F291223

General Info

Members Datasets Scaffolds Average Seq Length
189 148 187 248

Family's Representative Sequence

Representative Sequence 3300035116|Ga0373945_0027235|Ga0373945_0027235_614_1396
Length 260
Sequence MKHSPPLRPAGWLRRSLGLALWTITAASAHAADLTVSAAASLTNAFKDLGPMFEAANPGTKVLFNFGASGALLQQIAKGGAPVDVFASADQETMDQAQSQGLVQAAQRRDFVSNTLVVIVPASANSVPKAASDLTQAGYQRIAIGLPASVPVGRYTKGVLEAAGLWAAIEPKMVGASNVRQALDYVARAEVDAGFVYATDAAIMSDKVKVAVMVPTGKPVLYPVAPIAASANAAMAARFVDYLLSAQAQAVLTKYGFGKP

Samples

Sample ID Description Type Environment
1 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
2 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
104 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
105 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
106 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
107 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
108 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
109 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
115 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
121 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
122 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
123 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
134 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
139 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
140 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
141 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
142 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.82
Nodule 1.06
Rhizoplane 3.7
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 3.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10302418 3300003322 Bacteria 1259
2 rootH1_10162486 3300003323 Bacteria 1017
3 Ga0055524_1000013 3300003775 Bacteria 259850
4 Ga0055530_10002224 3300003791 Bacteria 12789
5 Ga0055540_1000119 3300003792 Bacteria 82568
6 Ga0055531_10009974 3300003794 Bacteria 4789
7 Ga0065707_10181441 3300005295 Bacteria 1405
8 Ga0070676_10209736 3300005328 Bacteria 1281
9 Ga0070677_10064895 3300005333 Bacteria 1518
10 Ga0068869_100136812 3300005334 Bacteria 1888
11 Ga0070687_100190279 3300005343 Bacteria 1236
12 Ga0070661_100002454 3300005344 Bacteria 12721
13 Ga0070669_100002697 3300005353 Bacteria 12801
14 Ga0070675_100068262 3300005354 Bacteria 2944
15 Ga0070675_100783823 3300005354 Bacteria 871
16 Ga0070674_100051247 3300005356 Bacteria 2844
17 Ga0070673_100004348 3300005364 Bacteria 8951
18 Ga0070673_100106053 3300005364 Bacteria 2322
19 Ga0070659_100003845 3300005366 Bacteria 10701
20 Ga0070700_100019483 3300005441 Bacteria 3916
21 Ga0070678_100093195 3300005456 Bacteria 2316
22 Ga0070678_100308315 3300005456 Bacteria 1347
23 Ga0070662_100179752 3300005457 Bacteria 1667
24 Ga0068867_100083014 3300005459 Bacteria 2418
25 Ga0070699_100644454 3300005518 Bacteria 967
26 Ga0070672_100012261 3300005543 Bacteria 6009
27 Ga0070672_100104813 3300005543 Bacteria 2298
28 Ga0068855_100070050 3300005563 Bacteria 4081
29 Ga0070664_100002177 3300005564 Bacteria 15739
30 Ga0070664_100021009 3300005564 Bacteria 5378
31 Ga0068857_100333578 3300005577 Bacteria 1402
32 Ga0070702_100309554 3300005615 Bacteria 1096
33 Ga0068852_100091087 3300005616 Bacteria 2728
34 Ga0068859_100093233 3300005617 Bacteria 3063
35 Ga0068866_10002199 3300005718 Bacteria 8125
36 Ga0068861_100005479 3300005719 Bacteria 8601
37 Ga0068861_100458521 3300005719 Bacteria 1144
38 Ga0068863_100685527 3300005841 Bacteria 1018
39 Ga0068863_100755420 3300005841 Bacteria 968
40 Ga0068858_100004653 3300005842 Bacteria 13447
41 Ga0068860_100003922 3300005843 Bacteria 15282
42 Ga0068860_100008698 3300005843 Bacteria 10113
43 Ga0068862_100007078 3300005844 Bacteria 9315
44 Ga0097621_100208898 3300006237 Bacteria 1698
45 Ga0097621_100342975 3300006237 Bacteria 1327
46 Ga0068871_100181534 3300006358 Bacteria 1809
47 Ga0075428_100437550 3300006844 Bacteria 1401
48 Ga0068865_100369941 3300006881 Bacteria 1166
49 Ga0097620_100093230 3300006931 Bacteria 3063
50 Ga0079104_1000351 3300006946 Bacteria 55504
51 Ga0105244_10001646 3300009036 Bacteria 17689
52 Ga0105240_10003100 3300009093 Bacteria 26142
53 Ga0105247_10247948 3300009101 Bacteria 1216
54 Ga0105243_10095414 3300009148 Bacteria 2458
55 Ga0105248_10238784 3300009177 Bacteria 2046
56 Ga0105248_10286820 3300009177 Bacteria 1853
57 Ga0105237_10000322 3300009545 Bacteria 67344
58 Ga0105238_10005482 3300009551 Bacteria 12541
59 Ga0105249_10041601 3300009553 Bacteria 4178
60 Ga0105239_10000750 3300010375 Bacteria 46021
61 Ga0157316_1005557 3300012510 Bacteria 1000
62 Ga0157378_10008964 3300013297 Bacteria 8711
63 Ga0163162_10006662 3300013306 Bacteria 11201
64 Ga0157375_10186758 3300013308 Bacteria 2226
65 Ga0157375_10233368 3300013308 Bacteria 1999
66 Ga0157380_10005593 3300014326 Bacteria 8780
67 Ga0157380_10134849 3300014326 Bacteria 2112
68 Ga0157379_10007337 3300014968 Bacteria 9539
69 Ga0163161_10393922 3300017792 Bacteria 1109
70 Ga0209565_1010968 3300025263 Bacteria 2228
71 Ga0209675_1010264 3300025291 Bacteria 3213
72 Ga0209050_1000478 3300025298 Bacteria 70631
73 Ga0209050_1019939 3300025298 Bacteria 2521
74 Ga0209256_1000061 3300025299 Bacteria 260890
75 Ga0209051_1000063 3300025303 Bacteria 249739
76 Ga0209257_1000118 3300025304 Bacteria 225963
77 Ga0207655_1024603 3300025728 Bacteria 2946
78 Ga0207682_10040325 3300025893 Bacteria 1902
79 Ga0207695_10006870 3300025913 Bacteria 14648
80 Ga0207671_10001693 3300025914 Bacteria 24981
81 Ga0207662_10234556 3300025918 Bacteria 1199
82 Ga0207657_10558151 3300025919 Bacteria 895
83 Ga0207649_10000261 3300025920 Bacteria 41690
84 Ga0207694_10004751 3300025924 Bacteria 10562
85 Ga0207659_10691908 3300025926 Bacteria 873
86 Ga0207690_10005903 3300025932 Bacteria 7249
87 Ga0207669_10022541 3300025937 Bacteria 3347
88 Ga0207704_10117290 3300025938 Bacteria 1813
89 Ga0207704_10443727 3300025938 Bacteria 1034
90 Ga0207691_10006733 3300025940 Bacteria 11081
91 Ga0207691_10103838 3300025940 Bacteria 2534
92 Ga0207691_10212883 3300025940 Bacteria 1678
93 Ga0207679_10000205 3300025945 Bacteria 47113
94 Ga0207679_10006019 3300025945 Bacteria 7636
95 Ga0207679_10226934 3300025945 Bacteria 1574
96 Ga0207667_10010390 3300025949 Bacteria 10881
97 Ga0207651_10016056 3300025960 Bacteria 4373
98 Ga0207658_10059923 3300025986 Bacteria 2838
99 Ga0207703_10036925 3300026035 Bacteria 3891
100 Ga0207703_10134240 3300026035 Bacteria 2141
101 Ga0207639_10011689 3300026041 Bacteria 6103
102 Ga0207708_10029577 3300026075 Bacteria 4152
103 Ga0207641_10219918 3300026088 Bacteria 1761
104 Ga0207648_10000310 3300026089 Bacteria 53471
105 Ga0207648_10360836 3300026089 Bacteria 1311
106 Ga0207648_10403116 3300026089 Bacteria 1239
107 Ga0207675_100002208 3300026118 Bacteria 19341
108 Ga0207675_100262119 3300026118 Bacteria 1675
109 Ga0207683_10082813 3300026121 Bacteria 2851
110 Ga0207683_10203092 3300026121 Bacteria 1802
111 Ga0207683_10222213 3300026121 Bacteria 1721
112 Ga0209281_1000479 3300027111 Bacteria 55808
113 Ga0209970_1000698 3300027614 Bacteria 5833
114 Ga0268265_10021105 3300028380 Bacteria 4556
115 Ga0268265_10550774 3300028380 Bacteria 1095
116 Ga0268264_10015661 3300028381 Bacteria 6209
117 Ga0307515_10000022 3300028794 Bacteria 404064
118 Ga0307513_10004555 3300031456 Bacteria 18482
119 Ga0307513_10433527 3300031456 Bacteria 1042
120 Ga0307416_100326471 3300032002 Bacteria 1540
121 Ga0373945_0027235 3300035116 Bacteria 1996
122 Ga0373955_0163027 3300035172 Bacteria 1317
123 Ga0373927_0018715 3300035695 Bacteria 4545
124 Ga0373925_0001962 3300037068 Bacteria 17023
125 Ga0373925_0127289 3300037068 Bacteria 1983
126 Ga0395898_0188285 3300037466 Bacteria 1972
127 Ga0395905_0009903 3300037471 Bacteria 9288
128 Ga0395905_0013641 3300037471 Bacteria 7785
129 Ga0395905_0093872 3300037471 Bacteria 2814
130 Ga0395905_0121951 3300037471 Bacteria 2451
131 Ga0395905_0362056 3300037471 Bacteria 1343
132 Ga0395905_0418930 3300037471 Bacteria 1235
133 Ga0451795_1420489 3300041456 Bacteria 1032
134 Ga0439431_0040721 3300041997 Bacteria 1182
135 Ga0439462_0045928 3300042015 Bacteria 1170
136 Ga0450919_000810 3300042121 Bacteria 4015
137 Ga0450898_001650 3300042134 Bacteria 2996
138 Ga0439464_0008942 3300042439 Bacteria 2627
139 Ga0450918_000072 3300042531 Bacteria 20795
140 Ga0451576_0228316 3300045051 Bacteria 1944
141 Ga0451576_0340738 3300045051 Bacteria 1569
142 Ga0495603_0068460 3300046455 Bacteria 2089
143 Ga0495629_0406390 3300046459 Bacteria 925
144 Ga0495653_0091511 3300046463 Bacteria 2223
145 Ga0495580_0284740 3300046472 Bacteria 1127
146 Ga0495582_0035584 3300046473 Bacteria 2739
147 Ga0495594_0148556 3300046499 Bacteria 1330
148 Ga0495594_0260160 3300046499 Bacteria 988
149 Ga0495596_0000200 3300046500 Bacteria 40951
150 Ga0495628_0095667 3300046516 Bacteria 2295
151 Ga0495643_0016816 3300046522 Bacteria 4292
152 Ga0495648_0002354 3300046524 Bacteria 17552
153 Ga0495666_0109747 3300046526 Bacteria 1296
154 Ga0495642_0005514 3300046528 Bacteria 4861
155 Ga0495665_0001330 3300046531 Bacteria 13183
156 Ga0495597_0012573 3300046542 Bacteria 4081
157 Ga0495597_0023332 3300046542 Bacteria 2862
158 Ga0495645_0060437 3300046543 Bacteria 2747
159 Ga0495645_0198415 3300046543 Bacteria 1363
160 Ga0495622_0002613 3300046557 Bacteria 8689
161 Ga0495622_0103737 3300046557 Bacteria 1302
162 Ga0495668_0070754 3300046616 Bacteria 1918
163 Ga0495634_0117338 3300046642 Bacteria 1707
164 Ga0495634_0211098 3300046642 Bacteria 1202
165 Ga0495625_0012901 3300046660 Bacteria 6751
166 Ga0495625_0321492 3300046660 Bacteria 985
167 Ga0495661_0025590 3300046665 Bacteria 3810
168 Ga0495588_0022605 3300046674 Bacteria 3108
169 Ga0495588_0063051 3300046674 Bacteria 1921
170 Ga0495623_0031222 3300046679 Bacteria 3425
171 Ga0495647_0159406 3300046681 Bacteria 971
172 Ga0495624_0000924 3300046690 Bacteria 23146
173 Ga0495581_0083757 3300047315 Bacteria 1847
174 Ga0495604_0023673 3300047317 Bacteria 4901
175 Ga0495674_0307319 3300047319 Bacteria 1294
176 Ga0495672_0047537 3300047320 Bacteria 2550
177 Ga0495676_0070529 3300047321 Bacteria 2691
178 Ga0495687_045701 3300047443 Bacteria 1894
179 Ga0495675_0029682 3300047444 Bacteria 3488
180 Ga0495626_0020516 3300048091 Bacteria 3291
181 Ga0496102_0044960 3300048905 Bacteria 4008
182 Ga0496102_0126706 3300048905 Bacteria 2387
183 Ga0496105_0352722 3300048908 Unclassified 1175
184 Ga0496110_0015272 3300048913 Bacteria 6387
185 Ga0496111_0308094 3300048914 Bacteria 1174
186 Ga0496114_0046250 3300048917 Bacteria 3617
187 Ga0496125_0133516 3300048928 Bacteria 1742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0362056 Ga0395905_0362056_418_1161 198
2 3300046542 Ga0495597_0023332 Ga0495597_0023332_1619_2374 206
3 3300046500 Ga0495596_0000200 Ga0495596_0000200_26950_27723 207
4 3300046522 Ga0495643_0016816 Ga0495643_0016816_2129_2902 207
5 3300047320 Ga0495672_0047537 Ga0495672_0047537_901_1674 207
6 3300048091 Ga0495626_0020516 Ga0495626_0020516_33_806 207
7 3300032002 Ga0307416_100326471 Ga0307416_1003264712 210
8 3300046616 Ga0495668_0070754 Ga0495668_0070754_860_1615 212
9 3300042439 Ga0439464_0008942 Ga0439464_0008942_17_808 215
10 3300045051 Ga0451576_0340738 Ga0451576_0340738_767_1528 215
11 3300026121 Ga0207683_10203092 Ga0207683_102030922 216
12 3300009036 Ga0105244_10001646 Ga0105244_1000164617 219
13 3300025728 Ga0207655_1024603 Ga0207655_10246032 219
14 3300005563 Ga0068855_100070050 Ga0068855_1000700504 220
15 3300025949 Ga0207667_10010390 Ga0207667_100103907 220
16 3300005841 Ga0068863_100755420 Ga0068863_1007554202 223
17 3300009101 Ga0105247_10247948 Ga0105247_102479482 223
18 3300026088 Ga0207641_10219918 Ga0207641_102199182 223
19 3300003322 rootL2_10302418 rootL2_103024181 224
20 3300003323 rootH1_10162486 rootH1_101624861 224
21 3300003775 Ga0055524_1000013 Ga0055524_100001330 224
22 3300003791 Ga0055530_10002224 Ga0055530_100022244 224
23 3300003792 Ga0055540_1000119 Ga0055540_100011970 224
24 3300003794 Ga0055531_10009974 Ga0055531_100099744 224
25 3300005295 Ga0065707_10181441 Ga0065707_101814411 224
26 3300005328 Ga0070676_10209736 Ga0070676_102097362 224
27 3300005333 Ga0070677_10064895 Ga0070677_100648952 224
28 3300005334 Ga0068869_100136812 Ga0068869_1001368122 224
29 3300005343 Ga0070687_100190279 Ga0070687_1001902792 224
30 3300005344 Ga0070661_100002454 Ga0070661_1000024545 224
31 3300005353 Ga0070669_100002697 Ga0070669_1000026979 224
32 3300005354 Ga0070675_100068262 Ga0070675_1000682621 224
33 3300005354 Ga0070675_100783823 Ga0070675_1007838231 224
34 3300005356 Ga0070674_100051247 Ga0070674_1000512473 224
35 3300005364 Ga0070673_100004348 Ga0070673_1000043482 224
36 3300005364 Ga0070673_100106053 Ga0070673_1001060532 224
37 3300005366 Ga0070659_100003845 Ga0070659_1000038457 224
38 3300005441 Ga0070700_100019483 Ga0070700_1000194835 224
39 3300005456 Ga0070678_100093195 Ga0070678_1000931952 224
40 3300005456 Ga0070678_100308315 Ga0070678_1003083152 224
41 3300005457 Ga0070662_100179752 Ga0070662_1001797522 224
42 3300005459 Ga0068867_100083014 Ga0068867_1000830143 224
43 3300005518 Ga0070699_100644454 Ga0070699_1006444541 224
44 3300005543 Ga0070672_100012261 Ga0070672_1000122613 224
45 3300005543 Ga0070672_100104813 Ga0070672_1001048133 224
46 3300005564 Ga0070664_100002177 Ga0070664_1000021775 224
47 3300005564 Ga0070664_100021009 Ga0070664_1000210094 224
48 3300005577 Ga0068857_100333578 Ga0068857_1003335781 224
49 3300005615 Ga0070702_100309554 Ga0070702_1003095542 224
50 3300005616 Ga0068852_100091087 Ga0068852_1000910873 224
51 3300005617 Ga0068859_100093233 Ga0068859_1000932334 224
52 3300005718 Ga0068866_10002199 Ga0068866_100021997 224
53 3300005719 Ga0068861_100005479 Ga0068861_1000054795 224
54 3300005719 Ga0068861_100458521 Ga0068861_1004585212 224
55 3300005841 Ga0068863_100685527 Ga0068863_1006855271 224
56 3300005842 Ga0068858_100004653 Ga0068858_1000046535 224
57 3300005843 Ga0068860_100003922 Ga0068860_1000039227 224
58 3300005843 Ga0068860_100008698 Ga0068860_1000086985 224
59 3300005844 Ga0068862_100007078 Ga0068862_1000070785 224
60 3300006237 Ga0097621_100208898 Ga0097621_1002088982 224
61 3300006237 Ga0097621_100342975 Ga0097621_1003429751 224
62 3300006358 Ga0068871_100181534 Ga0068871_1001815342 224
63 3300006844 Ga0075428_100437550 Ga0075428_1004375502 224
64 3300006881 Ga0068865_100369941 Ga0068865_1003699412 224
65 3300006931 Ga0097620_100093230 Ga0097620_1000932304 224
66 3300006946 Ga0079104_1000351 Ga0079104_100035141 224
67 3300009093 Ga0105240_10003100 Ga0105240_1000310022 224
68 3300009148 Ga0105243_10095414 Ga0105243_100954142 224
69 3300009177 Ga0105248_10238784 Ga0105248_102387841 224
70 3300009177 Ga0105248_10286820 Ga0105248_102868203 224
71 3300009545 Ga0105237_10000322 Ga0105237_1000032244 224
72 3300009551 Ga0105238_10005482 Ga0105238_100054829 224
73 3300009553 Ga0105249_10041601 Ga0105249_100416012 224
74 3300010375 Ga0105239_10000750 Ga0105239_100007502 224
75 3300012510 Ga0157316_1005557 Ga0157316_10055572 224
76 3300013297 Ga0157378_10008964 Ga0157378_100089649 224
77 3300013306 Ga0163162_10006662 Ga0163162_1000666213 224
78 3300013308 Ga0157375_10186758 Ga0157375_101867583 224
79 3300013308 Ga0157375_10233368 Ga0157375_102333682 224
80 3300014326 Ga0157380_10005593 Ga0157380_100055935 224
81 3300014326 Ga0157380_10134849 Ga0157380_101348492 224
82 3300014968 Ga0157379_10007337 Ga0157379_1000733710 224
83 3300017792 Ga0163161_10393922 Ga0163161_103939221 224
84 3300025263 Ga0209565_1010968 Ga0209565_10109682 224
85 3300025291 Ga0209675_1010264 Ga0209675_10102644 224
86 3300025298 Ga0209050_1000478 Ga0209050_10004785 224
87 3300025298 Ga0209050_1019939 Ga0209050_10199392 224
88 3300025299 Ga0209256_1000061 Ga0209256_100006131 224
89 3300025303 Ga0209051_1000063 Ga0209051_100006370 224
90 3300025304 Ga0209257_1000118 Ga0209257_1000118137 224
91 3300025893 Ga0207682_10040325 Ga0207682_100403253 224
92 3300025913 Ga0207695_10006870 Ga0207695_1000687012 224
93 3300025914 Ga0207671_10001693 Ga0207671_1000169323 224
94 3300025918 Ga0207662_10234556 Ga0207662_102345561 224
95 3300025919 Ga0207657_10558151 Ga0207657_105581512 224
96 3300025920 Ga0207649_10000261 Ga0207649_1000026131 224
97 3300025924 Ga0207694_10004751 Ga0207694_100047519 224
98 3300025926 Ga0207659_10691908 Ga0207659_106919081 224
99 3300025932 Ga0207690_10005903 Ga0207690_1000590311 224
100 3300025937 Ga0207669_10022541 Ga0207669_100225412 224
101 3300025938 Ga0207704_10117290 Ga0207704_101172901 224
102 3300025938 Ga0207704_10443727 Ga0207704_104437271 224
103 3300025940 Ga0207691_10006733 Ga0207691_100067335 224
104 3300025940 Ga0207691_10103838 Ga0207691_101038382 224
105 3300025940 Ga0207691_10212883 Ga0207691_102128832 224
106 3300025945 Ga0207679_10000205 Ga0207679_1000020523 224
107 3300025945 Ga0207679_10006019 Ga0207679_100060196 224
108 3300025945 Ga0207679_10226934 Ga0207679_102269342 224
109 3300025960 Ga0207651_10016056 Ga0207651_100160562 224
110 3300025986 Ga0207658_10059923 Ga0207658_100599233 224
111 3300026035 Ga0207703_10036925 Ga0207703_100369254 224
112 3300026035 Ga0207703_10134240 Ga0207703_101342402 224
113 3300026041 Ga0207639_10011689 Ga0207639_100116892 224
114 3300026075 Ga0207708_10029577 Ga0207708_100295775 224
115 3300026089 Ga0207648_10000310 Ga0207648_100003105 224
116 3300026089 Ga0207648_10360836 Ga0207648_103608362 224
117 3300026089 Ga0207648_10403116 Ga0207648_104031162 224
118 3300026118 Ga0207675_100002208 Ga0207675_1000022089 224
119 3300026118 Ga0207675_100262119 Ga0207675_1002621192 224
120 3300026121 Ga0207683_10082813 Ga0207683_100828132 224
121 3300026121 Ga0207683_10222213 Ga0207683_102222132 224
122 3300027111 Ga0209281_1000479 Ga0209281_100047941 224
123 3300027614 Ga0209970_1000698 Ga0209970_10006986 224
124 3300028380 Ga0268265_10021105 Ga0268265_100211057 224
125 3300028380 Ga0268265_10550774 Ga0268265_105507742 224
126 3300028381 Ga0268264_10015661 Ga0268264_100156613 224
127 3300028794 Ga0307515_10000022 Ga0307515_10000022150 224
128 3300031456 Ga0307513_10004555 Ga0307513_1000455519 224
129 3300031456 Ga0307513_10433527 Ga0307513_104335272 224
130 3300035116 Ga0373945_0027235 Ga0373945_0027235_614_1396 224
131 3300035172 Ga0373955_0163027 Ga0373955_0163027_157_918 224
132 3300035695 Ga0373927_0018715 Ga0373927_0018715_2225_3007 224
133 3300037068 Ga0373925_0001962 Ga0373925_0001962_9160_9942 224
134 3300037068 Ga0373925_0127289 Ga0373925_0127289_82_843 224
135 3300037466 Ga0395898_0188285 Ga0395898_0188285_1082_1825 224
136 3300037471 Ga0395905_0009903 Ga0395905_0009903_6655_7398 224
137 3300037471 Ga0395905_0013641 Ga0395905_0013641_6013_6768 224
138 3300037471 Ga0395905_0093872 Ga0395905_0093872_127_882 224
139 3300037471 Ga0395905_0121951 Ga0395905_0121951_1369_2121 224
140 3300037471 Ga0395905_0418930 Ga0395905_0418930_416_1174 224
141 3300041456 Ga0451795_1420489 Ga0451795_1420489_48_812 224
142 3300041997 Ga0439431_0040721 Ga0439431_0040721_166_933 224
143 3300042015 Ga0439462_0045928 Ga0439462_0045928_156_881 224
144 3300042121 Ga0450919_000810 Ga0450919_000810_2980_3735 224
145 3300042134 Ga0450898_001650 Ga0450898_001650_967_1725 224
146 3300042531 Ga0450918_000072 Ga0450918_000072_16735_17553 224
147 3300045051 Ga0451576_0228316 Ga0451576_0228316_753_1475 224
148 3300046455 Ga0495603_0068460 Ga0495603_0068460_94_837 224
149 3300046459 Ga0495629_0406390 Ga0495629_0406390_22_783 224
150 3300046463 Ga0495653_0091511 Ga0495653_0091511_43_786 224
151 3300046472 Ga0495580_0284740 Ga0495580_0284740_150_893 224
152 3300046473 Ga0495582_0035584 Ga0495582_0035584_912_1655 224
153 3300046499 Ga0495594_0148556 Ga0495594_0148556_199_930 224
154 3300046499 Ga0495594_0260160 Ga0495594_0260160_27_701 224
155 3300046516 Ga0495628_0095667 Ga0495628_0095667_163_924 224
156 3300046524 Ga0495648_0002354 Ga0495648_0002354_55_810 224
157 3300046526 Ga0495666_0109747 Ga0495666_0109747_340_1083 224
158 3300046528 Ga0495642_0005514 Ga0495642_0005514_3428_4171 224
159 3300046531 Ga0495665_0001330 Ga0495665_0001330_3025_3756 224
160 3300046542 Ga0495597_0012573 Ga0495597_0012573_3006_3749 224
161 3300046543 Ga0495645_0060437 Ga0495645_0060437_1017_1799 224
162 3300046543 Ga0495645_0198415 Ga0495645_0198415_319_1080 224
163 3300046557 Ga0495622_0002613 Ga0495622_0002613_3881_4612 224
164 3300046557 Ga0495622_0103737 Ga0495622_0103737_414_1157 224
165 3300046642 Ga0495634_0117338 Ga0495634_0117338_554_1297 224
166 3300046642 Ga0495634_0211098 Ga0495634_0211098_204_965 224
167 3300046660 Ga0495625_0012901 Ga0495625_0012901_1414_2157 224
168 3300046660 Ga0495625_0321492 Ga0495625_0321492_132_887 224
169 3300046665 Ga0495661_0025590 Ga0495661_0025590_1750_2493 224
170 3300046674 Ga0495588_0022605 Ga0495588_0022605_1779_2522 224
171 3300046674 Ga0495588_0063051 Ga0495588_0063051_737_1468 224
172 3300046679 Ga0495623_0031222 Ga0495623_0031222_2243_2986 224
173 3300046681 Ga0495647_0159406 Ga0495647_0159406_57_818 224
174 3300046690 Ga0495624_0000924 Ga0495624_0000924_11092_11835 224
175 3300047315 Ga0495581_0083757 Ga0495581_0083757_479_1222 224
176 3300047317 Ga0495604_0023673 Ga0495604_0023673_2855_3598 224
177 3300047319 Ga0495674_0307319 Ga0495674_0307319_369_1130 224
178 3300047321 Ga0495676_0070529 Ga0495676_0070529_14_757 224
179 3300047443 Ga0495687_045701 Ga0495687_045701_1012_1755 224
180 3300047444 Ga0495675_0029682 Ga0495675_0029682_948_1691 224
181 3300048905 Ga0496102_0044960 Ga0496102_0044960_849_1604 224
182 3300048905 Ga0496102_0126706 Ga0496102_0126706_1479_2228 224
183 3300048908 Ga0496105_0352722 Ga0496105_0352722_127_876 224
184 3300048913 Ga0496110_0015272 Ga0496110_0015272_1389_2138 224
185 3300048914 Ga0496111_0308094 Ga0496111_0308094_467_1147 224
186 3300048917 Ga0496114_0046250 Ga0496114_0046250_1555_2307 224
187 3300048928 Ga0496125_0133516 Ga0496125_0133516_197_964 224
188 iso_pu_bacteria 2643221644 2644248648 224
189 iso_pu_bacteria 2895511927 2895515233 224

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

34

258

0.95

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

37

250

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.8854 5 224
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8684 5 224
4kd5-assembly1.cif.gz_C substrate binding domain of putative molybdenum abc transporter from clostridium difficile 0.8636 5 224
8k8k-assembly1.cif.gz_A structure of klebsiella pneumonia moda 0.8566 5 224
6nio-assembly1.cif.gz_A crystal structure of the molybdate transporter periplasmic protein moda from yersinia pestis 0.8502 5 224
ID Description Score Start End Superfamily
af_P9WGU3_42_110_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9726 7 68 3.40.190.10
4kd5C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9624 7 224 3.40.190.10
af_P37329_30_103_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9529 7 65 3.40.190.10
4kd5D02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9446 78 179 3.40.190.10
1atgA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9355 7 224 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A1Z4UA78-F1-model_v4 deleted 0.9447 67 223
AF-A0A3M8RW09-F1-model_v4 Molybdate ABC transporter substrate-binding protein 0.9421 47 224 GO:0015689
GO:0030973
AF-A0A1D9FQY4-F1-model_v4 deleted 0.9413 6 224
AF-A0A0E3QDE5-F1-model_v4 Molybdenum ABC transporter, periplasmic molybdenum-binding protein ModA 0.9409 58 224 GO:0015689
GO:0030973
AF-A0A015NMI3-F1-model_v4 deleted 0.9357 84 224

Feature Viewer

pLDDT pTM Quality
93.45 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map