F290102

General Info

Members Datasets Scaffolds Average Seq Length
188 119 187 229

Family's Representative Sequence

Representative Sequence 3300053131|Ga0500652_080999|Ga0500652_080999_118_867
Length 249
Sequence MRNEKQRNEKGNKKQKIMKLHIHHIIIAITLTTFSCKKDNYDPPGAKLSGHVVYKGEAIGVEYDQVRFELYQYGFGKTGPISAVFAPDGSYSMLLFNGEYKFIVPNGQGPFQWKQTPQGAPDSMLITMNGSQELDIEVTPYYMIRNPQLSASGANVSGTFSIEKIITGASARDVENVSLYINKTQFVSGADNIAVKTVNGSDITNPNNVTLGVTIPTLTPAQNYIYARIGLKIAGVEDRIFSPVKKISL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
88 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
89 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
90 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
101 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
105 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
106 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
107 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
112 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
113 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
114 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
115 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
116 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
117 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
118 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
119 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.91
Nodule 0
Rhizoplane 0.53
Rhizosphere 86.17
Stem 0
Stem Tuber 0
Unclassified 6.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10057953 3300003316 Bacteria 1095
2 rootH1_10069611 3300003316 Unclassified 3746
3 rootL2_10109069 3300003322 Unclassified 3404
4 rootL2_10120349 3300003322 Bacteria 1430
5 rootL2_10188562 3300003322 Bacteria 1604
6 rootH1_10013233 3300003323 Bacteria 23855
7 rootH1_10252171 3300003323 Bacteria 1228
8 rootH1_10262851 3300003323 Bacteria 1465
9 JGI25160J50197_1001266 3300003354 Bacteria 12802
10 Ga0070658_10524461 3300005327 Bacteria 1024
11 Ga0070666_10000288 3300005335 Bacteria 33110
12 Ga0070680_100001016 3300005336 Bacteria 20025
13 Ga0070682_100003683 3300005337 Bacteria 8510
14 Ga0070682_100163375 3300005337 Unclassified 1540
15 Ga0068868_100256684 3300005338 Bacteria 1473
16 Ga0070660_100067917 3300005339 Bacteria 2778
17 Ga0070660_100650160 3300005339 Bacteria 883
18 Ga0070691_10000637 3300005341 Bacteria 13533
19 Ga0070671_100542469 3300005355 Bacteria 1002
20 Ga0070667_100009856 3300005367 Bacteria 7920
21 Ga0070667_100021532 3300005367 Bacteria 5351
22 Ga0070681_10001921 3300005458 Bacteria 18746
23 Ga0070679_100001924 3300005530 Bacteria 18646
24 Ga0070684_100690511 3300005535 Bacteria 951
25 Ga0068853_100008216 3300005539 Bacteria 8379
26 Ga0068853_100137808 3300005539 Unclassified 2189
27 Ga0068853_100234182 3300005539 Bacteria 1681
28 Ga0068853_100254288 3300005539 Bacteria 1613
29 Ga0068853_100444073 3300005539 Bacteria 1219
30 Ga0070693_100002315 3300005547 Bacteria 8740
31 Ga0068855_100006090 3300005563 Bacteria 14710
32 Ga0068855_100008815 3300005563 Bacteria 12192
33 Ga0068855_100045670 3300005563 Bacteria 5180
34 Ga0068855_100256708 3300005563 Bacteria 1948
35 Ga0068854_100071693 3300005578 Bacteria 2535
36 Ga0068856_100027273 3300005614 Bacteria 5573
37 Ga0068856_100027967 3300005614 Bacteria 5502
38 Ga0068852_100000475 3300005616 Bacteria 26290
39 Ga0068852_100089220 3300005616 Bacteria 2755
40 Ga0068852_100234504 3300005616 Bacteria 1751
41 Ga0068852_100467829 3300005616 Bacteria 1251
42 Ga0068852_100506442 3300005616 Bacteria 1203
43 Ga0068859_100000012 3300005617 Bacteria 300376
44 Ga0068859_100009036 3300005617 Bacteria 10068
45 Ga0068864_100011265 3300005618 Bacteria 7389
46 Ga0068863_100006395 3300005841 Bacteria 11549
47 Ga0068858_100005318 3300005842 Bacteria 12621
48 Ga0068860_100000004 3300005843 Bacteria 506126
49 Ga0068860_100003336 3300005843 Bacteria 16531
50 Ga0068862_100065623 3300005844 Bacteria 3127
51 Ga0075366_10204020 3300006195 Bacteria 1203
52 Ga0097621_100014814 3300006237 Bacteria 5848
53 Ga0068871_100006543 3300006358 Bacteria 8255
54 Ga0097620_100000012 3300006931 Bacteria 300376
55 Ga0097620_100009036 3300006931 Bacteria 10068
56 Ga0105240_10000649 3300009093 Bacteria 64145
57 Ga0105240_10000773 3300009093 Bacteria 58079
58 Ga0105240_10185450 3300009093 Bacteria 2451
59 Ga0105240_10191968 3300009093 Bacteria 2401
60 Ga0105245_10075205 3300009098 Bacteria 3075
61 Ga0105247_10027411 3300009101 Bacteria 3445
62 Ga0105241_10000357 3300009174 Bacteria 34720
63 Ga0105241_10000857 3300009174 Bacteria 23065
64 Ga0105241_10007916 3300009174 Bacteria 7813
65 Ga0105241_10070588 3300009174 Bacteria 2710
66 Ga0105237_10001940 3300009545 Bacteria 26353
67 Ga0105237_10039355 3300009545 Unclassified 4773
68 Ga0105237_10237425 3300009545 Bacteria 1824
69 Ga0105237_10307933 3300009545 Unclassified 1587
70 Ga0105237_10327845 3300009545 Bacteria 1535
71 Ga0105238_10000489 3300009551 Bacteria 41694
72 Ga0105249_10065961 3300009553 Bacteria 3332
73 Ga0105239_10055861 3300010375 Bacteria 4331
74 Ga0105246_10003874 3300011119 Bacteria 9066
75 Ga0105246_10026310 3300011119 Bacteria 3799
76 Ga0157373_10187845 3300013100 Bacteria 1456
77 Ga0157371_10093292 3300013102 Bacteria 2133
78 Ga0157371_10109204 3300013102 Bacteria 1963
79 Ga0157370_10000518 3300013104 Bacteria 48217
80 Ga0157370_10002985 3300013104 Bacteria 20119
81 Ga0157370_10037006 3300013104 Bacteria 4734
82 Ga0157369_10079157 3300013105 Bacteria 3520
83 Ga0157374_10033893 3300013296 Bacteria 4662
84 Ga0157374_10481528 3300013296 Bacteria 1244
85 Ga0157378_10099517 3300013297 Bacteria 2653
86 Ga0157378_10113083 3300013297 Unclassified 2492
87 Ga0157378_10167783 3300013297 Unclassified 2057
88 Ga0163162_10020817 3300013306 Bacteria 6448
89 Ga0163162_10156156 3300013306 Bacteria 2402
90 Ga0163162_11168768 3300013306 Bacteria 873
91 Ga0157372_10194326 3300013307 Bacteria 2351
92 Ga0157372_10254946 3300013307 Unclassified 2037
93 Ga0157372_10564077 3300013307 Bacteria 1327
94 Ga0157375_10054199 3300013308 Bacteria 3949
95 Ga0157375_11281519 3300013308 Bacteria 861
96 Ga0163163_10060406 3300014325 Bacteria 3753
97 Ga0163163_11074121 3300014325 Bacteria 868
98 Ga0157376_10000927 3300014969 Bacteria 19071
99 Ga0163161_10316865 3300017792 Unclassified 1232
100 Ga0207426_1000032 3300025302 Bacteria 457997
101 Ga0207710_10015543 3300025900 Bacteria 3218
102 Ga0207680_10000158 3300025903 Bacteria 33115
103 Ga0207647_10052186 3300025904 Bacteria 2525
104 Ga0207654_10000779 3300025911 Bacteria 17521
105 Ga0207654_10001075 3300025911 Bacteria 14852
106 Ga0207654_10005789 3300025911 Bacteria 6238
107 Ga0207654_10133806 3300025911 Unclassified 1572
108 Ga0207707_10000110 3300025912 Bacteria 82391
109 Ga0207695_10003344 3300025913 Bacteria 22693
110 Ga0207695_10047311 3300025913 Bacteria 4553
111 Ga0207671_10003547 3300025914 Bacteria 15462
112 Ga0207671_10006767 3300025914 Bacteria 10132
113 Ga0207671_10012986 3300025914 Bacteria 6662
114 Ga0207660_10005158 3300025917 Bacteria 8492
115 Ga0207657_10214607 3300025919 Unclassified 1543
116 Ga0207652_10000265 3300025921 Bacteria 54617
117 Ga0207652_10140489 3300025921 Bacteria 2159
118 Ga0207706_10282140 3300025933 Bacteria 1448
119 Ga0207704_10233350 3300025938 Bacteria 1370
120 Ga0207689_10001998 3300025942 Bacteria 19248
121 Ga0207667_10004551 3300025949 Bacteria 16994
122 Ga0207667_10009287 3300025949 Bacteria 11604
123 Ga0207667_10009705 3300025949 Bacteria 11320
124 Ga0207651_10673269 3300025960 Bacteria 910
125 Ga0207712_10042584 3300025961 Bacteria 3128
126 Ga0207712_10369683 3300025961 Bacteria 1197
127 Ga0207640_10249531 3300025981 Bacteria 1376
128 Ga0207703_10005056 3300026035 Bacteria 10678
129 Ga0207639_10007238 3300026041 Bacteria 7561
130 Ga0207639_10067940 3300026041 Bacteria 2776
131 Ga0207639_10159044 3300026041 Bacteria 1902
132 Ga0207639_10182351 3300026041 Bacteria 1787
133 Ga0207702_10204161 3300026078 Bacteria 1834
134 Ga0207641_10000048 3300026088 Bacteria 178206
135 Ga0207674_10139652 3300026116 Bacteria 2383
136 Ga0207698_10001143 3300026142 Bacteria 15448
137 Ga0207698_10268291 3300026142 Bacteria 1572
138 Ga0207698_10567138 3300026142 Unclassified 1115
139 Ga0207698_10863278 3300026142 Bacteria 910
140 Ga0268264_10000011 3300028381 Bacteria 580884
141 Ga0268264_10002171 3300028381 Bacteria 17486
142 Ga0307515_10000092 3300028794 Bacteria 212425
143 Ga0307513_10110174 3300031456 Bacteria 2749
144 Ga0307513_10382407 3300031456 Bacteria 1147
145 Ga0395899_0009814 3300037312 Bacteria 7344
146 Ga0395900_0263151 3300037418 Bacteria 1721
147 Ga0395898_0004737 3300037466 Bacteria 14806
148 Ga0395905_0002748 3300037471 Bacteria 19260
149 Ga0395901_0003493 3300038443 Bacteria 15840
150 Ga0451800_1211160 3300041459 Bacteria 1008
151 Ga0439457_034610 3300042014 Unclassified 1122
152 Ga0466969_0000103 3300044656 Bacteria 44804
153 Ga0466972_0000182 3300044658 Bacteria 48545
154 Ga0466972_0034056 3300044658 Bacteria 2497
155 Ga0466966_0000097 3300044684 Bacteria 53836
156 Ga0466961_0280320 3300044693 Bacteria 1020
157 Ga0466964_0065428 3300044706 Unclassified 1523
158 Ga0466957_0000362 3300044842 Bacteria 22356
159 Ga0466957_0003738 3300044842 Bacteria 8411
160 Ga0466959_0000180 3300045049 Bacteria 42019
161 Ga0495638_0102713 3300046460 Bacteria 1708
162 Ga0495609_0010738 3300046538 Bacteria 4381
163 Ga0495625_0070837 3300046660 Bacteria 2447
164 Ga0495687_000001 3300047443 Bacteria 1215582
165 Ga0495686_0000098 3300047472 Bacteria 183131
166 Ga0495686_0120402 3300047472 Bacteria 1565
167 Ga0495678_006658 3300049459 Bacteria 6113
168 Ga0501034_0153063 3300049571 Unclassified 2281
169 Ga0501047_0008951 3300049581 Bacteria 9452
170 Ga0501047_0018818 3300049581 Bacteria 6625
171 Ga0501219_000175 3300049703 Bacteria 11883
172 Ga0501225_0000482 3300049705 Bacteria 12403
173 Ga0501225_0008290 3300049705 Bacteria 2988
174 Ga0501241_005940 3300049758 Bacteria 2266
175 Ga0501035_0581132 3300049822 Bacteria 915
176 Ga0501044_0017918 3300049823 Bacteria 7593
177 Ga0501284_00004 3300050005 Bacteria 211793
178 nmdc:mga0k408_180454_c1 3300050493 Unclassified 1259
179 Ga0500578_0000529 3300053086 Bacteria 46403
180 Ga0500583_0000016 3300053092 Bacteria 144540
181 Ga0500652_080999 3300053131 Bacteria 1352
182 Ga0500658_0052093 3300053134 Unclassified 1676
183 Ga0500589_025002 3300053147 Bacteria 2763
184 Ga0500622_0014911 3300053156 Bacteria 4166
185 Ga0500636_0244597 3300053177 Bacteria 919
186 Ga0500611_037689 3300053727 Bacteria 1043
187 Ga0500645_024229 3300053730 Bacteria 1856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005339 Ga0070660_100650160 Ga0070660_1006501601 194
2 3300003323 rootH1_10252171 rootH1_102521712 205
3 3300005539 Ga0068853_100444073 Ga0068853_1004440732 211
4 3300026041 Ga0207639_10182351 Ga0207639_101823511 211
5 3300044658 Ga0466972_0034056 Ga0466972_0034056_1181_1879 211
6 3300053177 Ga0500636_0244597 Ga0500636_0244597_197_895 211
7 3300049705 Ga0501225_0000482 Ga0501225_0000482_3501_4151 213
8 3300005535 Ga0070684_100690511 Ga0070684_1006905112 215
9 3300005616 Ga0068852_100506442 Ga0068852_1005064422 215
10 3300013100 Ga0157373_10187845 Ga0157373_101878452 215
11 3300013102 Ga0157371_10109204 Ga0157371_101092041 215
12 3300013105 Ga0157369_10079157 Ga0157369_100791573 215
13 3300013307 Ga0157372_10194326 Ga0157372_101943262 215
14 3300013307 Ga0157372_10564077 Ga0157372_105640771 215
15 3300042014 Ga0439457_034610 Ga0439457_034610_63_755 215
16 3300005336 Ga0070680_100001016 Ga0070680_1000010161 216
17 3300005337 Ga0070682_100003683 Ga0070682_1000036832 216
18 3300005339 Ga0070660_100067917 Ga0070660_1000679172 216
19 3300005341 Ga0070691_10000637 Ga0070691_100006373 216
20 3300005458 Ga0070681_10001921 Ga0070681_100019213 216
21 3300005530 Ga0070679_100001924 Ga0070679_1000019247 216
22 3300005539 Ga0068853_100008216 Ga0068853_1000082163 216
23 3300005547 Ga0070693_100002315 Ga0070693_1000023153 216
24 3300005563 Ga0068855_100006090 Ga0068855_1000060904 216
25 3300009093 Ga0105240_10000773 Ga0105240_1000077322 216
26 3300009174 Ga0105241_10000357 Ga0105241_1000035710 216
27 3300009545 Ga0105237_10307933 Ga0105237_103079332 216
28 3300013104 Ga0157370_10000518 Ga0157370_1000051817 216
29 3300013307 Ga0157372_10254946 Ga0157372_102549462 216
30 3300025911 Ga0207654_10000779 Ga0207654_100007795 216
31 3300025912 Ga0207707_10000110 Ga0207707_1000011023 216
32 3300025913 Ga0207695_10047311 Ga0207695_100473112 216
33 3300025917 Ga0207660_10005158 Ga0207660_100051585 216
34 3300025919 Ga0207657_10214607 Ga0207657_102146072 216
35 3300025921 Ga0207652_10000265 Ga0207652_1000026517 216
36 3300025949 Ga0207667_10009705 Ga0207667_100097054 216
37 3300026041 Ga0207639_10007238 Ga0207639_100072383 216
38 3300009093 Ga0105240_10000649 Ga0105240_1000064947 217
39 3300009098 Ga0105245_10075205 Ga0105245_100752052 217
40 3300009101 Ga0105247_10027411 Ga0105247_100274112 217
41 3300009174 Ga0105241_10000857 Ga0105241_100008578 217
42 3300009174 Ga0105241_10007916 Ga0105241_100079163 217
43 3300009545 Ga0105237_10001940 Ga0105237_100019403 217
44 3300009545 Ga0105237_10039355 Ga0105237_100393553 217
45 3300009553 Ga0105249_10065961 Ga0105249_100659613 217
46 3300010375 Ga0105239_10055861 Ga0105239_100558612 217
47 3300011119 Ga0105246_10003874 Ga0105246_100038745 217
48 3300011119 Ga0105246_10026310 Ga0105246_100263102 217
49 3300013296 Ga0157374_10033893 Ga0157374_100338933 217
50 3300013306 Ga0163162_11168768 Ga0163162_111687682 217
51 3300013308 Ga0157375_10054199 Ga0157375_100541992 217
52 3300013308 Ga0157375_11281519 Ga0157375_112815191 217
53 3300014325 Ga0163163_10060406 Ga0163163_100604063 217
54 3300041459 Ga0451800_1211160 Ga0451800_1211160_126_782 217
55 3300044693 Ga0466961_0280320 Ga0466961_0280320_37_699 217
56 3300044706 Ga0466964_0065428 Ga0466964_0065428_791_1453 217
57 3300047472 Ga0495686_0000098 Ga0495686_0000098_124790_125461 217
58 3300053147 Ga0500589_025002 Ga0500589_025002_756_1418 217
59 3300003316 rootH1_10069611 rootH1_100696114 218
60 3300009551 Ga0105238_10000489 Ga0105238_1000048911 218
61 3300003323 rootH1_10013233 rootH1_1001323320 219
62 iso_pu_bacteria 2738541278 2738731804 223
63 3300005337 Ga0070682_100163375 Ga0070682_1001633752 225
64 3300006195 Ga0075366_10204020 Ga0075366_102040201 225
65 3300026142 Ga0207698_10567138 Ga0207698_105671382 225
66 3300005335 Ga0070666_10000288 Ga0070666_1000028818 226
67 3300005338 Ga0068868_100256684 Ga0068868_1002566841 226
68 3300005355 Ga0070671_100542469 Ga0070671_1005424692 226
69 3300005367 Ga0070667_100009856 Ga0070667_1000098564 226
70 3300005367 Ga0070667_100021532 Ga0070667_1000215323 226
71 3300005616 Ga0068852_100089220 Ga0068852_1000892203 226
72 3300005617 Ga0068859_100000012 Ga0068859_10000001263 226
73 3300005617 Ga0068859_100009036 Ga0068859_1000090362 226
74 3300005618 Ga0068864_100011265 Ga0068864_1000112654 226
75 3300005841 Ga0068863_100006395 Ga0068863_1000063953 226
76 3300005842 Ga0068858_100005318 Ga0068858_1000053183 226
77 3300005843 Ga0068860_100003336 Ga0068860_1000033368 226
78 3300006237 Ga0097621_100014814 Ga0097621_1000148142 226
79 3300006358 Ga0068871_100006543 Ga0068871_1000065432 226
80 3300006931 Ga0097620_100000012 Ga0097620_10000001263 226
81 3300006931 Ga0097620_100009036 Ga0097620_1000090362 226
82 3300013297 Ga0157378_10099517 Ga0157378_100995172 226
83 3300013297 Ga0157378_10113083 Ga0157378_101130832 226
84 3300013297 Ga0157378_10167783 Ga0157378_101677832 226
85 3300014969 Ga0157376_10000927 Ga0157376_100009277 226
86 3300025900 Ga0207710_10015543 Ga0207710_100155432 226
87 3300025903 Ga0207680_10000158 Ga0207680_1000015818 226
88 3300025911 Ga0207654_10001075 Ga0207654_100010758 226
89 3300025914 Ga0207671_10006767 Ga0207671_100067676 226
90 3300025938 Ga0207704_10233350 Ga0207704_102333502 226
91 3300025942 Ga0207689_10001998 Ga0207689_1000199811 226
92 3300025961 Ga0207712_10042584 Ga0207712_100425842 226
93 3300026035 Ga0207703_10005056 Ga0207703_100050565 226
94 3300026088 Ga0207641_10000048 Ga0207641_1000004886 226
95 3300026142 Ga0207698_10268291 Ga0207698_102682912 226
96 3300028381 Ga0268264_10002171 Ga0268264_1000217111 226
97 3300028794 Ga0307515_10000092 Ga0307515_10000092172 226
98 3300031456 Ga0307513_10382407 Ga0307513_103824072 226
99 3300044658 Ga0466972_0000182 Ga0466972_0000182_31647_32333 226
100 3300046660 Ga0495625_0070837 Ga0495625_0070837_26_724 226
101 3300047472 Ga0495686_0120402 Ga0495686_0120402_739_1437 226
102 3300049459 Ga0495678_006658 Ga0495678_006658_4213_4911 226
103 3300053134 Ga0500658_0052093 Ga0500658_0052093_773_1459 226
104 3300003322 rootL2_10109069 rootL2_101090693 227
105 3300003322 rootL2_10188562 rootL2_101885622 227
106 3300003323 rootH1_10262851 rootH1_102628511 227
107 3300003354 JGI25160J50197_1001266 JGI25160J50197_10012664 227
108 3300005539 Ga0068853_100137808 Ga0068853_1001378082 227
109 3300005539 Ga0068853_100234182 Ga0068853_1002341823 227
110 3300005539 Ga0068853_100254288 Ga0068853_1002542882 227
111 3300005563 Ga0068855_100008815 Ga0068855_1000088155 227
112 3300005563 Ga0068855_100045670 Ga0068855_1000456703 227
113 3300005563 Ga0068855_100256708 Ga0068855_1002567082 227
114 3300005578 Ga0068854_100071693 Ga0068854_1000716932 227
115 3300005614 Ga0068856_100027273 Ga0068856_1000272732 227
116 3300005614 Ga0068856_100027967 Ga0068856_1000279674 227
117 3300005616 Ga0068852_100000475 Ga0068852_1000004757 227
118 3300005616 Ga0068852_100467829 Ga0068852_1004678293 227
119 3300005843 Ga0068860_100000004 Ga0068860_10000000438 227
120 3300005844 Ga0068862_100065623 Ga0068862_1000656233 227
121 3300009093 Ga0105240_10185450 Ga0105240_101854502 227
122 3300009093 Ga0105240_10191968 Ga0105240_101919682 227
123 3300009174 Ga0105241_10070588 Ga0105241_100705882 227
124 3300009545 Ga0105237_10237425 Ga0105237_102374252 227
125 3300009545 Ga0105237_10327845 Ga0105237_103278451 227
126 3300013102 Ga0157371_10093292 Ga0157371_100932922 227
127 3300013104 Ga0157370_10002985 Ga0157370_1000298510 227
128 3300013104 Ga0157370_10037006 Ga0157370_100370062 227
129 3300013296 Ga0157374_10481528 Ga0157374_104815282 227
130 3300013306 Ga0163162_10020817 Ga0163162_100208173 227
131 3300013306 Ga0163162_10156156 Ga0163162_101561563 227
132 3300014325 Ga0163163_11074121 Ga0163163_110741211 227
133 3300017792 Ga0163161_10316865 Ga0163161_103168653 227
134 3300025302 Ga0207426_1000032 Ga0207426_100003210 227
135 3300025904 Ga0207647_10052186 Ga0207647_100521862 227
136 3300025911 Ga0207654_10005789 Ga0207654_100057893 227
137 3300025911 Ga0207654_10133806 Ga0207654_101338062 227
138 3300025913 Ga0207695_10003344 Ga0207695_1000334410 227
139 3300025914 Ga0207671_10003547 Ga0207671_100035473 227
140 3300025914 Ga0207671_10012986 Ga0207671_100129863 227
141 3300025921 Ga0207652_10140489 Ga0207652_101404892 227
142 3300025933 Ga0207706_10282140 Ga0207706_102821402 227
143 3300025949 Ga0207667_10004551 Ga0207667_100045513 227
144 3300025949 Ga0207667_10009287 Ga0207667_100092874 227
145 3300025960 Ga0207651_10673269 Ga0207651_106732691 227
146 3300025961 Ga0207712_10369683 Ga0207712_103696832 227
147 3300025981 Ga0207640_10249531 Ga0207640_102495312 227
148 3300026041 Ga0207639_10067940 Ga0207639_100679403 227
149 3300026041 Ga0207639_10159044 Ga0207639_101590442 227
150 3300026078 Ga0207702_10204161 Ga0207702_102041612 227
151 3300026116 Ga0207674_10139652 Ga0207674_101396522 227
152 3300026142 Ga0207698_10001143 Ga0207698_100011437 227
153 3300026142 Ga0207698_10863278 Ga0207698_108632781 227
154 3300028381 Ga0268264_10000011 Ga0268264_10000011328 227
155 3300031456 Ga0307513_10110174 Ga0307513_101101742 227
156 3300037312 Ga0395899_0009814 Ga0395899_0009814_6569_7270 227
157 3300037418 Ga0395900_0263151 Ga0395900_0263151_924_1625 227
158 3300037466 Ga0395898_0004737 Ga0395898_0004737_13874_14575 227
159 3300038443 Ga0395901_0003493 Ga0395901_0003493_14574_15275 227
160 3300044656 Ga0466969_0000103 Ga0466969_0000103_11912_12613 227
161 3300044684 Ga0466966_0000097 Ga0466966_0000097_8276_8977 227
162 3300044842 Ga0466957_0000362 Ga0466957_0000362_4627_5328 227
163 3300044842 Ga0466957_0003738 Ga0466957_0003738_6574_7275 227
164 3300045049 Ga0466959_0000180 Ga0466959_0000180_18391_19092 227
165 3300046460 Ga0495638_0102713 Ga0495638_0102713_414_1103 227
166 3300046538 Ga0495609_0010738 Ga0495609_0010738_585_1292 227
167 3300047443 Ga0495687_000001 Ga0495687_000001_1010577_1011281 227
168 3300049571 Ga0501034_0153063 Ga0501034_0153063_513_1214 227
169 3300049581 Ga0501047_0008951 Ga0501047_0008951_7342_8040 227
170 3300049581 Ga0501047_0018818 Ga0501047_0018818_3115_3807 227
171 3300049703 Ga0501219_000175 Ga0501219_000175_2008_2715 227
172 3300049822 Ga0501035_0581132 Ga0501035_0581132_85_777 227
173 3300049823 Ga0501044_0017918 Ga0501044_0017918_1510_2202 227
174 3300050005 Ga0501284_00004 Ga0501284_00004_205830_206537 227
175 3300050493 nmdc:mga0k408_180454_c1 nmdc:mga0k408_180454_c1_474_1160 227
176 3300053086 Ga0500578_0000529 Ga0500578_0000529_33106_33804 227
177 3300053092 Ga0500583_0000016 Ga0500583_0000016_127928_128623 227
178 3300053156 Ga0500622_0014911 Ga0500622_0014911_161_856 227
179 3300053727 Ga0500611_037689 Ga0500611_037689_329_1018 227
180 3300053730 Ga0500645_024229 Ga0500645_024229_370_1077 227
181 3300003316 rootH1_10057953 rootH1_100579531 228
182 3300003322 rootL2_10120349 rootL2_101203491 228
183 3300005327 Ga0070658_10524461 Ga0070658_105244612 228
184 3300005616 Ga0068852_100234504 Ga0068852_1002345042 228
185 3300037471 Ga0395905_0002748 Ga0395905_0002748_8027_8797 228
186 3300049705 Ga0501225_0008290 Ga0501225_0008290_239_964 228
187 3300049758 Ga0501241_005940 Ga0501241_005940_1267_1992 228
188 3300053131 Ga0500652_080999 Ga0500652_080999_118_867 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18003

DUF3823_C

Domain of unknown function (DUF3823_C)

142

246

0.98

PF12866

DUF3823

Protein of unknown function (DUF3823) N-terminal domain

46

139

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxt-assembly2.cif.gz_B crystal structure of a duf3823 family protein (bacova_02663) from bacteroides ovatus atcc 8483 at 2.77 a resolution 0.9031 26 227
4fxt-assembly3.cif.gz_C crystal structure of a duf3823 family protein (bacova_02663) from bacteroides ovatus atcc 8483 at 2.77 a resolution 0.903 26 227
4fxt-assembly8.cif.gz_H crystal structure of a duf3823 family protein (bacova_02663) from bacteroides ovatus atcc 8483 at 2.77 a resolution 0.9017 28 227
4fxt-assembly9.cif.gz_I crystal structure of a duf3823 family protein (bacova_02663) from bacteroides ovatus atcc 8483 at 2.77 a resolution 0.8971 28 227
4yok-assembly1.cif.gz_A crystal structure of a duf3823 family protein (parmer_04126) from parabacteroides merdae atcc 43184 at 1.80 a resolution 0.896 24 227
ID Description Score Start End Superfamily
4yokA01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8853 24 121 2.60.40.1120
4fxtG01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8823 28 121 2.60.40.1120
4yokA01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8765 24 121 2.60.40.1120
4fxtG01 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8634 28 121 2.60.40.1120
4fxtA02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8586 122 227 2.60.40.2060
ID Description Score Start End GO Terms
AF-A0A7W1W1I5-F1-model_v4 DUF3823 domain-containing protein 0.9725 51 228
AF-A0A679HU65-F1-model_v4 Uncharacterized protein 0.9451 30 227
AF-A0A4Q5RH04-F1-model_v4 DUF3823 domain-containing protein 0.9449 28 227
AF-A0A7W1W1I5-F1-model_v4 DUF3823 domain-containing protein 0.9414 51 228
AF-A0A679HU65-F1-model_v4 Uncharacterized protein 0.9355 30 227

Feature Viewer

pLDDT pTM Quality
87.9 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map