590602953 199
28 iso_pu_bacteria 2588254257 2590609958 199
29 iso_pu_bacteria 2728369107 2729201045 199
30 iso_pu_bacteria 2751185877 2753673974 199
31 iso_pu_bacteria 2765235839 2765575435 199
32 iso_pu_bacteria 2772190705 2772604930 199
33 iso_pu_bacteria 2775506739 2775674540 199
34 iso_pu_bacteria 2816332188 2816875277 199
35 iso_pu_bacteria 2842083920 2842087137 199
36 iso_pu_bacteria 2871720351 2871722621 199
37 iso_pu_bacteria 2889290771 2889294056 199
38 iso_pu_bacteria 2905999023 2905999234 199
39 iso_pu_bacteria 2919097161 2919098156 199
40 iso_pu_bacteria 2919399522 2919401496 199
41 iso_pu_bacteria 2945924605 2945924992 199
42 iso_pu_bacteria 2946019816 2946023837 199
43 3300041486 Ga0451807_1264441 Ga0451807_1264441_16_627 200
44 iso_pu_bacteria 2738541283 2738755206 200
45 3300001989 JGI24739J22299_10005386 JGI24739J22299_100053864 201
46 3300002737 JGI25162J39368_1001166 JGI25162J39368_100116613 201
47 3300002772 JGI25164J39214_1001361 JGI25164J39214_10013615 201
48 3300003214 JGI25165J46597_1001011 JGI25165J46597_10010115 201
49 3300003320 rootH2_10270571 rootH2_102705712 201
50 3300003322 rootL2_10075459 rootL2_100754591 201
51 3300005288 Ga0065714_10071719 Ga0065714_100717193 201
52 3300005356 Ga0070674_100097000 Ga0070674_1000970002 201
53 3300005367 Ga0070667_100002807 Ga0070667_10000280714 201
54 3300005563 Ga0068855_100242365 Ga0068855_1002423653 201
55 3300005563 Ga0068855_100787997 Ga0068855_1007879971 201
56 3300005577 Ga0068857_100292064 Ga0068857_1002920642 201
57 3300005614 Ga0068856_100035986 Ga0068856_1000359862 201
58 3300005614 Ga0068856_100308095 Ga0068856_1003080952 201
59 3300005843 Ga0068860_100004577 Ga0068860_10000457712 201
60 3300006195 Ga0075366_10002731 Ga0075366_1000273112 201
61 3300006195 Ga0075366_10059273 Ga0075366_100592731 201
62 3300009093 Ga0105240_10212206 Ga0105240_102122063 201
63 3300009093 Ga0105240_10272734 Ga0105240_102727343 201
64 3300009093 Ga0105240_10783599 Ga0105240_107835992 201
65 3300009174 Ga0105241_10065832 Ga0105241_100658323 201
66 3300009545 Ga0105237_10000901 Ga0105237_100009012 201
67 3300009545 Ga0105237_10014296 Ga0105237_100142966 201
68 3300009545 Ga0105237_10156141 Ga0105237_101561412 201
69 3300009551 Ga0105238_10405605 Ga0105238_104056051 201
70 3300010375 Ga0105239_10000002 Ga0105239_10000002189 201
71 3300010375 Ga0105239_10000186 Ga0105239_1000018622 201
72 3300010375 Ga0105239_10058965 Ga0105239_100589654 201
73 3300013102 Ga0157371_10003985 Ga0157371_100039854 201
74 3300013105 Ga0157369_10145777 Ga0157369_101457772 201
75 3300013297 Ga0157378_10007416 Ga0157378_100074162 201
76 3300013306 Ga0163162_10000564 Ga0163162_1000056417 201
77 3300013307 Ga0157372_11085200 Ga0157372_110852002 201
78 3300013308 Ga0157375_10025424 Ga0157375_100254246 201
79 3300025230 Ga0209563_103044 Ga0209563_1030443 201
80 3300025231 Ga0207427_100199 Ga0207427_1001995 201
81 3300025233 Ga0209437_100048 Ga0209437_10004813 201
82 3300025250 Ga0209026_1000441 Ga0209026_10004418 201
83 3300025261 Ga0209233_1000029 Ga0209233_1000029364 201
84 3300025904 Ga0207647_10113609 Ga0207647_101136092 201
85 3300025913 Ga0207695_10566736 Ga0207695_105667361 201
86 3300025913 Ga0207695_10729330 Ga0207695_107293301 201
87 3300025914 Ga0207671_10000494 Ga0207671_1000049426 201
88 3300025914 Ga0207671_10002456 Ga0207671_1000245614 201
89 3300025924 Ga0207694_10278735 Ga0207694_102787351 201
90 3300025949 Ga0207667_10109433 Ga0207667_101094334 201
91 3300025986 Ga0207658_10043490 Ga0207658_100434903 201
92 3300026078 Ga0207702_10355079 Ga0207702_103550792 201
93 3300026078 Ga0207702_11394161 Ga0207702_113941611 201
94 3300026116 Ga0207674_10733524 Ga0207674_107335241 201
95 3300028786 Ga0307517_10030143 Ga0307517_1003014310 201
96 3300028794 Ga0307515_10000675 Ga0307515_1000067527 201
97 3300046462 Ga0495651_0071331 Ga0495651_0071331_1722_2336 201
98 3300046492 Ga0495585_0002448 Ga0495585_0002448_11623_12237 201
99 3300046507 Ga0495606_0000074 Ga0495606_0000074_46425_47039 201
100 3300046518 Ga0495631_0099508 Ga0495631_0099508_420_1034 201
101 3300046524 Ga0495648_0005242 Ga0495648_0005242_3574_4188 201
102 3300046524 Ga0495648_0095452 Ga0495648_0095452_382_996 201
103 3300046538 Ga0495609_0160693 Ga0495609_0160693_31_645 201
104 3300046557 Ga0495622_0010125 Ga0495622_0010125_2959_3573 201
105 3300046616 Ga0495668_0006454 Ga0495668_0006454_3294_3908 201
106 3300046660 Ga0495625_0000376 Ga0495625_0000376_35145_35759 201
107 3300046660 Ga0495625_0000634 Ga0495625_0000634_49770_50384 201
108 3300046683 Ga0495658_0069091 Ga0495658_0069091_884_1498 201
109 3300046810 Ga0495660_0066865 Ga0495660_0066865_200_814 201
110 3300047443 Ga0495687_001274 Ga0495687_001274_2746_3360 201
111 3300048089 Ga0495614_0018535 Ga0495614_0018535_1681_2295 201
112 3300050493 nmdc:mga0k408_28806_c1 nmdc:mga0k408_28806_c1_469_1083 201
113 3300050493 nmdc:mga0k408_543_c2 nmdc:mga0k408_543_c2_7045_7659 201
114 3300053080 Ga0500635_0001085 Ga0500635_0001085_5135_5749 201
115 3300053123 Ga0500614_006552 Ga0500614_006552_1617_2231 201
116 3300053125 Ga0500618_000067 Ga0500618_000067_85668_86282 201
117 3300053161 Ga0500634_0076338 Ga0500634_0076338_321_935 201
118 3300053177 Ga0500636_0137737 Ga0500636_0137737_628_1242 201
119 3300003322 rootL2_10040356 rootL2_100403563 202
120 3300013104 Ga0157370_10003093 Ga0157370_100030936 202
121 3300014497 Ga0182008_10000500 Ga0182008_1000050016 202
122 3300015261 Ga0182006_1000751 Ga0182006_100075115 202
123 3300046512 Ga0495610_0001474 Ga0495610_0001474_877_1500 202
124 3300046512 Ga0495610_0003350 Ga0495610_0003350_4600_5265 202
125 3300046513 Ga0495616_0007655 Ga0495616_0007655_4686_5351 202
126 3300046558 Ga0495633_0048498 Ga0495633_0048498_755_1420 202
127 3300046558 Ga0495633_0141454 Ga0495633_0141454_215_838 202
128 3300046660 Ga0495625_0000005 Ga0495625_0000005_430884_431549 202
129 3300046665 Ga0495661_0020355 Ga0495661_0020355_2653_3318 202
130 3300046692 Ga0495671_0136618 Ga0495671_0136618_418_1083 202
131 3300046694 Ga0495649_0000003 Ga0495649_0000003_611642_612307 202
132 3300048925 Ga0496122_0001890 Ga0496122_0001890_14005_14628 202
133 3300048926 Ga0496123_0019504 Ga0496123_0019504_3369_3992 202
134 3300048928 Ga0496125_0153924 Ga0496125_0153924_300_923 202
135 3300053121 Ga0500607_022071 Ga0500607_022071_1048_1722 202
136 3300053139 Ga0500568_0102049 Ga0500568_0102049_127_792 202
137 3300001915 JGI24741J21665_1001002 JGI24741J21665_10010028 203
138 3300003784 Ga0055534_1002139 Ga0055534_10021394 203
139 3300005288 Ga0065714_10065362 Ga0065714_100653629 203
140 3300005337 Ga0070682_100000065 Ga0070682_10000006529 203
141 3300005347 Ga0070668_100122934 Ga0070668_1001229342 203
142 3300005347 Ga0070668_100134750 Ga0070668_1001347502 203
143 3300005539 Ga0068853_100494695 Ga0068853_1004946952 203
144 3300009036 Ga0105244_10000005 Ga0105244_10000005198 203
145 3300009148 Ga0105243_10000021 Ga0105243_10000021146 203
146 3300013104 Ga0157370_10007845 Ga0157370_100078457 203
147 3300013308 Ga0157375_10000417 Ga0157375_100004178 203
148 3300013308 Ga0157375_10081972 Ga0157375_100819724 203
149 3300017792 Ga0163161_10006946 Ga0163161_100069462 203
150 3300025291 Ga0209675_1000066 Ga0209675_100006610 203
151 3300025728 Ga0207655_1000016 Ga0207655_1000016197 203
152 3300025935 Ga0207709_10000281 Ga0207709_1000028150 203
153 3300025972 Ga0207668_10068694 Ga0207668_100686942 203
154 3300031911 Ga0307412_10000027 Ga0307412_10000027175 203
155 3300031911 Ga0307412_10001905 Ga0307412_1000190510 203
156 3300031911 Ga0307412_10032747 Ga0307412_100327473 203
157 3300032002 Ga0307416_100000006 Ga0307416_100000006345 203
158 3300032004 Ga0307414_10000061 Ga0307414_1000006142 203
159 3300032004 Ga0307414_10447376 Ga0307414_104473761 203
160 3300041413 Ga0439465_0000001 Ga0439465_0000001_78960_79571 203
161 3300042004 Ga0439445_0000096 Ga0439445_0000096_12592_13203 203
162 3300046507 Ga0495606_0023801 Ga0495606_0023801_950_1561 203
163 3300046507 Ga0495606_0033246 Ga0495606_0033246_2333_2944 203
164 3300046512 Ga0495610_0000005 Ga0495610_0000005_467582_468193 203
165 3300046522 Ga0495643_0049133 Ga0495643_0049133_595_1215 203
166 3300046538 Ga0495609_0000003 Ga0495609_0000003_483882_484493 203
167 3300048905 Ga0496102_0061026 Ga0496102_0061026_714_1325 203
168 3300048906 Ga0496103_0129133 Ga0496103_0129133_730_1341 203
169 3300048908 Ga0496105_0166914 Ga0496105_0166914_1171_1782 203
170 3300048916 Ga0496113_0069603 Ga0496113_0069603_318_929 203
171 3300048919 Ga0496116_0000029 Ga0496116_0000029_363240_363851 203
172 3300048920 Ga0496117_0000007 Ga0496117_0000007_360357_360968 203
173 3300048921 Ga0496118_0001189 Ga0496118_0001189_5882_6493 203
174 3300048922 Ga0496119_0000007 Ga0496119_0000007_360424_361035 203
175 3300048925 Ga0496122_0000089 Ga0496122_0000089_39874_40485 203
176 3300048925 Ga0496122_0000151 Ga0496122_0000151_115346_115957 203
177 3300048925 Ga0496122_0000153 Ga0496122_0000153_99828_100439 203
178 3300048925 Ga0496122_0001168 Ga0496122_0001168_36585_37196 203
179 3300048926 Ga0496123_0001687 Ga0496123_0001687_4710_5321 203
180 3300048926 Ga0496123_0002751 Ga0496123_0002751_4328_4939 203
181 3300048926 Ga0496123_0004599 Ga0496123_0004599_6532_7143 203
182 3300048926 Ga0496123_0122939 Ga0496123_0122939_362_973 203
183 3300048927 Ga0496124_0012031 Ga0496124_0012031_365_976 203
184 3300048928 Ga0496125_0000661 Ga0496125_0000661_24450_25061 203
185 3300048928 Ga0496125_0011373 Ga0496125_0011373_1173_1784 203
186 3300048928 Ga0496125_0057102 Ga0496125_0057102_1678_2289 203
187 3300048929 Ga0496126_0001535 Ga0496126_0001535_8419_9030 203
188 3300048929 Ga0496126_0022551 Ga0496126_0022551_218_829 203
189 3300049766 Ga0501269_000002 Ga0501269_000002_114663_115274 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13376

OmdA

Bacteriocin-protection, YdeI or OmpD-Associated

135

194

0.98

PF18899

DUF5655

Domain of unknown function (DUF5655)

8

119

0.93

PF08818

DUF1801

Domain of unknown function (DU1801)

19

116

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.7365 9 121
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7126 5 124
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6898 9 121
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6883 5 124
3tg9-assembly1.cif.gz_A the crystal structure of penicillin binding protein from bacillus halodurans 0.6586 39 69
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7898 4 116 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7773 4 116 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7188 5 121 3.90.1150.200
af_A0A1D8PJZ1_558_689_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.7093 53 70 2.60.200.20
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7092 5 121 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A0A0IXS6-F1-model_v4 deleted 0.9817 135 196
AF-A0A3G8Z9Z3-F1-model_v4 DUF1905 domain-containing protein 0.9771 135 195
AF-A0A7W0T8V1-F1-model_v4 DUF1905 domain-containing protein 0.9768 133 196
AF-A0A3N5Y7I4-F1-model_v4 deleted 0.9727 133 194
AF-A0A7Y2ERK7-F1-model_v4 DUF1905 domain-containing protein 0.9681 133 195

Feature Viewer

pLDDT pTM Quality
88.62 0.61 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map