F290528

General Info

Members Datasets Scaffolds Average Seq Length
189 120 378 177

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100290717|Ga0070700_1002907173
Length 203
Sequence LIAARGPRFSRYNDGFPPGWRAALREMLLDLNKRHGQREHFERTFPPSAFEPQDSEYRVAAPVELVLDVTRLGDNAFGLAGRARTRLQVDCSRCLEPFDVPVEAAFDLRYVPQSENAGEGEIEVGEDDLATAFYREGLVDLIELLREQFVLALPMKPLCEEACKGLCPECGSNLNKTQCDCAPRWEDPRLASLKSLLSKNKEN

Samples

Sample ID Description Type Environment
1 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
32 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
33 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
73 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
74 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
75 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
80 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
81 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
82 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
83 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
84 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
85 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
86 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
87 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
88 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
89 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
90 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
91 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
92 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
100 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
101 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
105 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
108 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
109 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
110 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
111 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
112 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
113 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
116 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
117 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
118 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
119 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
120 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.7
Rhizosphere 96.3
Stem 0
Stem Tuber 0
Unclassified 21.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070700_100290717 3300005441 Unclassified 1189
2 Ga0065712_10069483 3300005290 Bacteria 7199
3 Ga0065712_10075516 3300005290 Bacteria 3845
4 Ga0065715_10112439 3300005293 Bacteria 2530
5 Ga0070658_10544929 3300005327 Unclassified 1004
6 Ga0070683_100003892 3300005329 Bacteria 12211
7 Ga0070670_100019160 3300005331 Bacteria 5868
8 Ga0070670_100030395 3300005331 Bacteria 4651
9 Ga0070691_10512913 3300005341 Unclassified 695
10 Ga0070661_100024105 3300005344 Bacteria 4365
11 Ga0070675_100639558 3300005354 Unclassified 966
12 Ga0070671_100647357 3300005355 Bacteria 915
13 Ga0070673_100467017 3300005364 Unclassified 1137
14 Ga0070688_100100423 3300005365 Unclassified 1907
15 Ga0070667_100252748 3300005367 Bacteria 1576
16 Ga0070705_100942949 3300005440 Bacteria 697
17 Ga0070694_100001620 3300005444 Bacteria 13227
18 Ga0070663_100042711 3300005455 Bacteria 3187
19 Ga0070662_100536625 3300005457 Unclassified 979
20 Ga0070707_100081156 3300005468 Bacteria 3131
21 Ga0070698_100002831 3300005471 Bacteria 19089
22 Ga0070699_100029315 3300005518 Bacteria 4745
23 Ga0070684_100003202 3300005535 Bacteria 12240
24 Ga0070672_100053952 3300005543 Unclassified 3145
25 Ga0070665_100414330 3300005548 Bacteria 1356
26 Ga0070704_100012327 3300005549 Bacteria 5278
27 Ga0070704_100281244 3300005549 Bacteria 1379
28 Ga0070664_100004690 3300005564 Bacteria 10963
29 Ga0068857_100079771 3300005577 Bacteria 2922
30 Ga0070702_100275908 3300005615 Unclassified 1152
31 Ga0068864_100071455 3300005618 Bacteria 3022
32 Ga0068858_100110563 3300005842 Bacteria 2566
33 Ga0068862_100196562 3300005844 Bacteria 1817
34 Ga0068862_100445125 3300005844 Bacteria 1220
35 Ga0075428_100020244 3300006844 Bacteria 7369
36 Ga0075428_100029378 3300006844 Bacteria 6082
37 Ga0075428_100110587 3300006844 Bacteria 2993
38 Ga0075430_100001828 3300006846 Bacteria 17416
39 Ga0075430_100003211 3300006846 Bacteria 13690
40 Ga0075430_100009486 3300006846 Bacteria 8226
41 Ga0075431_100005190 3300006847 Bacteria 12828
42 Ga0075431_100082544 3300006847 Bacteria 3318
43 Ga0075431_100130676 3300006847 Bacteria 2590
44 Ga0075431_100299594 3300006847 Unclassified 1624
45 Ga0075433_10136270 3300006852 Bacteria 2182
46 Ga0075433_10153898 3300006852 Bacteria 2045
47 Ga0075433_11324490 3300006852 Bacteria 624
48 Ga0075434_100128045 3300006871 Bacteria 2556
49 Ga0075429_100026441 3300006880 Bacteria 5038
50 Ga0075429_100044364 3300006880 Bacteria 3869
51 Ga0075429_100202885 3300006880 Bacteria 1737
52 Ga0075435_100591642 3300007076 Bacteria 962
53 Ga0111539_10003731 3300009094 Bacteria 20043
54 Ga0111539_10093764 3300009094 Bacteria 3527
55 Ga0111539_10120716 3300009094 Bacteria 3071
56 Ga0111539_10220178 3300009094 Bacteria 2211
57 Ga0111539_10795437 3300009094 Unclassified 1101
58 Ga0111539_11023649 3300009094 Bacteria 960
59 Ga0111539_11390274 3300009094 Bacteria 814
60 Ga0114129_10000086 3300009147 Bacteria 86772
61 Ga0114129_10002028 3300009147 Bacteria 27757
62 Ga0114129_10053055 3300009147 Bacteria 5687
63 Ga0114129_10071391 3300009147 Bacteria 4841
64 Ga0114129_10090250 3300009147 Bacteria 4248
65 Ga0114129_10187988 3300009147 Bacteria 2806
66 Ga0114129_10424193 3300009147 Bacteria 1749
67 Ga0105243_10412942 3300009148 Bacteria 1257
68 Ga0105248_10099224 3300009177 Bacteria 3281
69 Ga0105249_11972944 3300009553 Bacteria 656
70 Ga0157375_10293452 3300013308 Bacteria 1789
71 Ga0207697_10194117 3300025315 Bacteria 892
72 Ga0207649_10415461 3300025920 Unclassified 1009
73 Ga0207681_10823447 3300025923 Unclassified 776
74 Ga0207650_10005304 3300025925 Bacteria 8795
75 Ga0207650_10093366 3300025925 Bacteria 2303
76 Ga0207659_10501259 3300025926 Unclassified 1028
77 Ga0207644_10076045 3300025931 Bacteria 2469
78 Ga0207661_10003180 3300025944 Bacteria 11387
79 Ga0207679_10001534 3300025945 Bacteria 14424
80 Ga0207651_10059805 3300025960 Bacteria 2642
81 Ga0207658_10047785 3300025986 Bacteria 3134
82 Ga0207678_10062103 3300026067 Bacteria 3213
83 Ga0207674_10025967 3300026116 Bacteria 6234
84 Ga0207683_11231525 3300026121 Unclassified 693
85 Ga0207428_10001565 3300027907 Bacteria 23885
86 Ga0268266_10379412 3300028379 Bacteria 1333
87 Ga0268265_10320690 3300028380 Unclassified 1403
88 Ga0307408_100017482 3300031548 Bacteria 4799
89 Ga0307408_100053258 3300031548 Bacteria 2921
90 Ga0307408_100280428 3300031548 Bacteria 1388
91 Ga0307408_100288000 3300031548 Unclassified 1370
92 Ga0307405_10263237 3300031731 Unclassified 1289
93 Ga0307405_10667221 3300031731 Unclassified 857
94 Ga0307413_10019807 3300031824 Bacteria 3564
95 Ga0307410_10566489 3300031852 Bacteria 943
96 Ga0307406_10054191 3300031901 Bacteria 2559
97 Ga0307406_10088381 3300031901 Bacteria 2079
98 Ga0307407_10207469 3300031903 Unclassified 1317
99 Ga0307412_10032803 3300031911 Bacteria 3295
100 Ga0307412_10207371 3300031911 Bacteria 1493
101 Ga0307412_10502190 3300031911 Unclassified 1010
102 Ga0307409_100194226 3300031995 Unclassified 1810
103 Ga0307409_101929994 3300031995 Unclassified 620
104 Ga0307416_100003885 3300032002 Bacteria 8894
105 Ga0307416_100054490 3300032002 Bacteria 3215
106 Ga0307416_100072941 3300032002 Bacteria 2860
107 Ga0307414_10106722 3300032004 Bacteria 2121
108 Ga0307414_10596497 3300032004 Bacteria 990
109 Ga0307411_10809647 3300032005 Bacteria 825
110 Ga0307411_11119779 3300032005 Unclassified 710
111 Ga0307415_100227925 3300032126 Bacteria 1498
112 Ga0373948_0045639 3300034817 Bacteria 929
113 Ga0439453_0091656 3300041408 Unclassified 668
114 Ga0439435_0008995 3300042436 Unclassified 2332
115 Ga0451577_0904829 3300042876 Unclassified 794
116 Ga0466967_0862582 3300045976 Bacteria 900
117 Ga0466967_1918186 3300045976 Unclassified 589
118 Ga0495603_0009550 3300046455 Bacteria 5861
119 Ga0495639_0106803 3300046475 Bacteria 1326
120 Ga0495584_0270076 3300046491 Bacteria 864
121 Ga0495637_0108048 3300046520 Bacteria 1081
122 Ga0495609_0096713 3300046538 Unclassified 1281
123 Ga0495669_0022154 3300046684 Bacteria 2760
124 Ga0496102_0586888 3300048905 Bacteria 1037
125 Ga0496104_0022186 3300048907 Bacteria 5832
126 Ga0496108_0001909 3300048911 Bacteria 16668
127 Ga0496109_0005670 3300048912 Bacteria 10446
128 Ga0496110_0000624 3300048913 Bacteria 24227
129 Ga0496112_0001309 3300048915 Bacteria 18920
130 Ga0496113_0356097 3300048916 Bacteria 1174
131 Ga0501292_027231 3300049515 Bacteria 947
132 Ga0501299_005637 3300049522 Bacteria 1933
133 Ga0501299_056847 3300049522 Bacteria 820
134 Ga0501032_0552891 3300049569 Bacteria 734
135 Ga0501036_0443000 3300049572 Bacteria 1082
136 Ga0501036_0947773 3300049572 Bacteria 705
137 Ga0501039_0697111 3300049575 Unclassified 794
138 Ga0501040_0193768 3300049576 Bacteria 1443
139 Ga0501042_0510027 3300049578 Bacteria 873
140 Ga0501046_0393809 3300049580 Bacteria 1001
141 Ga0501048_0192377 3300049582 Bacteria 1446
142 Ga0501048_0608194 3300049582 Unclassified 785
143 Ga0501070_0395653 3300049586 Bacteria 1118
144 Ga0501071_0075533 3300049587 Bacteria 2460
145 Ga0501071_0689187 3300049587 Bacteria 787
146 Ga0501072_0222736 3300049588 Bacteria 1503
147 Ga0501075_0694285 3300049591 Bacteria 775
148 Ga0501075_0776300 3300049591 Unclassified 729
149 Ga0501076_0163822 3300049592 Bacteria 1812
150 Ga0501076_0187994 3300049592 Bacteria 1685
151 Ga0501076_0753497 3300049592 Bacteria 804
152 Ga0501211_029112 3300049658 Unclassified 614
153 Ga0501216_020907 3300049660 Bacteria 1147
154 Ga0501080_0463777 3300049742 Unclassified 1135
155 Ga0501272_035057 3300049769 Unclassified 651
156 Ga0501045_0143473 3300049824 Bacteria 1776
157 Ga0501045_0386244 3300049824 Bacteria 1042
158 Ga0501045_0802686 3300049824 Bacteria 693
159 nmdc:mga05p37_284073_c1 3300050507 Bacteria 1972
160 nmdc:mga05p37_295506_c1 3300050507 Bacteria 1927
161 nmdc:mga05p37_359402_c1 3300050507 Unclassified 1712
162 nmdc:mga05p37_59475_c1 3300050507 Bacteria 4706
163 nmdc:mga05p37_91208_c1 3300050507 Bacteria 3755
164 nmdc:mga05p37_961_c1 3300050507 Bacteria 32612
165 nmdc:mga09592_2031_c1 3300050508 Bacteria 16324
166 nmdc:mga09592_334586_c1 3300050508 Bacteria 1311
167 nmdc:mga09592_368298_c1 3300050508 Bacteria 1243
168 nmdc:mga0qj67_14776_c1 3300050509 Bacteria 5903
169 nmdc:mga0qj67_23234_c1 3300050509 Bacteria 4768
170 nmdc:mga0qj67_45106_c1 3300050509 Bacteria 3478
171 nmdc:mga0qj67_497381_c1 3300050509 Unclassified 980
172 nmdc:mga0qj67_838162_c1 3300050509 Unclassified 727
173 nmdc:mga06r32_1207345_c1 3300050510 Unclassified 702
174 nmdc:mga06r32_1429825_c1 3300050510 Unclassified 633
175 nmdc:mga06r32_51189_c1 3300050510 Bacteria 3952
176 nmdc:mga06r32_69587_c1 3300050510 Bacteria 3401
177 nmdc:mga06r32_9229_c1 3300050510 Bacteria 8892
178 nmdc:mga08y16_1525844_c1 3300050511 Unclassified 628
179 nmdc:mga08y16_2369_c1 3300050511 Bacteria 19358
180 nmdc:mga08y16_51961_c1 3300050511 Bacteria 753
181 nmdc:mga08y16_55245_c1 3300050511 Bacteria 4150
182 nmdc:mga0n895_65420_c1 3300050512 Bacteria 3599
183 nmdc:mga0rr50_71669_c1 3300050513 Bacteria 2644
184 nmdc:mga08x19_778102_c1 3300050514 Bacteria 680
185 nmdc:mga0a205_18320_c1 3300050515 Bacteria 6582
186 nmdc:mga0a205_426064_c1 3300050515 Bacteria 1189
187 Ga0501084_0576238 3300054114 Bacteria 951
188 Ga0590071_060917 3300059421 Bacteria 922
189 Ga0530510_0099646 3300061734 Bacteria 2124
190 Ga0070700_100290717
191 Ga0065712_10069483
192 Ga0065712_10075516
193 Ga0065715_10112439
194 Ga0070658_10544929
195 Ga0070683_100003892
196 Ga0070670_100019160
197 Ga0070670_100030395
198 Ga0070691_10512913
199 Ga0070661_100024105
200 Ga0070675_100639558
201 Ga0070671_100647357
202 Ga0070673_100467017
203 Ga0070688_100100423
204 Ga0070667_100252748
205 Ga0070705_100942949
206 Ga0070694_100001620
207 Ga0070663_100042711
208 Ga0070662_100536625
209 Ga0070707_100081156
210 Ga0070698_100002831
211 Ga0070699_100029315
212 Ga0070684_100003202
213 Ga0070672_100053952
214 Ga0070665_100414330
215 Ga0070704_100012327
216 Ga0070704_100281244
217 Ga0070664_100004690
218 Ga0068857_100079771
219 Ga0070702_100275908
220 Ga0068864_100071455
221 Ga0068858_100110563
222 Ga0068862_100196562
223 Ga0068862_100445125
224 Ga0075428_100020244
225 Ga0075428_100029378
226 Ga0075428_100110587
227 Ga0075430_100001828
228 Ga0075430_100003211
229 Ga0075430_100009486
230 Ga0075431_100005190
231 Ga0075431_100082544
232 Ga0075431_100130676
233 Ga0075431_100299594
234 Ga0075433_10136270
235 Ga0075433_10153898
236 Ga0075433_11324490
237 Ga0075434_100128045
238 Ga0075429_100026441
239 Ga0075429_100044364
240 Ga0075429_100202885
241 Ga0075435_100591642
242 Ga0111539_10003731
243 Ga0111539_10093764
244 Ga0111539_10120716
245 Ga0111539_10220178
246 Ga0111539_10795437
247 Ga0111539_11023649
248 Ga0111539_11390274
249 Ga0114129_10000086
250 Ga0114129_10002028
251 Ga0114129_10053055
252 Ga0114129_10071391
253 Ga0114129_10090250
254 Ga0114129_10187988
255 Ga0114129_10424193
256 Ga0105243_10412942
257 Ga0105248_10099224
258 Ga0105249_11972944
259 Ga0157375_10293452
260 Ga0207697_10194117
261 Ga0207649_10415461
262 Ga0207681_10823447
263 Ga0207650_10005304
264 Ga0207650_10093366
265 Ga0207659_10501259
266 Ga0207644_10076045
267 Ga0207661_10003180
268 Ga0207679_10001534
269 Ga0207651_10059805
270 Ga0207658_10047785
271 Ga0207678_10062103
272 Ga0207674_10025967
273 Ga0207683_11231525
274 Ga0207428_10001565
275 Ga0268266_10379412
276 Ga0268265_10320690
277 Ga0307408_100017482
278 Ga0307408_100053258
279 Ga0307408_100280428
280 Ga0307408_100288000
281 Ga0307405_10263237
282 Ga0307405_10667221
283 Ga0307413_10019807
284 Ga0307410_10566489
285 Ga0307406_10054191
286 Ga0307406_10088381
287 Ga0307407_10207469
288 Ga0307412_10032803
289 Ga0307412_10207371
290 Ga0307412_10502190
291 Ga0307409_100194226
292 Ga0307409_101929994
293 Ga0307416_100003885
294 Ga0307416_100054490
295 Ga0307416_100072941
296 Ga0307414_10106722
297 Ga0307414_10596497
298 Ga0307411_10809647
299 Ga0307411_11119779
300 Ga0307415_100227925
301 Ga0373948_0045639
302 Ga0439453_0091656
303 Ga0439435_0008995
304 Ga0451577_0904829
305 Ga0466967_0862582
306 Ga0466967_1918186
307 Ga0495603_0009550
308 Ga0495639_0106803
309 Ga0495584_0270076
310 Ga0495637_0108048
311 Ga0495609_0096713
312 Ga0495669_0022154
313 Ga0496102_0586888
314 Ga0496104_0022186
315 Ga0496108_0001909
316 Ga0496109_0005670
317 Ga0496110_0000624
318 Ga0496112_0001309
319 Ga0496113_0356097
320 Ga0501292_027231
321 Ga0501299_005637
322 Ga0501299_056847
323 Ga0501032_0552891
324 Ga0501036_0443000
325 Ga0501036_0947773
326 Ga0501039_0697111
327 Ga0501040_0193768
328 Ga0501042_0510027
329 Ga0501046_0393809
330 Ga0501048_0192377
331 Ga0501048_0608194
332 Ga0501070_0395653
333 Ga0501071_0075533
334 Ga0501071_0689187
335 Ga0501072_0222736
336 Ga0501075_0694285
337 Ga0501075_0776300
338 Ga0501076_0163822
339 Ga0501076_0187994
340 Ga0501076_0753497
341 Ga0501211_029112
342 Ga0501216_020907
343 Ga0501080_0463777
344 Ga0501272_035057
345 Ga0501045_0143473
346 Ga0501045_0386244
347 Ga0501045_0802686
348 nmdc:mga05p37_284073_c1
349 nmdc:mga05p37_295506_c1
350 nmdc:mga05p37_359402_c1
351 nmdc:mga05p37_59475_c1
352 nmdc:mga05p37_91208_c1
353 nmdc:mga05p37_961_c1
354 nmdc:mga09592_2031_c1
355 nmdc:mga09592_334586_c1
356 nmdc:mga09592_368298_c1
357 nmdc:mga0qj67_14776_c1
358 nmdc:mga0qj67_23234_c1
359 nmdc:mga0qj67_45106_c1
360 nmdc:mga0qj67_497381_c1
361 nmdc:mga0qj67_838162_c1
362 nmdc:mga06r32_1207345_c1
363 nmdc:mga06r32_1429825_c1
364 nmdc:mga06r32_51189_c1
365 nmdc:mga06r32_69587_c1
366 nmdc:mga06r32_9229_c1
367 nmdc:mga08y16_1525844_c1
368 nmdc:mga08y16_2369_c1
369 nmdc:mga08y16_51961_c1
370 nmdc:mga08y16_55245_c1
371 nmdc:mga0n895_65420_c1
372 nmdc:mga0rr50_71669_c1
373 nmdc:mga08x19_778102_c1
374 nmdc:mga0a205_18320_c1
375 nmdc:mga0a205_426064_c1
376 Ga0501084_0576238
377 Ga0590071_060917
378 Ga0530510_0099646

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02620

YceD

Large ribosomal RNA subunit accumulation protein YceD

79

197

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oja-assembly1.cif.gz_A-2 structure of hydra cu-zn superoxide dismutase 0.7106 30 59
2e46-assembly1.cif.gz_A crystal structure analysis of the clock protein ea4 0.663 11 59
5u9o-assembly2.cif.gz_D cocrystal structure of the intermembrane space region of the plastid division proteins parc6 and pdv1 0.6462 31 83
1srd-assembly1.cif.gz_D three-dimensional structure of cu,zn-superoxide dismutase from spinach at 2.0 angstroms resolution 0.6173 11 68
4n59-assembly3.cif.gz_A the crystal structure of pectocin m2 at 2.3 angstroms 0.5798 11 83
ID Description Score Start End Superfamily
4n59A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Colicin M, catalytic domain 0.5798 11 83 3.30.450.400
af_P38817_463_585_2.60.40.1230 Mainly Beta;Sandwich;Immunoglobulin-like;Gamma-adaptin ear (GAE) domain 0.5539 15 59 2.60.40.1230
4n58A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Colicin M, catalytic domain 0.5485 11 83 3.30.450.400
af_Q0JQZ2_765_931_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.5451 12 57 2.60.40.1180
af_Q54WM5_152_323_3.10.450.240 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.5439 31 93 3.10.450.240
ID Description Score Start End GO Terms
AF-A0A3N5NPB6-F1-model_v4 DUF177 domain-containing protein 0.9177 1 170
AF-A0A7C7HA84-F1-model_v4 DUF177 domain-containing protein 0.9128 1 173
AF-A0A7C7C3P4-F1-model_v4 DUF177 domain-containing protein 0.9094 1 141
AF-A0A7C7HA84-F1-model_v4 DUF177 domain-containing protein 0.9076 1 173
AF-A0A3N5PPA0-F1-model_v4 DUF177 domain-containing protein 0.9006 28 170

Map