F290687

General Info

Members Datasets Scaffolds Average Seq Length
189 151 378 251

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100024068|Ga0068860_1000240682
Length 262
Sequence MRRRRTIMPRMITATTPIITMMIMEPAAVGAGSGMNADEAAALYRLMTWLSPAFPVGAFSYSSGIEWAVEAGDITDAASLRDWLAAMLGEGSGFCDAVFLAQAHRAASAQDEDGLREIAELAAAFVPSRERQLETSTQGRAFIEIARSAWACDGLDGMVAACGGMVYPVAVGVVSAGHAVPLEPAMHAFLHAVVSNWISAGARLVPLGQTDSQRILARLEADVAATAKRALEASLDDLGSACFRADLASLRHETQYTRLFRS

Samples

Sample ID Description Type Environment
1 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
7 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
15 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
62 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
63 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
64 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
69 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
70 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
79 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
80 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
81 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
85 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
86 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
87 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
88 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
89 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
94 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
95 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
101 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
102 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
103 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
111 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
112 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
115 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
116 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
117 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
118 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
119 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
120 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
121 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
128 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
129 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
130 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
131 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
134 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
135 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
136 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
137 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
138 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
139 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
140 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
141 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
142 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
143 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
144 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
145 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
146 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
147 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
148 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
149 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
150 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
151 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.59
Metatranscriptomes 0
Isolates 7.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.22
Nodule 3.17
Rhizoplane 4.76
Rhizosphere 58.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068860_100024068 3300005843 Bacteria 5887
2 Ga0070670_100201681 3300005331 Bacteria 1729
3 Ga0070668_100137192 3300005347 Bacteria 1968
4 Ga0070668_100430926 3300005347 Bacteria 1130
5 Ga0070714_100210025 3300005435 Bacteria 1784
6 Ga0070713_100041948 3300005436 Bacteria 3731
7 Ga0070663_100286358 3300005455 Bacteria 1315
8 Ga0070663_100481462 3300005455 Bacteria 1027
9 Ga0070678_100057511 3300005456 Bacteria 2849
10 Ga0070679_100125183 3300005530 Bacteria 2553
11 Ga0070665_100016617 3300005548 Bacteria 7374
12 Ga0070665_100064061 3300005548 Bacteria 3686
13 Ga0070665_100068528 3300005548 Bacteria 3557
14 Ga0068855_100198382 3300005563 Bacteria 2260
15 Ga0070664_100358962 3300005564 Bacteria 1327
16 Ga0068859_100180190 3300005617 Bacteria 2195
17 Ga0068861_100077887 3300005719 Bacteria 2587
18 Ga0068861_100096102 3300005719 Bacteria 2347
19 Ga0068863_100064662 3300005841 Bacteria 3460
20 Ga0068858_100233636 3300005842 Bacteria 1743
21 Ga0068862_100157836 3300005844 Bacteria 2023
22 Ga0081455_10002236 3300005937 Bacteria 23051
23 Ga0081539_10000040 3300005985 Bacteria 292753
24 Ga0070717_10016954 3300006028 Bacteria 5658
25 Ga0075365_10015150 3300006038 Bacteria 4657
26 Ga0075365_10021305 3300006038 Bacteria 4041
27 Ga0075365_10063305 3300006038 Bacteria 2476
28 Ga0075368_10070378 3300006042 Bacteria 1412
29 Ga0075363_100004635 3300006048 Bacteria 6043
30 Ga0075367_10058451 3300006178 Bacteria 2294
31 Ga0075367_10087171 3300006178 Bacteria 1896
32 Ga0075367_10092051 3300006178 Bacteria 1845
33 Ga0075369_10029623 3300006186 Bacteria 2300
34 Ga0075366_10024393 3300006195 Bacteria 3528
35 Ga0075370_10043743 3300006353 Bacteria 2531
36 Ga0075428_100125906 3300006844 Bacteria 2788
37 Ga0097620_100180189 3300006931 Bacteria 2195
38 Ga0105247_10077045 3300009101 Bacteria 2095
39 Ga0105247_10083866 3300009101 Bacteria 2013
40 Ga0114129_10144031 3300009147 Bacteria 3265
41 Ga0105241_10007332 3300009174 Bacteria 8110
42 Ga0105238_10279726 3300009551 Bacteria 1650
43 Ga0157378_10651846 3300013297 Bacteria 1069
44 Ga0157372_10587038 3300013307 Bacteria 1299
45 Ga0163163_10671126 3300014325 Bacteria 1100
46 Ga0157380_10396575 3300014326 Bacteria 1308
47 Ga0157379_10568956 3300014968 Bacteria 1056
48 Ga0209233_1011155 3300025261 Bacteria 2656
49 Ga0209758_1001109 3300025297 Bacteria 34763
50 Ga0207688_10144552 3300025901 Bacteria 1401
51 Ga0207643_10074781 3300025908 Bacteria 1954
52 Ga0207654_10006856 3300025911 Bacteria 5734
53 Ga0207671_10225840 3300025914 Bacteria 1468
54 Ga0207700_10196730 3300025928 Bacteria 1697
55 Ga0207664_10199252 3300025929 Bacteria 1727
56 Ga0207644_10365696 3300025931 Bacteria 1174
57 Ga0207689_10222175 3300025942 Bacteria 1561
58 Ga0207661_10001495 3300025944 Bacteria 15826
59 Ga0207679_10101789 3300025945 Bacteria 2248
60 Ga0207712_10273368 3300025961 Bacteria 1376
61 Ga0207668_10100994 3300025972 Bacteria 2143
62 Ga0207668_10139456 3300025972 Bacteria 1862
63 Ga0207640_10222182 3300025981 Bacteria 1447
64 Ga0207677_10408181 3300026023 Bacteria 1154
65 Ga0207639_10330861 3300026041 Bacteria 1355
66 Ga0207639_10408838 3300026041 Bacteria 1224
67 Ga0207639_10639251 3300026041 Bacteria 984
68 Ga0207678_10007033 3300026067 Bacteria 9990
69 Ga0207678_10062410 3300026067 Bacteria 3203
70 Ga0207678_10143874 3300026067 Bacteria 2035
71 Ga0207678_10177402 3300026067 Bacteria 1819
72 Ga0207678_10219387 3300026067 Bacteria 1628
73 Ga0207675_100242483 3300026118 Bacteria 1742
74 Ga0209588_1007190 3300027671 Bacteria 3266
75 Ga0268266_10001364 3300028379 Bacteria 29475
76 Ga0268266_10003076 3300028379 Bacteria 17052
77 Ga0268266_10165416 3300028379 Bacteria 2003
78 Ga0268266_10398163 3300028379 Bacteria 1301
79 Ga0268265_10215438 3300028380 Bacteria 1676
80 Ga0265339_10051191 3300031249 Bacteria 2255
81 Ga0307509_10039527 3300031507 Bacteria 5139
82 Ga0307516_10028796 3300031730 Bacteria 5618
83 Ga0307516_10063872 3300031730 Bacteria 3563
84 Ga0307516_10277970 3300031730 Bacteria 1357
85 Ga0307415_100371408 3300032126 Bacteria 1211
86 Ga0307510_10032352 3300033180 Bacteria 5893
87 Ga0373927_0059235 3300035695 Bacteria 2477
88 Ga0395898_0074982 3300037466 Bacteria 3268
89 Ga0395901_0216557 3300038443 Bacteria 2003
90 Ga0436360_0044805 3300039438 Bacteria 1518
91 Ga0436360_1271027 3300039438 Bacteria 1224
92 Ga0451807_1997479 3300041486 Bacteria 953
93 Ga0466967_0146848 3300045976 Bacteria 2200
94 Ga0495603_0118226 3300046455 Bacteria 1545
95 Ga0495629_0130698 3300046459 Bacteria 1749
96 Ga0495629_0178347 3300046459 Bacteria 1473
97 Ga0495638_0096143 3300046460 Bacteria 1778
98 Ga0495650_0028431 3300046471 Bacteria 2567
99 Ga0495580_0021312 3300046472 Bacteria 4782
100 Ga0495664_0042543 3300046477 Bacteria 2691
101 Ga0495585_0071012 3300046492 Bacteria 1898
102 Ga0495594_0138689 3300046499 Bacteria 1379
103 Ga0495596_0115314 3300046500 Bacteria 1043
104 Ga0495610_0076603 3300046512 Bacteria 1547
105 Ga0495616_0072912 3300046513 Bacteria 1657
106 Ga0495616_0082685 3300046513 Bacteria 1533
107 Ga0495630_0011446 3300046517 Bacteria 6425
108 Ga0495652_0184378 3300046529 Bacteria 1598
109 Ga0495640_0038790 3300046533 Bacteria 3349
110 Ga0495609_0024123 3300046538 Bacteria 2792
111 Ga0495622_0098400 3300046557 Bacteria 1341
112 Ga0495656_0133920 3300046615 Bacteria 1182
113 Ga0495668_0083863 3300046616 Bacteria 1748
114 Ga0495668_0188844 3300046616 Bacteria 1128
115 Ga0495611_0043276 3300046648 Bacteria 2013
116 Ga0495625_0037854 3300046660 Bacteria 3534
117 Ga0495588_0116957 3300046674 Bacteria 1405
118 Ga0495657_0047206 3300046675 Bacteria 2912
119 Ga0495669_0131598 3300046684 Bacteria 1177
120 Ga0495613_0123616 3300046689 Bacteria 1857
121 Ga0495624_0072978 3300046690 Bacteria 2134
122 Ga0495600_0148702 3300046809 Bacteria 1517
123 Ga0495581_0054653 3300047315 Bacteria 2305
124 Ga0495604_0012457 3300047317 Bacteria 6763
125 Ga0495604_0201583 3300047317 Bacteria 1380
126 Ga0495676_0405748 3300047321 Bacteria 904
127 Ga0495683_0115985 3300047323 Bacteria 1275
128 Ga0495686_0123292 3300047472 Bacteria 1542
129 Ga0495593_0008069 3300047673 Bacteria 6123
130 Ga0495615_0086332 3300048090 Bacteria 868
131 Ga0496102_0352655 3300048905 Bacteria 1385
132 Ga0496104_0091463 3300048907 Bacteria 2908
133 Ga0496105_0006270 3300048908 Bacteria 9135
134 Ga0496106_0100481 3300048909 Bacteria 2243
135 Ga0496109_0298501 3300048912 Bacteria 1519
136 Ga0496112_0031224 3300048915 Bacteria 5165
137 Ga0496112_0351434 3300048915 Bacteria 1416
138 Ga0496117_0189548 3300048920 Bacteria 1173
139 Ga0496119_0008221 3300048922 Bacteria 9225
140 Ga0496121_0092529 3300048924 Bacteria 2357
141 Ga0496121_0098974 3300048924 Bacteria 2255
142 Ga0496121_0118368 3300048924 Bacteria 2005
143 Ga0496126_0003471 3300048929 Bacteria 19894
144 Ga0496126_0033339 3300048929 Bacteria 4845
145 Ga0496126_0104628 3300048929 Bacteria 2472
146 Ga0496126_0111855 3300048929 Bacteria 2378
147 nmdc:mga03683_39459_c1 3300050489 Bacteria 1933
148 nmdc:mga03n38_12825_c1 3300050490 Bacteria 3166
149 nmdc:mga00v17_14464_c1 3300050491 Bacteria 4404
150 nmdc:mga0yw44_3472_c1 3300050492 Bacteria 7003
151 nmdc:mga0yw44_85297_c1 3300050492 Bacteria 1987
152 nmdc:mga0k408_48999_c1 3300050493 Bacteria 2445
153 nmdc:mga06z11_54521_c1 3300050494 Bacteria 2061
154 nmdc:mga06z11_6340_c1 3300050494 Bacteria 4803
155 nmdc:mga04h51_62981_c1 3300050495 Bacteria 1276
156 nmdc:mga04h51_94230_c1 3300050495 Bacteria 1082
157 nmdc:mga07m45_167353_c1 3300050496 Bacteria 1277
158 nmdc:mga07m45_77580_c1 3300050496 Bacteria 1895
159 Ga0500643_021688 3300053087 Bacteria 2080
160 Ga0500583_0044872 3300053092 Bacteria 2026
161 Ga0500651_0129190 3300053093 Bacteria 1529
162 Ga0500566_0000336 3300053094 Bacteria 25656
163 Ga0500566_0006187 3300053094 Bacteria 7116
164 Ga0500641_0023900 3300053096 Bacteria 2354
165 Ga0500594_0007043 3300053118 Bacteria 2538
166 Ga0500618_004620 3300053125 Bacteria 4345
167 Ga0500642_0000005 3300053130 Bacteria 422725
168 Ga0500577_0011427 3300053142 Bacteria 2648
169 Ga0500604_0029103 3300053151 Bacteria 1608
170 Ga0500616_0000038 3300053153 Bacteria 386801
171 Ga0500638_003067 3300053162 Bacteria 6077
172 Ga0500636_0171682 3300053177 Bacteria 1172
173 Ga0500637_0002325 3300053178 Bacteria 8416
174 Ga0500645_018080 3300053730 Bacteria 2203
175 Ga0500661_001526 3300055283 Bacteria 4352
176 2513700184 2513237102 Bacteria 7703324
177 2517889676 2517572143 Bacteria 9484767
178 2671119528 2667528175 Bacteria 7532676
179 2723842328 2721755755 Bacteria 8322773
180 2824630972 2824626560 Bacteria 8813858
181 2824648309 2824644064 Bacteria 8743947
182 2824719489 2824714736 Bacteria 8717648
183 2874610081 2874604998 Bacteria 7834745
184 2876811507 2876808645 Bacteria 8824342
185 2879116944 2879110137 Bacteria 8907982
186 2885412960 2885409591 Bacteria 9235467
187 8006929764 8006926726 Bacteria 6749210
188 8006993077 8006984368 Bacteria 9651211
189 8006996929 8006994254 Bacteria 8309700
190 Ga0068860_100024068
191 Ga0070670_100201681
192 Ga0070668_100137192
193 Ga0070668_100430926
194 Ga0070714_100210025
195 Ga0070713_100041948
196 Ga0070663_100286358
197 Ga0070663_100481462
198 Ga0070678_100057511
199 Ga0070679_100125183
200 Ga0070665_100016617
201 Ga0070665_100064061
202 Ga0070665_100068528
203 Ga0068855_100198382
204 Ga0070664_100358962
205 Ga0068859_100180190
206 Ga0068861_100077887
207 Ga0068861_100096102
208 Ga0068863_100064662
209 Ga0068858_100233636
210 Ga0068862_100157836
211 Ga0081455_10002236
212 Ga0081539_10000040
213 Ga0070717_10016954
214 Ga0075365_10015150
215 Ga0075365_10021305
216 Ga0075365_10063305
217 Ga0075368_10070378
218 Ga0075363_100004635
219 Ga0075367_10058451
220 Ga0075367_10087171
221 Ga0075367_10092051
222 Ga0075369_10029623
223 Ga0075366_10024393
224 Ga0075370_10043743
225 Ga0075428_100125906
226 Ga0097620_100180189
227 Ga0105247_10077045
228 Ga0105247_10083866
229 Ga0114129_10144031
230 Ga0105241_10007332
231 Ga0105238_10279726
232 Ga0157378_10651846
233 Ga0157372_10587038
234 Ga0163163_10671126
235 Ga0157380_10396575
236 Ga0157379_10568956
237 Ga0209233_1011155
238 Ga0209758_1001109
239 Ga0207688_10144552
240 Ga0207643_10074781
241 Ga0207654_10006856
242 Ga0207671_10225840
243 Ga0207700_10196730
244 Ga0207664_10199252
245 Ga0207644_10365696
246 Ga0207689_10222175
247 Ga0207661_10001495
248 Ga0207679_10101789
249 Ga0207712_10273368
250 Ga0207668_10100994
251 Ga0207668_10139456
252 Ga0207640_10222182
253 Ga0207677_10408181
254 Ga0207639_10330861
255 Ga0207639_10408838
256 Ga0207639_10639251
257 Ga0207678_10007033
258 Ga0207678_10062410
259 Ga0207678_10143874
260 Ga0207678_10177402
261 Ga0207678_10219387
262 Ga0207675_100242483
263 Ga0209588_1007190
264 Ga0268266_10001364
265 Ga0268266_10003076
266 Ga0268266_10165416
267 Ga0268266_10398163
268 Ga0268265_10215438
269 Ga0265339_10051191
270 Ga0307509_10039527
271 Ga0307516_10028796
272 Ga0307516_10063872
273 Ga0307516_10277970
274 Ga0307415_100371408
275 Ga0307510_10032352
276 Ga0373927_0059235
277 Ga0395898_0074982
278 Ga0395901_0216557
279 Ga0436360_0044805
280 Ga0436360_1271027
281 Ga0451807_1997479
282 Ga0466967_0146848
283 Ga0495603_0118226
284 Ga0495629_0130698
285 Ga0495629_0178347
286 Ga0495638_0096143
287 Ga0495650_0028431
288 Ga0495580_0021312
289 Ga0495664_0042543
290 Ga0495585_0071012
291 Ga0495594_0138689
292 Ga0495596_0115314
293 Ga0495610_0076603
294 Ga0495616_0072912
295 Ga0495616_0082685
296 Ga0495630_0011446
297 Ga0495652_0184378
298 Ga0495640_0038790
299 Ga0495609_0024123
300 Ga0495622_0098400
301 Ga0495656_0133920
302 Ga0495668_0083863
303 Ga0495668_0188844
304 Ga0495611_0043276
305 Ga0495625_0037854
306 Ga0495588_0116957
307 Ga0495657_0047206
308 Ga0495669_0131598
309 Ga0495613_0123616
310 Ga0495624_0072978
311 Ga0495600_0148702
312 Ga0495581_0054653
313 Ga0495604_0012457
314 Ga0495604_0201583
315 Ga0495676_0405748
316 Ga0495683_0115985
317 Ga0495686_0123292
318 Ga0495593_0008069
319 Ga0495615_0086332
320 Ga0496102_0352655
321 Ga0496104_0091463
322 Ga0496105_0006270
323 Ga0496106_0100481
324 Ga0496109_0298501
325 Ga0496112_0031224
326 Ga0496112_0351434
327 Ga0496117_0189548
328 Ga0496119_0008221
329 Ga0496121_0092529
330 Ga0496121_0098974
331 Ga0496121_0118368
332 Ga0496126_0003471
333 Ga0496126_0033339
334 Ga0496126_0104628
335 Ga0496126_0111855
336 nmdc:mga03683_39459_c1
337 nmdc:mga03n38_12825_c1
338 nmdc:mga00v17_14464_c1
339 nmdc:mga0yw44_3472_c1
340 nmdc:mga0yw44_85297_c1
341 nmdc:mga0k408_48999_c1
342 nmdc:mga06z11_54521_c1
343 nmdc:mga06z11_6340_c1
344 nmdc:mga04h51_62981_c1
345 nmdc:mga04h51_94230_c1
346 nmdc:mga07m45_167353_c1
347 nmdc:mga07m45_77580_c1
348 Ga0500643_021688
349 Ga0500583_0044872
350 Ga0500651_0129190
351 Ga0500566_0000336
352 Ga0500566_0006187
353 Ga0500641_0023900
354 Ga0500594_0007043
355 Ga0500618_004620
356 Ga0500642_0000005
357 Ga0500577_0011427
358 Ga0500604_0029103
359 Ga0500616_0000038
360 Ga0500638_003067
361 Ga0500636_0171682
362 Ga0500637_0002325
363 Ga0500645_018080
364 Ga0500661_001526
365 2513700184
366 2517889676
367 2671119528
368 2723842328
369 2824630972
370 2824648309
371 2824719489
372 2874610081
373 2876811507
374 2879116944
375 2885412960
376 8006929764
377 8006993077
378 8006996929

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01730

UreF

UreF

74

220

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o1q-assembly2.cif.gz_B native crystal structure of helicobacter pylori urease accessory protein uref 0.8933 52 228
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.8656 26 229
3cxn-assembly2.cif.gz_C structure of the urease accessory protein uref from helicobacter pylori 0.8653 28 228
3o1q-assembly1.cif.gz_A native crystal structure of helicobacter pylori urease accessory protein uref 0.8578 24 228
6jc4-assembly2.cif.gz_C crystal structure of the urease accessory protein uref from klebsiella pneumoniae 0.8578 26 229
ID Description Score Start End Superfamily
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8657 29 229 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8598 28 228 1.10.4190.10
af_Q2G2K7_3_207_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8475 29 229 1.10.4190.10
3cxnC00 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.8192 28 228 1.10.4190.10
af_P9WFE5_1_189_1.10.4190.10 Mainly Alpha;Orthogonal Bundle;Urease accessory protein UreF;Urease accessory protein UreF 0.7876 31 223 1.10.4190.10
ID Description Score Start End GO Terms
AF-A0A381XV29-F1-model_v4 Uncharacterized protein 0.9096 47 177 GO:0016151
AF-B3TCF4-F1-model_v4 Putative UreF 0.8907 55 229 GO:0016020
GO:0016151
AF-A0A0K1W3W6-F1-model_v4 UreF (EC 3.5.1.5) 0.8895 51 207 GO:0009039
GO:0016151
AF-A0A6P0NHM2-F1-model_v4 Urease accessory protein UreF 0.885 28 228 GO:0016151
AF-A0A4Q6F4A4-F1-model_v4 deleted 0.8848 32 224

Map