F291008

General Info

Members Datasets Scaffolds Average Seq Length
189 83 378 193

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10015429|Ga0213874_100154291
Length 232
Sequence VACGASIAALARGGRASGALIAALVGTKDEQNAPGPVRVYRFVCMRVLVLDNYDSFTYNLVQYLGELGADVEVVRNDHATVNELLVRGYDRVIVSPGPCTPNEAGISLEAVRRFPEAKVPTLGVCLGHQALVQAWGGRVVQHEPVHGKTTTIDHDEKTIFRGLRRPLEVGRYHSLVVDPALPDCLETSARGGEVVMAVRHRELPAEGVQFHPESVLTEQGRELLANFLARTR

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
8 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
9 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
10 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
13 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
14 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
18 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
20 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
21 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
22 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
23 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
26 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
34 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
35 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
36 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
37 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
38 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
39 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
44 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
45 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
46 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
47 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
50 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
51 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
52 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
53 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
54 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
55 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
56 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
57 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
62 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
63 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
64 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
65 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
66 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
67 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
68 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
69 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
70 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
71 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
72 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
73 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
74 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
75 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
76 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
77 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
78 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
79 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
80 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
81 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
82 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
83 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 5.29
Rhizosphere 64.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10015429 3300021377 Bacteria 2015
2 JGI25406J46586_10048951 3300003203 Bacteria 1429
3 Ga0070668_100214051 3300005347 Bacteria 1586
4 Ga0070668_100422302 3300005347 Bacteria 1142
5 Ga0070675_100307496 3300005354 Bacteria 1398
6 Ga0070714_100010420 3300005435 Bacteria 7347
7 Ga0070714_100011293 3300005435 Bacteria 7080
8 Ga0070714_100154607 3300005435 Bacteria 2070
9 Ga0070713_100019333 3300005436 Bacteria 5197
10 Ga0070713_100762894 3300005436 Bacteria 926
11 Ga0070684_100164944 3300005535 Bacteria 2011
12 Ga0068856_100018427 3300005614 Bacteria 6767
13 Ga0068859_101186208 3300005617 Bacteria 841
14 Ga0081538_10001757 3300005981 Bacteria 21975
15 Ga0081539_10004464 3300005985 Bacteria 15425
16 Ga0070717_10009514 3300006028 Bacteria 7309
17 Ga0070717_10089179 3300006028 Bacteria 2601
18 Ga0075365_10073174 3300006038 Bacteria 2310
19 Ga0075365_10271729 3300006038 Bacteria 1192
20 Ga0075365_10716563 3300006038 Bacteria 707
21 Ga0075364_10123187 3300006051 Bacteria 1737
22 Ga0075367_10011497 3300006178 Bacteria 4688
23 Ga0075428_101529516 3300006844 Bacteria 699
24 Ga0075434_100231426 3300006871 Bacteria 1867
25 Ga0097620_101186189 3300006931 Bacteria 841
26 Ga0105247_10124796 3300009101 Bacteria 1672
27 Ga0105242_10137615 3300009176 Bacteria 2115
28 Ga0157380_10755886 3300014326 Bacteria 984
29 Ga0213873_10008419 3300021358 Bacteria 2106
30 Ga0213873_10019227 3300021358 Bacteria 1582
31 Ga0213873_10053122 3300021358 Bacteria 1078
32 Ga0213874_10209901 3300021377 Bacteria 704
33 Ga0213876_10010779 3300021384 Bacteria 4896
34 Ga0213876_10010890 3300021384 Bacteria 4872
35 Ga0213876_10012803 3300021384 Bacteria 4460
36 Ga0213876_10023189 3300021384 Bacteria 3279
37 Ga0213876_10029213 3300021384 Bacteria 2907
38 Ga0213876_10031212 3300021384 Bacteria 2812
39 Ga0213876_10032105 3300021384 Bacteria 2770
40 Ga0213876_10036148 3300021384 Bacteria 2605
41 Ga0213876_10046903 3300021384 Bacteria 2285
42 Ga0213875_10000351 3300021388 Bacteria 43186
43 Ga0213875_10017793 3300021388 Bacteria 3429
44 Ga0213875_10019182 3300021388 Bacteria 3291
45 Ga0213875_10125686 3300021388 Bacteria 1198
46 Ga0207426_1021021 3300025302 Bacteria 2260
47 Ga0207692_10202488 3300025898 Bacteria 1168
48 Ga0207663_10367607 3300025916 Bacteria 1093
49 Ga0207700_10683840 3300025928 Bacteria 915
50 Ga0207664_10014994 3300025929 Bacteria 5613
51 Ga0207664_10285337 3300025929 Bacteria 1449
52 Ga0207709_10142431 3300025935 Bacteria 1649
53 Ga0207677_10891221 3300026023 Bacteria 801
54 Ga0207641_10441818 3300026088 Bacteria 1256
55 Ga0265326_10024158 3300028558 Bacteria 1735
56 Ga0265338_10173064 3300028800 Bacteria 1653
57 Ga0265327_10078605 3300031251 Bacteria 1634
58 Ga0316576_10022792 3300031727 Bacteria 4354
59 Ga0316578_10036253 3300031728 Bacteria 2839
60 Ga0373952_0115277 3300035092 Bacteria 723
61 Ga0316574_0035494 3300035398 Bacteria 3048
62 Ga0316584_0193332 3300036712 Bacteria 1503
63 Ga0316584_0253172 3300036712 Bacteria 1286
64 Ga0395900_0014977 3300037418 Bacteria 7903
65 Ga0395898_0002434 3300037466 Bacteria 21997
66 Ga0436364_0053201 3300037853 Bacteria 1958
67 Ga0436364_0056785 3300037853 Bacteria 952
68 Ga0436364_0071360 3300037853 Bacteria 3112
69 Ga0436364_0137273 3300037853 Bacteria 1474
70 Ga0436364_0193608 3300037853 Bacteria 2147
71 Ga0436364_0453611 3300037853 Bacteria 18573
72 Ga0436364_0663830 3300037853 Bacteria 757
73 Ga0436364_0690446 3300037853 Bacteria 17320
74 Ga0436364_0814300 3300037853 Bacteria 1103
75 Ga0436364_0905168 3300037853 Bacteria 688
76 Ga0436364_0928903 3300037853 Bacteria 2674
77 Ga0436364_0964792 3300037853 Bacteria 932
78 Ga0436364_1006666 3300037853 Bacteria 7981
79 Ga0436364_1186703 3300037853 Bacteria 9290
80 Ga0436364_1426665 3300037853 Bacteria 33049
81 Ga0436365_0148921 3300039437 Bacteria 4424
82 Ga0436365_0603548 3300039437 Bacteria 6269
83 Ga0436365_0669928 3300039437 Bacteria 11910
84 Ga0436365_0783439 3300039437 Bacteria 1257
85 Ga0436365_0835841 3300039437 Bacteria 4065
86 Ga0436365_0860769 3300039437 Bacteria 2941
87 Ga0436365_0929024 3300039437 Bacteria 2486
88 Ga0436365_1128146 3300039437 Bacteria 12263
89 Ga0436365_1227877 3300039437 Bacteria 3336
90 Ga0436365_1734079 3300039437 Bacteria 9502
91 Ga0436365_1777262 3300039437 Bacteria 3143
92 Ga0436360_0637900 3300039438 Bacteria 732
93 Ga0436363_0112719 3300039450 Bacteria 893
94 Ga0436363_0319746 3300039450 Bacteria 987
95 Ga0436363_0956689 3300039450 Bacteria 918
96 Ga0436363_1071785 3300039450 Bacteria 874
97 Ga0436363_1547459 3300039450 Bacteria 979
98 Ga0436363_1589067 3300039450 Bacteria 661
99 Ga0436363_1700215 3300039450 Bacteria 797
100 Ga0436362_0163860 3300039453 Bacteria 3387
101 Ga0436362_0341449 3300039453 Bacteria 1310
102 Ga0436362_0605246 3300039453 Bacteria 1200
103 Ga0436362_0610059 3300039453 Bacteria 868
104 Ga0436362_0803078 3300039453 Bacteria 752
105 Ga0436362_1056368 3300039453 Bacteria 1673
106 Ga0466969_0021906 3300044656 Bacteria 3303
107 Ga0466969_0055708 3300044656 Bacteria 1933
108 Ga0466965_0057902 3300044683 Bacteria 1932
109 Ga0466966_0029362 3300044684 Bacteria 3578
110 Ga0466966_0216720 3300044684 Bacteria 1156
111 Ga0466961_0020583 3300044693 Bacteria 4246
112 Ga0466961_0137100 3300044693 Bacteria 1533
113 Ga0466961_0221533 3300044693 Bacteria 1166
114 Ga0466961_0371419 3300044693 Bacteria 869
115 Ga0466963_0000696 3300044694 Bacteria 16373
116 Ga0466963_0017407 3300044694 Bacteria 4480
117 Ga0466963_0018718 3300044694 Bacteria 4335
118 Ga0466963_0031052 3300044694 Bacteria 3451
119 Ga0466963_0042406 3300044694 Bacteria 2988
120 Ga0466963_0174070 3300044694 Bacteria 1501
121 Ga0466963_0238507 3300044694 Bacteria 1275
122 Ga0466964_0091985 3300044706 Bacteria 1322
123 Ga0466964_0139836 3300044706 Bacteria 1112
124 Ga0466964_0146481 3300044706 Bacteria 1090
125 Ga0466964_0164140 3300044706 Bacteria 1041
126 Ga0466971_0008324 3300044719 Bacteria 4525
127 Ga0466971_0111791 3300044719 Bacteria 1261
128 Ga0466971_0188146 3300044719 Bacteria 972
129 Ga0466971_0410305 3300044719 Bacteria 661
130 Ga0466968_0023294 3300044735 Bacteria 2521
131 Ga0466968_0308530 3300044735 Bacteria 762
132 Ga0466970_0032306 3300044765 Bacteria 2765
133 Ga0466957_0047191 3300044842 Bacteria 2617
134 Ga0466957_0129857 3300044842 Bacteria 1613
135 Ga0466957_0193503 3300044842 Bacteria 1333
136 Ga0466959_0002599 3300045049 Bacteria 11583
137 Ga0466959_0004646 3300045049 Bacteria 9237
138 Ga0466959_0036732 3300045049 Bacteria 3619
139 Ga0466959_0105654 3300045049 Bacteria 2013
140 Ga0466959_0110103 3300045049 Bacteria 1966
141 Ga0466959_0116202 3300045049 Bacteria 1905
142 Ga0466959_0142024 3300045049 Bacteria 1696
143 Ga0466959_0205165 3300045049 Bacteria 1371
144 Ga0466959_0253394 3300045049 Bacteria 1214
145 Ga0466959_0316471 3300045049 Bacteria 1067
146 Ga0466959_0475176 3300045049 Bacteria 846
147 Ga0466959_0611652 3300045049 Bacteria 733
148 Ga0466958_0000409 3300045836 Bacteria 17656
149 Ga0466958_0001371 3300045836 Bacteria 11507
150 Ga0466958_0009100 3300045836 Bacteria 5520
151 Ga0466958_0047997 3300045836 Bacteria 2579
152 Ga0466958_0049197 3300045836 Bacteria 2550
153 Ga0466958_0051567 3300045836 Bacteria 2491
154 Ga0466958_0086637 3300045836 Bacteria 1933
155 Ga0466958_0214557 3300045836 Bacteria 1227
156 Ga0466967_0011233 3300045976 Bacteria 6768
157 Ga0466967_0047897 3300045976 Bacteria 3729
158 Ga0466967_0223161 3300045976 Bacteria 1792
159 Ga0466967_0231209 3300045976 Bacteria 1761
160 Ga0466967_0283054 3300045976 Bacteria 1591
161 Ga0466967_0367963 3300045976 Bacteria 1394
162 Ga0466967_0414379 3300045976 Bacteria 1312
163 Ga0495664_0067041 3300046477 Bacteria 2141
164 Ga0495663_0210305 3300046525 Bacteria 681
165 Ga0495652_0119490 3300046529 Bacteria 2105
166 Ga0495587_0101943 3300046536 Bacteria 1653
167 Ga0495656_0013351 3300046615 Bacteria 3055
168 Ga0495672_0037818 3300047320 Bacteria 2950
169 Ga0495602_0188259 3300048088 Bacteria 1585
170 Ga0496101_0007968 3300048904 Bacteria 6903
171 Ga0496102_0007601 3300048905 Bacteria 9261
172 Ga0496103_0180438 3300048906 Bacteria 1357
173 Ga0496104_1061833 3300048907 Bacteria 714
174 Ga0496106_0001712 3300048909 Bacteria 16367
175 Ga0496107_0003028 3300048910 Bacteria 11140
176 Ga0496109_0568097 3300048912 Bacteria 1069
177 Ga0496112_0229155 3300048915 Bacteria 1812
178 Ga0496113_0239391 3300048916 Bacteria 1448
179 Ga0496115_0012668 3300048918 Bacteria 6355
180 Ga0501069_0192058 3300049585 Bacteria 1182
181 nmdc:mga00v17_51304_c1 3300050491 Bacteria 2508
182 nmdc:mga0yw44_187094_c1 3300050492 Bacteria 1365
183 nmdc:mga06z11_143076_c1 3300050494 Bacteria 1353
184 Ga0495619_0335734 3300053085 Bacteria 1046
185 Ga0466962_0034157 3300061719 Bacteria 2434
186 Ga0466962_0052758 3300061719 Bacteria 1943
187 Ga0466962_0165713 3300061719 Bacteria 1075
188 Ga0466962_0364735 3300061719 Bacteria 720
189 Ga0466962_0416820 3300061719 Bacteria 673
190 Ga0213874_10015429
191 JGI25406J46586_10048951
192 Ga0070668_100214051
193 Ga0070668_100422302
194 Ga0070675_100307496
195 Ga0070714_100010420
196 Ga0070714_100011293
197 Ga0070714_100154607
198 Ga0070713_100019333
199 Ga0070713_100762894
200 Ga0070684_100164944
201 Ga0068856_100018427
202 Ga0068859_101186208
203 Ga0081538_10001757
204 Ga0081539_10004464
205 Ga0070717_10009514
206 Ga0070717_10089179
207 Ga0075365_10073174
208 Ga0075365_10271729
209 Ga0075365_10716563
210 Ga0075364_10123187
211 Ga0075367_10011497
212 Ga0075428_101529516
213 Ga0075434_100231426
214 Ga0097620_101186189
215 Ga0105247_10124796
216 Ga0105242_10137615
217 Ga0157380_10755886
218 Ga0213873_10008419
219 Ga0213873_10019227
220 Ga0213873_10053122
221 Ga0213874_10209901
222 Ga0213876_10010779
223 Ga0213876_10010890
224 Ga0213876_10012803
225 Ga0213876_10023189
226 Ga0213876_10029213
227 Ga0213876_10031212
228 Ga0213876_10032105
229 Ga0213876_10036148
230 Ga0213876_10046903
231 Ga0213875_10000351
232 Ga0213875_10017793
233 Ga0213875_10019182
234 Ga0213875_10125686
235 Ga0207426_1021021
236 Ga0207692_10202488
237 Ga0207663_10367607
238 Ga0207700_10683840
239 Ga0207664_10014994
240 Ga0207664_10285337
241 Ga0207709_10142431
242 Ga0207677_10891221
243 Ga0207641_10441818
244 Ga0265326_10024158
245 Ga0265338_10173064
246 Ga0265327_10078605
247 Ga0316576_10022792
248 Ga0316578_10036253
249 Ga0373952_0115277
250 Ga0316574_0035494
251 Ga0316584_0193332
252 Ga0316584_0253172
253 Ga0395900_0014977
254 Ga0395898_0002434
255 Ga0436364_0053201
256 Ga0436364_0056785
257 Ga0436364_0071360
258 Ga0436364_0137273
259 Ga0436364_0193608
260 Ga0436364_0453611
261 Ga0436364_0663830
262 Ga0436364_0690446
263 Ga0436364_0814300
264 Ga0436364_0905168
265 Ga0436364_0928903
266 Ga0436364_0964792
267 Ga0436364_1006666
268 Ga0436364_1186703
269 Ga0436364_1426665
270 Ga0436365_0148921
271 Ga0436365_0603548
272 Ga0436365_0669928
273 Ga0436365_0783439
274 Ga0436365_0835841
275 Ga0436365_0860769
276 Ga0436365_0929024
277 Ga0436365_1128146
278 Ga0436365_1227877
279 Ga0436365_1734079
280 Ga0436365_1777262
281 Ga0436360_0637900
282 Ga0436363_0112719
283 Ga0436363_0319746
284 Ga0436363_0956689
285 Ga0436363_1071785
286 Ga0436363_1547459
287 Ga0436363_1589067
288 Ga0436363_1700215
289 Ga0436362_0163860
290 Ga0436362_0341449
291 Ga0436362_0605246
292 Ga0436362_0610059
293 Ga0436362_0803078
294 Ga0436362_1056368
295 Ga0466969_0021906
296 Ga0466969_0055708
297 Ga0466965_0057902
298 Ga0466966_0029362
299 Ga0466966_0216720
300 Ga0466961_0020583
301 Ga0466961_0137100
302 Ga0466961_0221533
303 Ga0466961_0371419
304 Ga0466963_0000696
305 Ga0466963_0017407
306 Ga0466963_0018718
307 Ga0466963_0031052
308 Ga0466963_0042406
309 Ga0466963_0174070
310 Ga0466963_0238507
311 Ga0466964_0091985
312 Ga0466964_0139836
313 Ga0466964_0146481
314 Ga0466964_0164140
315 Ga0466971_0008324
316 Ga0466971_0111791
317 Ga0466971_0188146
318 Ga0466971_0410305
319 Ga0466968_0023294
320 Ga0466968_0308530
321 Ga0466970_0032306
322 Ga0466957_0047191
323 Ga0466957_0129857
324 Ga0466957_0193503
325 Ga0466959_0002599
326 Ga0466959_0004646
327 Ga0466959_0036732
328 Ga0466959_0105654
329 Ga0466959_0110103
330 Ga0466959_0116202
331 Ga0466959_0142024
332 Ga0466959_0205165
333 Ga0466959_0253394
334 Ga0466959_0316471
335 Ga0466959_0475176
336 Ga0466959_0611652
337 Ga0466958_0000409
338 Ga0466958_0001371
339 Ga0466958_0009100
340 Ga0466958_0047997
341 Ga0466958_0049197
342 Ga0466958_0051567
343 Ga0466958_0086637
344 Ga0466958_0214557
345 Ga0466967_0011233
346 Ga0466967_0047897
347 Ga0466967_0223161
348 Ga0466967_0231209
349 Ga0466967_0283054
350 Ga0466967_0367963
351 Ga0466967_0414379
352 Ga0495664_0067041
353 Ga0495663_0210305
354 Ga0495652_0119490
355 Ga0495587_0101943
356 Ga0495656_0013351
357 Ga0495672_0037818
358 Ga0495602_0188259
359 Ga0496101_0007968
360 Ga0496102_0007601
361 Ga0496103_0180438
362 Ga0496104_1061833
363 Ga0496106_0001712
364 Ga0496107_0003028
365 Ga0496109_0568097
366 Ga0496112_0229155
367 Ga0496113_0239391
368 Ga0496115_0012668
369 Ga0501069_0192058
370 nmdc:mga00v17_51304_c1
371 nmdc:mga0yw44_187094_c1
372 nmdc:mga06z11_143076_c1
373 Ga0495619_0335734
374 Ga0466962_0034157
375 Ga0466962_0052758
376 Ga0466962_0165713
377 Ga0466962_0364735
378 Ga0466962_0416820

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

48

231

0.95

PF07722

Peptidase_C26

Peptidase C26

92

213

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wl8-assembly1.cif.gz_A crystal structure of ph1346 protein from pyrococcus horikoshii 0.9113 1 184
1qdl-assembly1.cif.gz_B-2 the crystal structure of anthranilate synthase from sulfolobus solfataricus 0.9092 2 185
7yc6-assembly1.cif.gz_A crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.902 3 184
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.9014 1 184
7d40-assembly2.cif.gz_B crystal structure of gatase subunit of methanocaldococcus jannaschii gmp synthetase 0.9008 3 184
ID Description Score Start End Superfamily
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9413 1 184 3.40.50.880
af_P9WN35_1_200_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9315 1 184 3.40.50.880
af_P00903_1_187_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9298 1 184 3.40.50.880
af_K7L2D7_74_267_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9283 1 184 3.40.50.880
af_Q2G099_1_189_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9266 3 184 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A533RQB3-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9709 3 166 GO:0000162
GO:0004049
GO:0005829
AF-A0A7V9DP49-F1-model_v4 Anthranilate/aminodeoxychorismate synthase component II (EC 4.1.3.27) 0.9708 2 92 GO:0000162
GO:0004049
GO:0005829
AF-A0A1S8C7S8-F1-model_v4 Aminodeoxychorismate/anthranilate synthase component II 0.9667 2 92 GO:0000162
GO:0004049
GO:0005829
AF-A0A381QXX5-F1-model_v4 Glutamine amidotransferase domain-containing protein 0.9648 3 166 GO:0000162
GO:0004049
GO:0005829
AF-A0A1D1ZU99-F1-model_v4 anthranilate synthase (EC 4.1.3.27) 0.964 2 170 GO:0000162
GO:0004049
GO:0005829
GO:0006541

Map