F290276

General Info

Members Datasets Scaffolds Average Seq Length
189 122 189 233

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10092534|rootH1_100925342
Length 236
Sequence MRLPERLLVLLALATTGAAAQADPIDLKPFKATFTAEWKGISAATSILELRKTGPDTWTFATINTPHGLFRMALPDSLTQASTFKLVDGRIVPLSFRGSDEKERPIDLVFDWQGKKVTGTAKAHAIDIVIPEDAQDPMSLQIASLRNLAKGTIPATVSLVDGDGKLKDYELKQEGTARLDTELGTLDTIIYTSRRANSDRVTRTWVAPALGYLPVKAERVRKNKTEFTLLIDSIDR

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
84 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
85 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
86 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
94 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
95 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
102 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
105 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
112 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
122 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 3.7
Rhizosphere 91.01
Stem 0
Stem Tuber 0
Unclassified 4.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10092534 3300003316 Bacteria 1166
2 rootL2_10023327 3300003322 Bacteria 1434
3 rootH1_10280539 3300003323 Bacteria 1068
4 Ga0070676_10088977 3300005328 Bacteria 1888
5 Ga0070690_100053021 3300005330 Bacteria 2593
6 Ga0070670_100241727 3300005331 Bacteria 1572
7 Ga0070677_10024281 3300005333 Bacteria 2253
8 Ga0068869_100157110 3300005334 Bacteria 1768
9 Ga0068869_100255903 3300005334 Bacteria 1400
10 Ga0068869_100943338 3300005334 Unclassified 749
11 Ga0070682_100008439 3300005337 Bacteria 5814
12 Ga0070682_100059123 3300005337 Bacteria 2420
13 Ga0070682_100326830 3300005337 Bacteria 1135
14 Ga0070682_100475887 3300005337 Unclassified 962
15 Ga0070682_100660071 3300005337 Unclassified 834
16 Ga0070689_100217238 3300005340 Bacteria 1567
17 Ga0070689_100490120 3300005340 Bacteria 1051
18 Ga0070689_100590638 3300005340 Bacteria 961
19 Ga0070669_100173978 3300005353 Bacteria 1680
20 Ga0070675_100458910 3300005354 Bacteria 1143
21 Ga0070674_100062445 3300005356 Bacteria 2603
22 Ga0070674_100239857 3300005356 Bacteria 1419
23 Ga0070674_100452546 3300005356 Bacteria 1060
24 Ga0070673_100104991 3300005364 Bacteria 2334
25 Ga0070688_100310452 3300005365 Bacteria 1143
26 Ga0070688_100703128 3300005365 Archaea 783
27 Ga0070688_100730709 3300005365 Unclassified 769
28 Ga0070667_100308625 3300005367 Bacteria 1426
29 Ga0070667_100384026 3300005367 Bacteria 1276
30 Ga0070701_10086473 3300005438 Bacteria 1709
31 Ga0070701_10322117 3300005438 Bacteria 957
32 Ga0070700_100087830 3300005441 Bacteria 2022
33 Ga0070700_100123700 3300005441 Bacteria 1737
34 Ga0070694_100674378 3300005444 Bacteria 839
35 Ga0070663_100202144 3300005455 Bacteria 1551
36 Ga0070678_100031552 3300005456 Bacteria 3657
37 Ga0068867_100024094 3300005459 Bacteria 4361
38 Ga0070685_10198609 3300005466 Bacteria 1302
39 Ga0070685_10283725 3300005466 Bacteria 1110
40 Ga0068853_100622532 3300005539 Bacteria 1026
41 Ga0070672_100013057 3300005543 Bacteria 5854
42 Ga0070686_100065928 3300005544 Bacteria 2353
43 Ga0070686_100092496 3300005544 Bacteria 2026
44 Ga0070686_100580474 3300005544 Unclassified 881
45 Ga0070695_100135364 3300005545 Bacteria 1703
46 Ga0070665_100002677 3300005548 Bacteria 19359
47 Ga0070665_100114550 3300005548 Bacteria 2699
48 Ga0070665_100399172 3300005548 Bacteria 1383
49 Ga0070702_100006053 3300005615 Bacteria 5697
50 Ga0070702_100706543 3300005615 Bacteria 769
51 Ga0068859_100194627 3300005617 Bacteria 2112
52 Ga0068864_100233792 3300005618 Bacteria 1701
53 Ga0068866_10013400 3300005718 Bacteria 3598
54 Ga0068861_100065299 3300005719 Bacteria 2803
55 Ga0068861_100079963 3300005719 Bacteria 2556
56 Ga0068861_100083925 3300005719 Bacteria 2500
57 Ga0068861_100463002 3300005719 Bacteria 1138
58 Ga0068861_100759157 3300005719 Unclassified 907
59 Ga0068870_10036205 3300005840 Bacteria 2538
60 Ga0068870_10179442 3300005840 Bacteria 1270
61 Ga0068863_100134345 3300005841 Bacteria 2363
62 Ga0068863_100172730 3300005841 Bacteria 2073
63 Ga0068863_100265299 3300005841 Bacteria 1661
64 Ga0068858_100181811 3300005842 Bacteria 1986
65 Ga0068860_100171531 3300005843 Bacteria 2095
66 Ga0068862_100033990 3300005844 Bacteria 4313
67 Ga0068862_100490311 3300005844 Bacteria 1165
68 Ga0081455_10010344 3300005937 Bacteria 9479
69 Ga0075366_10142197 3300006195 Bacteria 1451
70 Ga0097621_100032230 3300006237 Bacteria 4164
71 Ga0068871_100061967 3300006358 Bacteria 3056
72 Ga0068871_100276300 3300006358 Bacteria 1468
73 Ga0068871_100566391 3300006358 Bacteria 1030
74 Ga0075430_100345912 3300006846 Bacteria 1228
75 Ga0068865_100339916 3300006881 Bacteria 1213
76 Ga0097620_100194612 3300006931 Bacteria 2112
77 Ga0111539_10206696 3300009094 Bacteria 2288
78 Ga0105242_10267898 3300009176 Bacteria 1546
79 Ga0105242_10567411 3300009176 Bacteria 1091
80 Ga0105248_10275004 3300009177 Bacteria 1896
81 Ga0105249_10231489 3300009553 Bacteria 1823
82 Ga0157378_10290454 3300013297 Bacteria 1579
83 Ga0157378_10506107 3300013297 Bacteria 1207
84 Ga0157375_10162233 3300013308 Bacteria 2378
85 Ga0163163_10060042 3300014325 Bacteria 3763
86 Ga0163163_10322388 3300014325 Bacteria 1599
87 Ga0157380_10012370 3300014326 Bacteria 6191
88 Ga0157380_10022387 3300014326 Bacteria 4756
89 Ga0157380_10104873 3300014326 Bacteria 2362
90 Ga0157380_10189504 3300014326 Bacteria 1814
91 Ga0157379_10159687 3300014968 Bacteria 2035
92 Ga0157376_10070603 3300014969 Bacteria 2965
93 Ga0207682_10015611 3300025893 Bacteria 2958
94 Ga0207682_10022921 3300025893 Bacteria 2463
95 Ga0207645_10207483 3300025907 Bacteria 1290
96 Ga0207643_10283964 3300025908 Bacteria 1027
97 Ga0207681_10084128 3300025923 Bacteria 2254
98 Ga0207681_10595163 3300025923 Archaea 913
99 Ga0207659_10418386 3300025926 Bacteria 1123
100 Ga0207659_10538066 3300025926 Unclassified 992
101 Ga0207644_10376789 3300025931 Bacteria 1157
102 Ga0207690_10222052 3300025932 Bacteria 1446
103 Ga0207686_10022397 3300025934 Bacteria 3638
104 Ga0207686_10568008 3300025934 Bacteria 889
105 Ga0207670_10035059 3300025936 Bacteria 3250
106 Ga0207670_10498231 3300025936 Bacteria 989
107 Ga0207691_10022467 3300025940 Bacteria 5949
108 Ga0207691_10036934 3300025940 Bacteria 4526
109 Ga0207691_10087953 3300025940 Bacteria 2787
110 Ga0207691_10133402 3300025940 Bacteria 2192
111 Ga0207689_10157760 3300025942 Bacteria 1870
112 Ga0207689_10485012 3300025942 Bacteria 1035
113 Ga0207679_10052471 3300025945 Bacteria 2991
114 Ga0207679_10152350 3300025945 Bacteria 1884
115 Ga0207651_10035010 3300025960 Bacteria 3259
116 Ga0207712_10282094 3300025961 Bacteria 1356
117 Ga0207658_10351238 3300025986 Bacteria 1284
118 Ga0207708_10154962 3300026075 Bacteria 1806
119 Ga0207708_10207334 3300026075 Bacteria 1566
120 Ga0207641_10262659 3300026088 Bacteria 1617
121 Ga0207648_10131919 3300026089 Bacteria 2199
122 Ga0207675_100003881 3300026118 Bacteria 14530
123 Ga0207675_100008703 3300026118 Bacteria 9539
124 Ga0207675_100034235 3300026118 Bacteria 4735
125 Ga0207675_100125624 3300026118 Bacteria 2430
126 Ga0207675_100168438 3300026118 Bacteria 2093
127 Ga0207675_100407455 3300026118 Bacteria 1341
128 Ga0207683_10017951 3300026121 Bacteria 6034
129 Ga0207683_10019228 3300026121 Bacteria 5832
130 Ga0207698_10197179 3300026142 Bacteria 1800
131 Ga0209974_10095009 3300027876 Unclassified 1037
132 Ga0268266_10184973 3300028379 Bacteria 1899
133 Ga0268266_10358024 3300028379 Bacteria 1372
134 Ga0268265_10011689 3300028380 Bacteria 5937
135 Ga0268265_10064503 3300028380 Bacteria 2822
136 Ga0268264_10395639 3300028381 Bacteria 1326
137 Ga0307513_10004107 3300031456 Bacteria 19509
138 Ga0307513_10018888 3300031456 Bacteria 8221
139 Ga0307513_10132055 3300031456 Bacteria 2440
140 Ga0307509_10015789 3300031507 Bacteria 8781
141 Ga0307405_10258159 3300031731 Bacteria 1300
142 Ga0307413_10008773 3300031824 Bacteria 4796
143 Ga0307413_10277812 3300031824 Bacteria 1258
144 Ga0307410_10009345 3300031852 Bacteria 5494
145 Ga0307410_10591183 3300031852 Unclassified 925
146 Ga0307406_10006955 3300031901 Bacteria 6269
147 Ga0307412_10115888 3300031911 Bacteria 1921
148 Ga0307409_100008604 3300031995 Bacteria 6208
149 Ga0307409_100012396 3300031995 Bacteria 5432
150 Ga0307411_10000994 3300032005 Bacteria 10923
151 Ga0307415_100151622 3300032126 Bacteria 1785
152 Ga0307415_100266853 3300032126 Bacteria 1400
153 Ga0373937_0162906 3300036401 Bacteria 2091
154 Ga0373925_0395445 3300037068 Bacteria 1127
155 Ga0451800_0417131 3300041459 Bacteria 2589
156 Ga0451807_0725967 3300041486 Bacteria 1187
157 Ga0451807_2085030 3300041486 Bacteria 1271
158 Ga0451807_2186492 3300041486 Bacteria 3207
159 Ga0451837_1007159 3300041494 Bacteria 752
160 Ga0451853_2054540 3300041512 Bacteria 921
161 Ga0495638_0190932 3300046460 Bacteria 1162
162 Ga0495632_0061668 3300046519 Bacteria 1820
163 Ga0495656_0171604 3300046615 Bacteria 1061
164 Ga0495625_0018059 3300046660 Bacteria 5512
165 Ga0495625_0068040 3300046660 Bacteria 2504
166 Ga0495625_0260524 3300046660 Bacteria 1122
167 Ga0495649_0180586 3300046694 Bacteria 1101
168 Ga0496104_0178647 3300048907 Bacteria 2033
169 Ga0496105_0568163 3300048908 Unclassified 883
170 Ga0496114_0094279 3300048917 Bacteria 2546
171 Ga0501036_0209869 3300049572 Unclassified 1637
172 Ga0501042_0236904 3300049578 Bacteria 1317
173 Ga0501067_0274069 3300049583 Unclassified 939
174 Ga0501068_0019801 3300049584 Bacteria 3912
175 Ga0501070_0027505 3300049586 Bacteria 4771
176 Ga0501072_0381734 3300049588 Bacteria 1118
177 Ga0501073_0011563 3300049589 Bacteria 6454
178 Ga0501074_0003932 3300049590 Bacteria 10589
179 Ga0501076_0008594 3300049592 Bacteria 7491
180 Ga0501077_0011220 3300049593 Bacteria 5591
181 Ga0501079_0003179 3300049741 Bacteria 12030
182 Ga0501080_0001778 3300049742 Bacteria 18468
183 Ga0501083_0011188 3300049744 Bacteria 6296
184 Ga0501045_0615081 3300049824 Unclassified 804
185 nmdc:mga0qj67_410494_c1 3300050509 Bacteria 1092
186 nmdc:mga08y16_497190_c1 3300050511 Bacteria 1239
187 nmdc:mga08y16_554372_c1 3300050511 Bacteria 1163
188 Ga0501084_0005365 3300054114 Bacteria 10507
189 Ga0501082_0042933 3300060353 Bacteria 3897

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041494 Ga0451837_1007159 Ga0451837_1007159_155_739 187
2 3300041512 Ga0451853_2054540 Ga0451853_2054540_319_909 195
3 3300005356 Ga0070674_100452546 Ga0070674_1004525462 198
4 3300048907 Ga0496104_0178647 Ga0496104_0178647_11_622 203
5 3300026118 Ga0207675_100034235 Ga0207675_1000342352 211
6 3300049572 Ga0501036_0209869 Ga0501036_0209869_684_1388 225
7 3300041459 Ga0451800_0417131 Ga0451800_0417131_636_1337 226
8 3300041486 Ga0451807_2186492 Ga0451807_2186492_251_952 226
9 3300005438 Ga0070701_10322117 Ga0070701_103221171 227
10 3300005459 Ga0068867_100024094 Ga0068867_1000240943 227
11 3300046615 Ga0495656_0171604 Ga0495656_0171604_232_921 227
12 3300005330 Ga0070690_100053021 Ga0070690_1000530213 232
13 3300005334 Ga0068869_100157110 Ga0068869_1001571102 232
14 3300005365 Ga0070688_100310452 Ga0070688_1003104522 232
15 3300005438 Ga0070701_10086473 Ga0070701_100864732 232
16 3300005539 Ga0068853_100622532 Ga0068853_1006225321 232
17 3300005544 Ga0070686_100092496 Ga0070686_1000924963 232
18 3300005545 Ga0070695_100135364 Ga0070695_1001353642 232
19 3300005615 Ga0070702_100006053 Ga0070702_1000060536 232
20 3300005617 Ga0068859_100194627 Ga0068859_1001946273 232
21 3300005618 Ga0068864_100233792 Ga0068864_1002337922 232
22 3300005719 Ga0068861_100065299 Ga0068861_1000652994 232
23 3300005719 Ga0068861_100079963 Ga0068861_1000799633 232
24 3300005842 Ga0068858_100181811 Ga0068858_1001818112 232
25 3300005843 Ga0068860_100171531 Ga0068860_1001715313 232
26 3300005937 Ga0081455_10010344 Ga0081455_100103443 232
27 3300006931 Ga0097620_100194612 Ga0097620_1001946123 232
28 3300014326 Ga0157380_10104873 Ga0157380_101048733 232
29 3300025936 Ga0207670_10035059 Ga0207670_100350591 232
30 3300025942 Ga0207689_10157760 Ga0207689_101577603 232
31 3300026118 Ga0207675_100003881 Ga0207675_10000388115 232
32 3300026118 Ga0207675_100125624 Ga0207675_1001256242 232
33 3300028381 Ga0268264_10395639 Ga0268264_103956392 232
34 3300003323 rootH1_10280539 rootH1_102805392 233
35 3300005444 Ga0070694_100674378 Ga0070694_1006743781 233
36 3300014326 Ga0157380_10022387 Ga0157380_100223874 233
37 3300031731 Ga0307405_10258159 Ga0307405_102581592 233
38 3300031824 Ga0307413_10277812 Ga0307413_102778121 233
39 3300032126 Ga0307415_100151622 Ga0307415_1001516222 233
40 3300005328 Ga0070676_10088977 Ga0070676_100889772 234
41 3300005331 Ga0070670_100241727 Ga0070670_1002417272 234
42 3300005333 Ga0070677_10024281 Ga0070677_100242812 234
43 3300005334 Ga0068869_100255903 Ga0068869_1002559031 234
44 3300005334 Ga0068869_100943338 Ga0068869_1009433381 234
45 3300005337 Ga0070682_100059123 Ga0070682_1000591233 234
46 3300005337 Ga0070682_100326830 Ga0070682_1003268302 234
47 3300005337 Ga0070682_100475887 Ga0070682_1004758871 234
48 3300005337 Ga0070682_100660071 Ga0070682_1006600711 234
49 3300005340 Ga0070689_100217238 Ga0070689_1002172382 234
50 3300005340 Ga0070689_100490120 Ga0070689_1004901202 234
51 3300005340 Ga0070689_100590638 Ga0070689_1005906381 234
52 3300005353 Ga0070669_100173978 Ga0070669_1001739781 234
53 3300005354 Ga0070675_100458910 Ga0070675_1004589101 234
54 3300005356 Ga0070674_100062445 Ga0070674_1000624453 234
55 3300005356 Ga0070674_100239857 Ga0070674_1002398572 234
56 3300005364 Ga0070673_100104991 Ga0070673_1001049912 234
57 3300005365 Ga0070688_100703128 Ga0070688_1007031281 234
58 3300005365 Ga0070688_100730709 Ga0070688_1007307091 234
59 3300005367 Ga0070667_100308625 Ga0070667_1003086251 234
60 3300005367 Ga0070667_100384026 Ga0070667_1003840261 234
61 3300005441 Ga0070700_100087830 Ga0070700_1000878302 234
62 3300005441 Ga0070700_100123700 Ga0070700_1001237002 234
63 3300005455 Ga0070663_100202144 Ga0070663_1002021441 234
64 3300005456 Ga0070678_100031552 Ga0070678_1000315523 234
65 3300005466 Ga0070685_10198609 Ga0070685_101986092 234
66 3300005543 Ga0070672_100013057 Ga0070672_1000130575 234
67 3300005544 Ga0070686_100065928 Ga0070686_1000659283 234
68 3300005544 Ga0070686_100580474 Ga0070686_1005804742 234
69 3300005548 Ga0070665_100002677 Ga0070665_1000026778 234
70 3300005548 Ga0070665_100114550 Ga0070665_1001145503 234
71 3300005548 Ga0070665_100399172 Ga0070665_1003991722 234
72 3300005615 Ga0070702_100706543 Ga0070702_1007065431 234
73 3300005718 Ga0068866_10013400 Ga0068866_100134003 234
74 3300005719 Ga0068861_100083925 Ga0068861_1000839253 234
75 3300005719 Ga0068861_100463002 Ga0068861_1004630022 234
76 3300005719 Ga0068861_100759157 Ga0068861_1007591571 234
77 3300005840 Ga0068870_10036205 Ga0068870_100362052 234
78 3300005840 Ga0068870_10179442 Ga0068870_101794421 234
79 3300005841 Ga0068863_100134345 Ga0068863_1001343452 234
80 3300005841 Ga0068863_100172730 Ga0068863_1001727302 234
81 3300005844 Ga0068862_100033990 Ga0068862_1000339906 234
82 3300005844 Ga0068862_100490311 Ga0068862_1004903112 234
83 3300006237 Ga0097621_100032230 Ga0097621_1000322304 234
84 3300006358 Ga0068871_100061967 Ga0068871_1000619673 234
85 3300006358 Ga0068871_100276300 Ga0068871_1002763002 234
86 3300006358 Ga0068871_100566391 Ga0068871_1005663911 234
87 3300006846 Ga0075430_100345912 Ga0075430_1003459122 234
88 3300006881 Ga0068865_100339916 Ga0068865_1003399162 234
89 3300009094 Ga0111539_10206696 Ga0111539_102066961 234
90 3300009176 Ga0105242_10267898 Ga0105242_102678982 234
91 3300009176 Ga0105242_10567411 Ga0105242_105674112 234
92 3300009177 Ga0105248_10275004 Ga0105248_102750042 234
93 3300009553 Ga0105249_10231489 Ga0105249_102314892 234
94 3300013297 Ga0157378_10290454 Ga0157378_102904542 234
95 3300013297 Ga0157378_10506107 Ga0157378_105061072 234
96 3300013308 Ga0157375_10162233 Ga0157375_101622332 234
97 3300014325 Ga0163163_10060042 Ga0163163_100600422 234
98 3300014325 Ga0163163_10322388 Ga0163163_103223882 234
99 3300014326 Ga0157380_10012370 Ga0157380_100123702 234
100 3300014326 Ga0157380_10189504 Ga0157380_101895042 234
101 3300014968 Ga0157379_10159687 Ga0157379_101596873 234
102 3300014969 Ga0157376_10070603 Ga0157376_100706032 234
103 3300025893 Ga0207682_10015611 Ga0207682_100156113 234
104 3300025893 Ga0207682_10022921 Ga0207682_100229213 234
105 3300025907 Ga0207645_10207483 Ga0207645_102074832 234
106 3300025908 Ga0207643_10283964 Ga0207643_102839641 234
107 3300025923 Ga0207681_10084128 Ga0207681_100841282 234
108 3300025923 Ga0207681_10595163 Ga0207681_105951632 234
109 3300025926 Ga0207659_10418386 Ga0207659_104183862 234
110 3300025926 Ga0207659_10538066 Ga0207659_105380661 234
111 3300025931 Ga0207644_10376789 Ga0207644_103767891 234
112 3300025932 Ga0207690_10222052 Ga0207690_102220522 234
113 3300025934 Ga0207686_10022397 Ga0207686_100223971 234
114 3300025934 Ga0207686_10568008 Ga0207686_105680082 234
115 3300025936 Ga0207670_10498231 Ga0207670_104982312 234
116 3300025940 Ga0207691_10022467 Ga0207691_100224676 234
117 3300025940 Ga0207691_10036934 Ga0207691_100369343 234
118 3300025940 Ga0207691_10087953 Ga0207691_100879534 234
119 3300025940 Ga0207691_10133402 Ga0207691_101334022 234
120 3300025942 Ga0207689_10485012 Ga0207689_104850121 234
121 3300025945 Ga0207679_10052471 Ga0207679_100524713 234
122 3300025945 Ga0207679_10152350 Ga0207679_101523502 234
123 3300025960 Ga0207651_10035010 Ga0207651_100350102 234
124 3300025961 Ga0207712_10282094 Ga0207712_102820942 234
125 3300025986 Ga0207658_10351238 Ga0207658_103512382 234
126 3300026075 Ga0207708_10154962 Ga0207708_101549622 234
127 3300026075 Ga0207708_10207334 Ga0207708_102073342 234
128 3300026088 Ga0207641_10262659 Ga0207641_102626592 234
129 3300026089 Ga0207648_10131919 Ga0207648_101319193 234
130 3300026118 Ga0207675_100008703 Ga0207675_1000087039 234
131 3300026118 Ga0207675_100168438 Ga0207675_1001684382 234
132 3300026118 Ga0207675_100407455 Ga0207675_1004074552 234
133 3300026121 Ga0207683_10017951 Ga0207683_100179515 234
134 3300026121 Ga0207683_10019228 Ga0207683_100192285 234
135 3300026142 Ga0207698_10197179 Ga0207698_101971793 234
136 3300027876 Ga0209974_10095009 Ga0209974_100950092 234
137 3300028379 Ga0268266_10184973 Ga0268266_101849733 234
138 3300028379 Ga0268266_10358024 Ga0268266_103580242 234
139 3300028380 Ga0268265_10011689 Ga0268265_100116894 234
140 3300031456 Ga0307513_10004107 Ga0307513_1000410716 234
141 3300031456 Ga0307513_10018888 Ga0307513_100188884 234
142 3300031456 Ga0307513_10132055 Ga0307513_101320553 234
143 3300031507 Ga0307509_10015789 Ga0307509_100157895 234
144 3300031824 Ga0307413_10008773 Ga0307413_100087736 234
145 3300031852 Ga0307410_10009345 Ga0307410_100093452 234
146 3300031852 Ga0307410_10591183 Ga0307410_105911831 234
147 3300031901 Ga0307406_10006955 Ga0307406_100069555 234
148 3300031911 Ga0307412_10115888 Ga0307412_101158882 234
149 3300031995 Ga0307409_100008604 Ga0307409_1000086042 234
150 3300031995 Ga0307409_100012396 Ga0307409_1000123964 234
151 3300032005 Ga0307411_10000994 Ga0307411_1000099413 234
152 3300032126 Ga0307415_100266853 Ga0307415_1002668532 234
153 3300036401 Ga0373937_0162906 Ga0373937_0162906_435_1148 234
154 3300037068 Ga0373925_0395445 Ga0373925_0395445_89_802 234
155 3300041486 Ga0451807_2085030 Ga0451807_2085030_371_1075 234
156 3300046460 Ga0495638_0190932 Ga0495638_0190932_389_1093 234
157 3300046519 Ga0495632_0061668 Ga0495632_0061668_586_1290 234
158 3300046660 Ga0495625_0018059 Ga0495625_0018059_2992_3696 234
159 3300046660 Ga0495625_0068040 Ga0495625_0068040_1728_2432 234
160 3300046660 Ga0495625_0260524 Ga0495625_0260524_258_965 234
161 3300046694 Ga0495649_0180586 Ga0495649_0180586_219_923 234
162 3300048908 Ga0496105_0568163 Ga0496105_0568163_127_831 234
163 3300048917 Ga0496114_0094279 Ga0496114_0094279_1459_2163 234
164 3300049578 Ga0501042_0236904 Ga0501042_0236904_442_1146 234
165 3300049583 Ga0501067_0274069 Ga0501067_0274069_49_753 234
166 3300049584 Ga0501068_0019801 Ga0501068_0019801_3178_3882 234
167 3300049586 Ga0501070_0027505 Ga0501070_0027505_4017_4721 234
168 3300049588 Ga0501072_0381734 Ga0501072_0381734_387_1091 234
169 3300049589 Ga0501073_0011563 Ga0501073_0011563_883_1587 234
170 3300049590 Ga0501074_0003932 Ga0501074_0003932_9590_10294 234
171 3300049592 Ga0501076_0008594 Ga0501076_0008594_6715_7419 234
172 3300049593 Ga0501077_0011220 Ga0501077_0011220_550_1254 234
173 3300049741 Ga0501079_0003179 Ga0501079_0003179_11013_11717 234
174 3300049742 Ga0501080_0001778 Ga0501080_0001778_10810_11514 234
175 3300049744 Ga0501083_0011188 Ga0501083_0011188_4985_5689 234
176 3300049824 Ga0501045_0615081 Ga0501045_0615081_52_756 234
177 3300050509 nmdc:mga0qj67_410494_c1 nmdc:mga0qj67_410494_c1_147_851 234
178 3300050511 nmdc:mga08y16_497190_c1 nmdc:mga08y16_497190_c1_442_1146 234
179 3300050511 nmdc:mga08y16_554372_c1 nmdc:mga08y16_554372_c1_24_728 234
180 3300054114 Ga0501084_0005365 Ga0501084_0005365_4197_4901 234
181 3300060353 Ga0501082_0042933 Ga0501082_0042933_3170_3874 234
182 3300005337 Ga0070682_100008439 Ga0070682_1000084393 235
183 3300005466 Ga0070685_10283725 Ga0070685_102837251 235
184 3300006195 Ga0075366_10142197 Ga0075366_101421972 235
185 3300041486 Ga0451807_0725967 Ga0451807_0725967_306_1013 235
186 3300003316 rootH1_10092534 rootH1_100925342 236
187 3300003322 rootL2_10023327 rootL2_100233272 236
188 3300005841 Ga0068863_100265299 Ga0068863_1002652993 236
189 3300028380 Ga0268265_10064503 Ga0268265_100645032 236

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11306

DUF3108

Protein of unknown function (DUF3108)

10

233

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ntr-assembly2.cif.gz_B crystal structure of beta-barrel-like protein of domain of unknown function duf1849 from brucella abortus 0.6747 29 235
6ntr-assembly4.cif.gz_D crystal structure of beta-barrel-like protein of domain of unknown function duf1849 from brucella abortus 0.6291 29 235
6ntr-assembly1.cif.gz_A crystal structure of beta-barrel-like protein of domain of unknown function duf1849 from brucella abortus 0.6283 29 235
4i4k-assembly1.cif.gz_B streptomyces globisporus c-1027 9-membered enediyne conserved protein sgce6 0.6276 44 99
5ig5-assembly1.cif.gz_E crystal structure of n. vectensis camkii-b hub at ph 4.2 0.6257 48 99
ID Description Score Start End Superfamily
af_Q54CJ8_2_182_3.30.1780.10 Alpha Beta;2-Layer Sandwich;ornithine cyclodeaminase, domain 1;ornithine cyclodeaminase, domain 1 0.734 31 91 3.30.1780.10
af_Q86AF6_540_684_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7207 44 99 3.30.530.20
af_I1MWI9_71_209_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6583 43 99 2.40.128.20
1lqgD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Bacteriophage PBS2, uracil-glycosylase inhibitor 0.6292 172 227 3.10.450.20
4i4kB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6276 44 99 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A521W4W1-F1-model_v4 DUF3108 domain-containing protein 0.9315 18 235
AF-A0A3N5KS09-F1-model_v4 DUF3108 domain-containing protein 0.9308 18 236
AF-A0A5J4EA41-F1-model_v4 DUF3108 domain-containing protein 0.9308 18 235
AF-A0A381Z4A7-F1-model_v4 DUF3108 domain-containing protein 0.9245 80 236
AF-A0A2W4QXJ3-F1-model_v4 DUF3108 domain-containing protein 0.9213 12 236 GO:0016020

Feature Viewer

pLDDT pTM Quality
89.28 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map