F289826

General Info

Members Datasets Scaffolds Average Seq Length
188 115 376 237

Family's Representative Sequence

Representative Sequence 3300046462|Ga0495651_0190716|Ga0495651_0190716_32_847
Length 271
Sequence MLPIGSSTSGIHTSSCAAISRRIEPHPYPCPVAAEPPIVELARAPERAALFFDLDGTLSPIVARPEDAFVPAETRAEIERLASRYALVACVTGRAGNDARRILGVESVTYVGEHGLELEPGAERWRDPLALFLAGVSWPDEDTENKGLTASLHFRNATDGAAAEAALEAIAERARQEGFRARFGRKVLELLPPVEASKRTAVAQLLGRSRLTRALYAGDDTTDLDAFAALDGLELAVRVAVGSAEGPATLRERADVVVETPAELLGILRAL

Samples

Sample ID Description Type Environment
1 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
34 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
59 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
60 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
61 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
62 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
80 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
88 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
89 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
94 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
98 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
101 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
102 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
109 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
110 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
111 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
112 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
113 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 2.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.72
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495651_0190716 3300046462 Bacteria 1443
2 Ga0070658_10036571 3300005327 Bacteria 3957
3 Ga0070658_10511222 3300005327 Unclassified 1038
4 Ga0070683_100037582 3300005329 Bacteria 4432
5 Ga0070683_100153405 3300005329 Bacteria 2184
6 Ga0070682_100421018 3300005337 Unclassified 1015
7 Ga0070660_100015912 3300005339 Bacteria 5446
8 Ga0070660_100148586 3300005339 Bacteria 1883
9 Ga0070660_100166307 3300005339 Bacteria 1779
10 Ga0070661_100040189 3300005344 Bacteria 3411
11 Ga0070661_100326370 3300005344 Unclassified 1200
12 Ga0070659_100003771 3300005366 Bacteria 10814
13 Ga0070659_100042127 3300005366 Bacteria 3570
14 Ga0070659_100141754 3300005366 Bacteria 1957
15 Ga0070667_100008415 3300005367 Bacteria 8559
16 Ga0070681_10015700 3300005458 Bacteria 7546
17 Ga0070681_10275245 3300005458 Bacteria 1594
18 Ga0070707_100001094 3300005468 Bacteria 26790
19 Ga0070679_100023086 3300005530 Bacteria 6085
20 Ga0070679_100050172 3300005530 Bacteria 4156
21 Ga0070679_100082883 3300005530 Bacteria 3196
22 Ga0070679_100172249 3300005530 Bacteria 2137
23 Ga0070679_100265730 3300005530 Bacteria 1670
24 Ga0070684_100148510 3300005535 Bacteria 2122
25 Ga0070697_100136011 3300005536 Bacteria 2064
26 Ga0068853_100101626 3300005539 Bacteria 2543
27 Ga0068853_100453969 3300005539 Unclassified 1206
28 Ga0070696_100014317 3300005546 Bacteria 5320
29 Ga0070665_100007548 3300005548 Bacteria 11053
30 Ga0068855_100088984 3300005563 Bacteria 3566
31 Ga0068855_100112215 3300005563 Bacteria 3128
32 Ga0068855_100209553 3300005563 Bacteria 2191
33 Ga0068857_100011411 3300005577 Bacteria 7729
34 Ga0068856_100391955 3300005614 Bacteria 1408
35 Ga0068852_100014317 3300005616 Bacteria 6100
36 Ga0068852_100506960 3300005616 Bacteria 1202
37 Ga0068858_100148308 3300005842 Bacteria 2204
38 Ga0081539_10057219 3300005985 Bacteria 2159
39 Ga0075431_100377053 3300006847 Bacteria 1423
40 Ga0075434_100262237 3300006871 Bacteria 1747
41 Ga0105240_10051622 3300009093 Bacteria 5172
42 Ga0111539_10008138 3300009094 Bacteria 13357
43 Ga0111539_10266342 3300009094 Bacteria 1995
44 Ga0114129_10077258 3300009147 Bacteria 4632
45 Ga0105241_10383439 3300009174 Bacteria 1229
46 Ga0105237_10037076 3300009545 Bacteria 4929
47 Ga0105237_10418327 3300009545 Unclassified 1346
48 Ga0105238_10040827 3300009551 Bacteria 4700
49 Ga0105238_10107844 3300009551 Bacteria 2766
50 Ga0105238_10747692 3300009551 Bacteria 992
51 Ga0105239_10027377 3300010375 Bacteria 6275
52 Ga0105239_10051511 3300010375 Bacteria 4513
53 Ga0157370_10013920 3300013104 Bacteria 8260
54 Ga0157370_10021781 3300013104 Bacteria 6384
55 Ga0157370_10027545 3300013104 Bacteria 5603
56 Ga0157370_10089902 3300013104 Bacteria 2884
57 Ga0157369_10010672 3300013105 Bacteria 10455
58 Ga0157369_10084027 3300013105 Bacteria 3404
59 Ga0157369_10097700 3300013105 Bacteria 3132
60 Ga0157369_10665755 3300013105 Bacteria 1073
61 Ga0157374_10266775 3300013296 Bacteria 1688
62 Ga0157372_10109170 3300013307 Bacteria 3168
63 Ga0157372_10167841 3300013307 Bacteria 2538
64 Ga0157372_10254602 3300013307 Unclassified 2038
65 Ga0157372_11545133 3300013307 Bacteria 764
66 Ga0206356_10150742 3300020070 Bacteria 3555
67 Ga0206354_10202118 3300020081 Unclassified 1652
68 Ga0206354_11143875 3300020081 Bacteria 1264
69 Ga0206353_11861837 3300020082 Bacteria 2607
70 Ga0213876_10229015 3300021384 Bacteria 988
71 Ga0207654_10146690 3300025911 Bacteria 1510
72 Ga0207707_10017189 3300025912 Bacteria 6305
73 Ga0207707_10082799 3300025912 Unclassified 2801
74 Ga0207695_10116989 3300025913 Bacteria 2639
75 Ga0207657_10005129 3300025919 Bacteria 13727
76 Ga0207657_10030136 3300025919 Bacteria 4929
77 Ga0207649_10332136 3300025920 Unclassified 1120
78 Ga0207652_10227457 3300025921 Bacteria 1681
79 Ga0207646_10004975 3300025922 Bacteria 14201
80 Ga0207694_10183167 3300025924 Unclassified 1699
81 Ga0207690_10181460 3300025932 Bacteria 1585
82 Ga0207661_10067008 3300025944 Bacteria 2918
83 Ga0207667_10049597 3300025949 Bacteria 4433
84 Ga0207667_10101797 3300025949 Bacteria 2963
85 Ga0207667_10181528 3300025949 Unclassified 2161
86 Ga0207667_10211450 3300025949 Bacteria 1988
87 Ga0207658_10004795 3300025986 Bacteria 9360
88 Ga0207703_10158250 3300026035 Bacteria 1982
89 Ga0207639_10411884 3300026041 Unclassified 1220
90 Ga0207674_10004721 3300026116 Bacteria 16335
91 Ga0207674_10054833 3300026116 Bacteria 4056
92 Ga0207698_10029075 3300026142 Bacteria 3952
93 Ga0268266_10072502 3300028379 Bacteria 2987
94 Ga0265338_10064047 3300028800 Bacteria 3201
95 Ga0307405_10163480 3300031731 Bacteria 1580
96 Ga0373943_0034784 3300035170 Bacteria 2405
97 Ga0373943_0183837 3300035170 Bacteria 1150
98 Ga0373935_0057293 3300035692 Bacteria 2486
99 Ga0373947_0060612 3300035725 Bacteria 2298
100 Ga0373937_0494435 3300036401 Unclassified 1162
101 Ga0395899_0003564 3300037312 Bacteria 12326
102 Ga0395899_0025165 3300037312 Bacteria 4495
103 Ga0395899_0042385 3300037312 Bacteria 3398
104 Ga0395899_0161385 3300037312 Bacteria 1583
105 Ga0395900_0024495 3300037418 Bacteria 6180
106 Ga0395900_0024884 3300037418 Bacteria 6127
107 Ga0395900_0025419 3300037418 Bacteria 6062
108 Ga0395900_0027117 3300037418 Bacteria 5865
109 Ga0395900_0115772 3300037418 Bacteria 2751
110 Ga0395898_0025809 3300037466 Bacteria 5917
111 Ga0395898_0043182 3300037466 Bacteria 4443
112 Ga0395905_0010364 3300037471 Bacteria 9074
113 Ga0395905_0018209 3300037471 Bacteria 6667
114 Ga0395905_0067916 3300037471 Bacteria 3339
115 Ga0395905_0442564 3300037471 Unclassified 1197
116 Ga0395901_0009240 3300038443 Bacteria 9991
117 Ga0395901_0024846 3300038443 Bacteria 6149
118 Ga0395901_0033884 3300038443 Bacteria 5274
119 Ga0395901_0036006 3300038443 Bacteria 5114
120 Ga0395901_0067325 3300038443 Bacteria 3729
121 Ga0395901_0164737 3300038443 Bacteria 2328
122 Ga0395901_0383645 3300038443 Bacteria 1446
123 Ga0436365_0890932 3300039437 Bacteria 961
124 Ga0466965_0141714 3300044683 Bacteria 1252
125 Ga0466961_0003920 3300044693 Bacteria 9308
126 Ga0466963_0003559 3300044694 Bacteria 8949
127 Ga0466963_0007724 3300044694 Bacteria 6426
128 Ga0466963_0195499 3300044694 Bacteria 1414
129 Ga0466964_0001534 3300044706 Bacteria 7945
130 Ga0466971_0000469 3300044719 Bacteria 15840
131 Ga0466971_0043932 3300044719 Bacteria 2007
132 Ga0466968_0023960 3300044735 Bacteria 2491
133 Ga0466968_0196379 3300044735 Unclassified 943
134 Ga0466957_0013233 3300044842 Bacteria 4785
135 Ga0466959_0007042 3300045049 Bacteria 7859
136 Ga0466959_0018160 3300045049 Bacteria 5162
137 Ga0466959_0037088 3300045049 Bacteria 3601
138 Ga0466958_0003237 3300045836 Bacteria 8407
139 Ga0466958_0181870 3300045836 Bacteria 1334
140 Ga0466967_0004759 3300045976 Bacteria 9241
141 Ga0466967_0005890 3300045976 Bacteria 8586
142 Ga0466967_0006213 3300045976 Bacteria 8418
143 Ga0466967_0060145 3300045976 Bacteria 3365
144 Ga0466967_0124168 3300045976 Bacteria 2389
145 Ga0466967_0132200 3300045976 Bacteria 2318
146 Ga0466967_0154683 3300045976 Bacteria 2147
147 Ga0466967_0163237 3300045976 Bacteria 2092
148 Ga0495603_0011120 3300046455 Bacteria 5456
149 Ga0495641_0009615 3300046461 Bacteria 5723
150 Ga0495641_0121849 3300046461 Unclassified 1163
151 Ga0495580_0128682 3300046472 Bacteria 1757
152 Ga0495582_0117932 3300046473 Bacteria 1494
153 Ga0495639_0004366 3300046475 Bacteria 6061
154 Ga0495584_0256637 3300046491 Unclassified 889
155 Ga0495630_0041085 3300046517 Bacteria 3454
156 Ga0495652_0379927 3300046529 Unclassified 1005
157 Ga0495665_0037759 3300046531 Bacteria 2577
158 Ga0495667_0188130 3300046559 Bacteria 1324
159 Ga0495634_0028664 3300046642 Unclassified 3863
160 Ga0495635_0267099 3300046663 Bacteria 1151
161 Ga0495588_0076170 3300046674 Bacteria 1748
162 Ga0495657_0251097 3300046675 Unclassified 1065
163 Ga0495658_0002674 3300046683 Bacteria 8971
164 Ga0495658_0388562 3300046683 Unclassified 889
165 Ga0495674_0083581 3300047319 Unclassified 2736
166 Ga0495676_0019822 3300047321 Bacteria 5911
167 Ga0495676_0089519 3300047321 Bacteria 2306
168 Ga0495680_0032210 3300047322 Bacteria 4259
169 Ga0495614_0021467 3300048089 Bacteria 2789
170 Ga0496100_0012306 3300048903 Bacteria 4901
171 Ga0496101_0026973 3300048904 Bacteria 3995
172 Ga0496104_0452154 3300048907 Bacteria 1196
173 Ga0496105_0137618 3300048908 Bacteria 2011
174 Ga0496106_0073772 3300048909 Bacteria 2611
175 Ga0496107_0058620 3300048910 Bacteria 2784
176 Ga0496109_0065429 3300048912 Bacteria 3328
177 Ga0501047_0072970 3300049581 Bacteria 3304
178 Ga0501067_0001127 3300049583 Bacteria 14464
179 Ga0501079_0519360 3300049741 Bacteria 936
180 nmdc:mga05p37_103298_c1 3300050507 Bacteria 3508
181 nmdc:mga06r32_214538_c1 3300050510 Bacteria 1219
182 nmdc:mga08y16_114230_c1 3300050511 Bacteria 2811
183 nmdc:mga08y16_320011_c1 3300050511 Bacteria 1597
184 nmdc:mga0n895_189705_c1 3300050512 Bacteria 2086
185 Ga0495612_0084490 3300053078 Bacteria 1337
186 Ga0495595_0081804 3300053084 Bacteria 1539
187 Ga0466962_0003629 3300061719 Bacteria 7359
188 Ga0530510_0009672 3300061734 Bacteria 6766
189 Ga0495651_0190716
190 Ga0070658_10036571
191 Ga0070658_10511222
192 Ga0070683_100037582
193 Ga0070683_100153405
194 Ga0070682_100421018
195 Ga0070660_100015912
196 Ga0070660_100148586
197 Ga0070660_100166307
198 Ga0070661_100040189
199 Ga0070661_100326370
200 Ga0070659_100003771
201 Ga0070659_100042127
202 Ga0070659_100141754
203 Ga0070667_100008415
204 Ga0070681_10015700
205 Ga0070681_10275245
206 Ga0070707_100001094
207 Ga0070679_100023086
208 Ga0070679_100050172
209 Ga0070679_100082883
210 Ga0070679_100172249
211 Ga0070679_100265730
212 Ga0070684_100148510
213 Ga0070697_100136011
214 Ga0068853_100101626
215 Ga0068853_100453969
216 Ga0070696_100014317
217 Ga0070665_100007548
218 Ga0068855_100088984
219 Ga0068855_100112215
220 Ga0068855_100209553
221 Ga0068857_100011411
222 Ga0068856_100391955
223 Ga0068852_100014317
224 Ga0068852_100506960
225 Ga0068858_100148308
226 Ga0081539_10057219
227 Ga0075431_100377053
228 Ga0075434_100262237
229 Ga0105240_10051622
230 Ga0111539_10008138
231 Ga0111539_10266342
232 Ga0114129_10077258
233 Ga0105241_10383439
234 Ga0105237_10037076
235 Ga0105237_10418327
236 Ga0105238_10040827
237 Ga0105238_10107844
238 Ga0105238_10747692
239 Ga0105239_10027377
240 Ga0105239_10051511
241 Ga0157370_10013920
242 Ga0157370_10021781
243 Ga0157370_10027545
244 Ga0157370_10089902
245 Ga0157369_10010672
246 Ga0157369_10084027
247 Ga0157369_10097700
248 Ga0157369_10665755
249 Ga0157374_10266775
250 Ga0157372_10109170
251 Ga0157372_10167841
252 Ga0157372_10254602
253 Ga0157372_11545133
254 Ga0206356_10150742
255 Ga0206354_10202118
256 Ga0206354_11143875
257 Ga0206353_11861837
258 Ga0213876_10229015
259 Ga0207654_10146690
260 Ga0207707_10017189
261 Ga0207707_10082799
262 Ga0207695_10116989
263 Ga0207657_10005129
264 Ga0207657_10030136
265 Ga0207649_10332136
266 Ga0207652_10227457
267 Ga0207646_10004975
268 Ga0207694_10183167
269 Ga0207690_10181460
270 Ga0207661_10067008
271 Ga0207667_10049597
272 Ga0207667_10101797
273 Ga0207667_10181528
274 Ga0207667_10211450
275 Ga0207658_10004795
276 Ga0207703_10158250
277 Ga0207639_10411884
278 Ga0207674_10004721
279 Ga0207674_10054833
280 Ga0207698_10029075
281 Ga0268266_10072502
282 Ga0265338_10064047
283 Ga0307405_10163480
284 Ga0373943_0034784
285 Ga0373943_0183837
286 Ga0373935_0057293
287 Ga0373947_0060612
288 Ga0373937_0494435
289 Ga0395899_0003564
290 Ga0395899_0025165
291 Ga0395899_0042385
292 Ga0395899_0161385
293 Ga0395900_0024495
294 Ga0395900_0024884
295 Ga0395900_0025419
296 Ga0395900_0027117
297 Ga0395900_0115772
298 Ga0395898_0025809
299 Ga0395898_0043182
300 Ga0395905_0010364
301 Ga0395905_0018209
302 Ga0395905_0067916
303 Ga0395905_0442564
304 Ga0395901_0009240
305 Ga0395901_0024846
306 Ga0395901_0033884
307 Ga0395901_0036006
308 Ga0395901_0067325
309 Ga0395901_0164737
310 Ga0395901_0383645
311 Ga0436365_0890932
312 Ga0466965_0141714
313 Ga0466961_0003920
314 Ga0466963_0003559
315 Ga0466963_0007724
316 Ga0466963_0195499
317 Ga0466964_0001534
318 Ga0466971_0000469
319 Ga0466971_0043932
320 Ga0466968_0023960
321 Ga0466968_0196379
322 Ga0466957_0013233
323 Ga0466959_0007042
324 Ga0466959_0018160
325 Ga0466959_0037088
326 Ga0466958_0003237
327 Ga0466958_0181870
328 Ga0466967_0004759
329 Ga0466967_0005890
330 Ga0466967_0006213
331 Ga0466967_0060145
332 Ga0466967_0124168
333 Ga0466967_0132200
334 Ga0466967_0154683
335 Ga0466967_0163237
336 Ga0495603_0011120
337 Ga0495641_0009615
338 Ga0495641_0121849
339 Ga0495580_0128682
340 Ga0495582_0117932
341 Ga0495639_0004366
342 Ga0495584_0256637
343 Ga0495630_0041085
344 Ga0495652_0379927
345 Ga0495665_0037759
346 Ga0495667_0188130
347 Ga0495634_0028664
348 Ga0495635_0267099
349 Ga0495588_0076170
350 Ga0495657_0251097
351 Ga0495658_0002674
352 Ga0495658_0388562
353 Ga0495674_0083581
354 Ga0495676_0019822
355 Ga0495676_0089519
356 Ga0495680_0032210
357 Ga0495614_0021467
358 Ga0496100_0012306
359 Ga0496101_0026973
360 Ga0496104_0452154
361 Ga0496105_0137618
362 Ga0496106_0073772
363 Ga0496107_0058620
364 Ga0496109_0065429
365 Ga0501047_0072970
366 Ga0501067_0001127
367 Ga0501079_0519360
368 nmdc:mga05p37_103298_c1
369 nmdc:mga06r32_214538_c1
370 nmdc:mga08y16_114230_c1
371 nmdc:mga08y16_320011_c1
372 nmdc:mga0n895_189705_c1
373 Ga0495612_0084490
374 Ga0495595_0081804
375 Ga0466962_0003629
376 Ga0530510_0009672

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02358

Trehalose_PPase

Trehalose-phosphatase

51

138

0.92

PF02358

Trehalose_PPase

Trehalose-phosphatase

136

255

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvx-assembly1.cif.gz_A structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (otsb2) from mycobacterium tuberculosis 0.8497 26 247
1u02-assembly1.cif.gz_A crystal structure of trehalose-6-phosphate phosphatase related protein 0.7981 28 246
5dx9-assembly1.cif.gz_A structure of trehalose-6-phosphate phosphatase from cryptococcus neoformans 0.7815 14 246
6rcz-assembly2.cif.gz_E the structure of burkholderia pseudomallei trehalose-6-phosphatase 0.7648 23 247
5gvx-assembly1.cif.gz_A structural insight into dephosphorylation by trehalose 6-phosphate phosphatase (otsb2) from mycobacterium tuberculosis 0.7628 26 247
ID Description Score Start End Superfamily
af_A0A0R4J4X4_114_199_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9701 28 93 3.40.50.1000
af_Q67XC9_113_209_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9674 28 93 3.40.50.1000
af_C9QPE7_53_137_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9197 28 95 3.40.50.1000
af_Q9C9S4_119_361_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8331 29 245 3.40.50.1000
af_Q9VM18_31_111_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8327 28 95 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A7W1MY92-F1-model_v4 Trehalose-phosphate phosphatase (Trehalose-6-phosphate phosphatase) 0.9834 17 93 GO:0004805
GO:0005992
AF-A0A7Y5XUG2-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9765 10 209 GO:0004805
GO:0005992
GO:0046872
AF-A0A7W1N591-F1-model_v4 Trehalose-phosphatase 0.9732 168 248
AF-A0A7Y5XUG2-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9718 10 209 GO:0004805
GO:0005992
GO:0046872
AF-A0A7V9HR43-F1-model_v4 Trehalose-phosphate phosphatase (Trehalose-6-phosphate phosphatase) 0.9633 17 93 GO:0004805
GO:0005992

Map