F289811

General Info

Members Datasets Scaffolds Average Seq Length
188 156 376 430

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0119309|Ga0495592_0119309_272_1765
Length 475
Sequence LWTATLYRVNPVAQPSSEPTEPPAPSGLSEPSLRQDSARRRHDREILALAVPAFGALVAEPLFVMADSAVVGHLGTAQLAGLGVAAALLTTAVNIFVFLAYATTAAVARRVGAGDLPAALRQGIDGIWLALLLGALVIAVVLPAAPGIVHLCGASPTAAPYAVTYLRISALGIPAMLVVLAATGVLRGFQDTRTPLLVAVAGFTANAGLNVTLVYGAGLGIAGSAWGTVIAQNGMAAVYLWVVVRGAARHARQARRIQPGAAYGDGKGSVGRADVWALLRPDAAGIRACARAGVPLLVRTVSLRAILVIATAVAAGLGDTEIAAHQITLTVWSLLAFALDAIAIAGQAIIGRYLGADDPEGARAACRRMIQWGVSDPAVQQALSAALIVVAVCQPVSGVVFVLDGVLMGAGDGPYLAWSMLVTLVVFAPAAFAVPALGAGLTALWWAMTLMMLTRLAALWLRARSGRWLVTGAAR

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
16 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
25 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
26 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
27 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
28 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
29 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
30 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
31 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
32 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
33 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
34 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
35 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
36 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
37 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
38 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
39 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
40 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
41 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
45 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
46 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
47 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
48 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
49 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
50 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
51 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
55 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
59 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
60 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
61 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
62 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
63 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
64 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
65 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
66 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
67 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
68 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
69 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
70 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
71 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
72 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
73 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
74 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
75 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
76 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
77 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
78 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
79 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
80 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
81 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
82 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
83 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
84 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
85 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
89 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
91 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
99 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
100 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
101 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
102 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
103 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
106 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
107 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
108 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
109 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
110 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
111 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
112 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
113 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
114 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
115 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
116 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
117 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
118 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
119 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
120 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
121 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
124 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
125 2643221575 Microbacterium sp. Root61 Isolate Unclassified
126 2643221647 Streptomyces sp. Root369 Isolate Unclassified
127 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
128 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
129 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
130 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
131 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
132 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
133 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
134 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
135 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
136 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
137 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
138 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
139 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
140 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
141 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
142 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
143 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
144 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
145 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
146 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
147 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
148 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
149 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
150 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
151 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
152 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
153 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
154 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
155 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
156 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 82.45
Metatranscriptomes 0
Isolates 17.55

Biome Distribution

Category Percentage (%)
Aerial Root 1.6
Bulb 0
Endosphere 6.91
Nodule 0
Rhizoplane 0
Rhizosphere 74.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0119309 3300046454 Bacteria 1857
2 JGI24737J22298_10016117 3300001990 Bacteria 2413
3 Ga0070667_100088596 3300005367 Bacteria 2658
4 Ga0070709_10043383 3300005434 Bacteria 2781
5 Ga0070714_100000529 3300005435 Bacteria 27614
6 Ga0070714_100009514 3300005435 Bacteria 7644
7 Ga0070714_100150478 3300005435 Bacteria 2097
8 Ga0070713_100008284 3300005436 Bacteria 7370
9 Ga0070700_100014578 3300005441 Bacteria 4440
10 Ga0070708_100010880 3300005445 Bacteria 7390
11 Ga0070685_10104414 3300005466 Bacteria 1735
12 Ga0070699_100117541 3300005518 Bacteria 2337
13 Ga0070717_10027542 3300006028 Bacteria 4543
14 Ga0075363_100008811 3300006048 Bacteria 4718
15 Ga0070712_100168878 3300006175 Bacteria 1696
16 Ga0075367_10000477 3300006178 Bacteria 14983
17 Ga0075433_10040650 3300006852 Bacteria 4026
18 Ga0075434_100055160 3300006871 Bacteria 3949
19 Ga0075436_100022043 3300006914 Bacteria 4374
20 Ga0075435_100004081 3300007076 Bacteria 9995
21 Ga0114129_10022089 3300009147 Bacteria 9029
22 Ga0207693_10171987 3300025915 Bacteria 1706
23 Ga0207700_10007703 3300025928 Bacteria 6613
24 Ga0207664_10031500 3300025929 Bacteria 4058
25 Ga0207664_10145435 3300025929 Bacteria 2009
26 Ga0207708_10039340 3300026075 Bacteria 3603
27 Ga0307517_10011673 3300028786 Bacteria 12155
28 Ga0307515_10196090 3300028794 Bacteria 1911
29 Ga0307511_10000329 3300030521 Bacteria 50299
30 Ga0307512_10099613 3300030522 Bacteria 1976
31 Ga0307509_10096759 3300031507 Bacteria 3002
32 Ga0307509_10122731 3300031507 Bacteria 2572
33 Ga0307508_10068498 3300031616 Bacteria 3119
34 Ga0307514_10004638 3300031649 Bacteria 12601
35 Ga0316576_10012423 3300031727 Bacteria 5624
36 Ga0316576_10030830 3300031727 Bacteria 3800
37 Ga0316578_10006615 3300031728 Bacteria 5741
38 Ga0307507_10000140 3300033179 Bacteria 125574
39 Ga0373934_0011258 3300035086 Bacteria 3366
40 Ga0373956_0018434 3300035119 Bacteria 2956
41 Ga0373955_0053191 3300035172 Bacteria 2210
42 Ga0316574_0055878 3300035398 Bacteria 2468
43 Ga0373933_0054805 3300035724 Bacteria 2390
44 Ga0373937_0008875 3300036401 Bacteria 8727
45 Ga0316584_0003701 3300036712 Bacteria 10004
46 Ga0316584_0115559 3300036712 Bacteria 2007
47 Ga0373925_0008107 3300037068 Bacteria 7650
48 Ga0395900_0198752 3300037418 Bacteria 2030
49 Ga0395898_0051698 3300037466 Bacteria 4017
50 Ga0436364_1247620 3300037853 Bacteria 2778
51 Ga0395901_0021293 3300038443 Bacteria 6641
52 Ga0451833_1033859 3300041491 Bacteria 4831
53 Ga0451837_0797465 3300041494 Bacteria 4034
54 Ga0439455_0003903 3300042012 Bacteria 2904
55 Ga0450903_000320 3300042138 Bacteria 10589
56 Ga0466969_0000555 3300044656 Bacteria 20517
57 Ga0466965_0103439 3300044683 Bacteria 1458
58 Ga0466961_0060361 3300044693 Bacteria 2411
59 Ga0466963_0036742 3300044694 Bacteria 3195
60 Ga0466964_0010315 3300044706 Bacteria 3524
61 Ga0466967_0015508 3300045976 Bacteria 5974
62 Ga0466967_0037428 3300045976 Bacteria 4152
63 Ga0466967_0080541 3300045976 Bacteria 2939
64 Ga0495603_0023635 3300046455 Bacteria 3717
65 Ga0495629_0029540 3300046459 Bacteria 3886
66 Ga0495629_0104779 3300046459 Bacteria 1973
67 Ga0495651_0050085 3300046462 Bacteria 3223
68 Ga0495582_0010657 3300046473 Bacteria 5056
69 Ga0495585_0028413 3300046492 Bacteria 3190
70 Ga0495594_0103798 3300046499 Bacteria 1600
71 Ga0495608_0102849 3300046511 Bacteria 1841
72 Ga0495618_0037227 3300046514 Bacteria 3055
73 Ga0495618_0043511 3300046514 Bacteria 2833
74 Ga0495643_0004506 3300046522 Bacteria 9711
75 Ga0495652_0011222 3300046529 Bacteria 8111
76 Ga0495652_0019759 3300046529 Bacteria 5993
77 Ga0495640_0061550 3300046533 Bacteria 2549
78 Ga0495586_0059408 3300046535 Bacteria 2078
79 Ga0495645_0024323 3300046543 Bacteria 4394
80 Ga0495633_0026784 3300046558 Bacteria 2825
81 Ga0495634_0020140 3300046642 Bacteria 4732
82 Ga0495611_0049010 3300046648 Bacteria 1900
83 Ga0495635_0095996 3300046663 Bacteria 2026
84 Ga0495599_0093792 3300046678 Bacteria 1872
85 Ga0495623_0017184 3300046679 Bacteria 4672
86 Ga0495623_0023754 3300046679 Bacteria 3955
87 Ga0495613_0028278 3300046689 Bacteria 4169
88 Ga0495660_0012970 3300046810 Bacteria 4831
89 Ga0495604_0003204 3300047317 Bacteria 13077
90 Ga0495680_0010277 3300047322 Bacteria 8349
91 Ga0495683_0048996 3300047323 Bacteria 2117
92 Ga0495675_0020099 3300047444 Bacteria 4243
93 Ga0495685_000652 3300047447 Bacteria 10599
94 Ga0495685_028501 3300047447 Bacteria 1920
95 Ga0495685_036932 3300047447 Bacteria 1677
96 Ga0495681_0003346 3300047470 Bacteria 11154
97 Ga0495602_0116653 3300048088 Bacteria 2157
98 Ga0495602_0204777 3300048088 Bacteria 1502
99 Ga0496123_0010240 3300048926 Bacteria 8319
100 Ga0501031_0025558 3300049568 Bacteria 3851
101 Ga0501031_0064827 3300049568 Bacteria 2380
102 Ga0501032_0022886 3300049569 Bacteria 4326
103 Ga0501032_0055701 3300049569 Bacteria 2660
104 Ga0501034_0001869 3300049571 Bacteria 26715
105 Ga0501034_0003595 3300049571 Bacteria 17603
106 Ga0501034_0029947 3300049571 Bacteria 5533
107 Ga0501036_0112480 3300049572 Bacteria 2301
108 Ga0501036_0167841 3300049572 Bacteria 1849
109 Ga0501037_0124151 3300049573 Bacteria 1854
110 Ga0501038_0060399 3300049574 Bacteria 3244
111 Ga0501038_0091075 3300049574 Bacteria 2555
112 Ga0501039_0092988 3300049575 Bacteria 2350
113 Ga0501043_0048808 3300049579 Bacteria 3326
114 Ga0501043_0111337 3300049579 Bacteria 2149
115 Ga0501046_0098448 3300049580 Bacteria 2245
116 Ga0501047_0000075 3300049581 Bacteria 124995
117 Ga0501047_0001097 3300049581 Bacteria 26948
118 Ga0501047_0051105 3300049581 Bacteria 3992
119 Ga0501047_0088469 3300049581 Bacteria 2974
120 Ga0501047_0229125 3300049581 Bacteria 1712
121 Ga0501047_0299063 3300049581 Bacteria 1452
122 Ga0501048_0012002 3300049582 Bacteria 6456
123 Ga0501067_0058661 3300049583 Bacteria 2131
124 Ga0501070_0011362 3300049586 Bacteria 7524
125 Ga0501073_0136372 3300049589 Bacteria 1701
126 Ga0501076_0027723 3300049592 Bacteria 4392
127 Ga0501079_0002915 3300049741 Bacteria 12492
128 Ga0501080_0146699 3300049742 Bacteria 2181
129 Ga0501083_0005345 3300049744 Bacteria 9086
130 Ga0501083_0028459 3300049744 Bacteria 3850
131 Ga0501035_0000431 3300049822 Bacteria 47303
132 Ga0501035_0066470 3300049822 Bacteria 3199
133 Ga0501044_0073652 3300049823 Bacteria 3471
134 Ga0501044_0123750 3300049823 Bacteria 2584
135 Ga0501044_0152620 3300049823 Bacteria 2291
136 Ga0501044_0159336 3300049823 Bacteria 2235
137 Ga0501045_0152392 3300049824 Bacteria 1720
138 nmdc:mga06z11_1431_c1 3300050494 Bacteria 8870
139 nmdc:mga05p37_88765_c1 3300050507 Bacteria 3810
140 nmdc:mga0n895_9998_c1 3300050512 Bacteria 8349
141 nmdc:mga08x19_15990_c1 3300050514 Bacteria 4571
142 nmdc:mga0a205_162274_c1 3300050515 Bacteria 2131
143 Ga0495612_0004885 3300053078 Bacteria 5551
144 Ga0500583_0036801 3300053092 Bacteria 2194
145 Ga0500566_0076659 3300053094 Bacteria 1868
146 Ga0500640_041395 3300053095 Bacteria 2023
147 Ga0500560_060196 3300053107 Bacteria 1236
148 Ga0500569_018191 3300053109 Bacteria 1811
149 Ga0500614_010153 3300053123 Bacteria 2019
150 Ga0500559_0110320 3300053136 Bacteria 1274
151 Ga0500561_0001620 3300053137 Bacteria 3686
152 Ga0500634_0006806 3300053161 Bacteria 5566
153 Ga0500587_006559 3300053739 Bacteria 1539
154 Ga0501084_0007062 3300054114 Bacteria 9253
155 Ga0466962_0056528 3300061719 Bacteria 1874
156 2588107368 2585428157 Bacteria 3018951
157 2643887819 2643221575 Bacteria 4022601
158 2644262881 2643221647 Bacteria 10741251
159 2644455143 2643221681 Bacteria 3707866
160 2644539408 2643221697 Bacteria 3575694
161 2645721448 2643221961 Bacteria 3919167
162 2645724578 2643221962 Bacteria 3874254
163 2758225540 2757320536 Bacteria 3629334
164 2768642448 2767802112 Bacteria 6465194
165 2786671053 2786546132 Bacteria 10419719
166 2793975374 2791355406 Bacteria 11364898
167 2862508136 2862507626 Bacteria 9425308
168 2862709137 2862705112 Bacteria 6563286
169 2867347533 2867346516 Bacteria 7608576
170 2912761312 2912757875 Bacteria 7940295
171 2954006834 2954002825 Bacteria 9173742
172 2954385772 2954380949 Bacteria 10050426
173 2954677382 2954673503 Bacteria 9685905
174 2954686771 2954682443 Bacteria 9862841
175 2954696419 2954691527 Bacteria 10720516
176 2954705858 2954701450 Bacteria 10834262
177 2984578158 2984576629 Bacteria 4248407
178 2984593069 2984592036 Bacteria 3670284
179 2990049932 2990044586 Bacteria 6603797
180 2990090071 2990088156 Bacteria 6657676
181 2990257671 2990256926 Bacteria 4252839
182 3003003636 3002998708 Bacteria 11715108
183 3006325731 3006321560 Bacteria 8247479
184 8008485991 8008485437 Bacteria 7198341
185 8025525307 8025524527 Bacteria 7197316
186 8053951915 8053945823 Bacteria 8962862
187 8055068314 8055066027 Bacteria 9479577
188 8055178644 8055172936 Bacteria 9305943
189 Ga0495592_0119309
190 JGI24737J22298_10016117
191 Ga0070667_100088596
192 Ga0070709_10043383
193 Ga0070714_100000529
194 Ga0070714_100009514
195 Ga0070714_100150478
196 Ga0070713_100008284
197 Ga0070700_100014578
198 Ga0070708_100010880
199 Ga0070685_10104414
200 Ga0070699_100117541
201 Ga0070717_10027542
202 Ga0075363_100008811
203 Ga0070712_100168878
204 Ga0075367_10000477
205 Ga0075433_10040650
206 Ga0075434_100055160
207 Ga0075436_100022043
208 Ga0075435_100004081
209 Ga0114129_10022089
210 Ga0207693_10171987
211 Ga0207700_10007703
212 Ga0207664_10031500
213 Ga0207664_10145435
214 Ga0207708_10039340
215 Ga0307517_10011673
216 Ga0307515_10196090
217 Ga0307511_10000329
218 Ga0307512_10099613
219 Ga0307509_10096759
220 Ga0307509_10122731
221 Ga0307508_10068498
222 Ga0307514_10004638
223 Ga0316576_10012423
224 Ga0316576_10030830
225 Ga0316578_10006615
226 Ga0307507_10000140
227 Ga0373934_0011258
228 Ga0373956_0018434
229 Ga0373955_0053191
230 Ga0316574_0055878
231 Ga0373933_0054805
232 Ga0373937_0008875
233 Ga0316584_0003701
234 Ga0316584_0115559
235 Ga0373925_0008107
236 Ga0395900_0198752
237 Ga0395898_0051698
238 Ga0436364_1247620
239 Ga0395901_0021293
240 Ga0451833_1033859
241 Ga0451837_0797465
242 Ga0439455_0003903
243 Ga0450903_000320
244 Ga0466969_0000555
245 Ga0466965_0103439
246 Ga0466961_0060361
247 Ga0466963_0036742
248 Ga0466964_0010315
249 Ga0466967_0015508
250 Ga0466967_0037428
251 Ga0466967_0080541
252 Ga0495603_0023635
253 Ga0495629_0029540
254 Ga0495629_0104779
255 Ga0495651_0050085
256 Ga0495582_0010657
257 Ga0495585_0028413
258 Ga0495594_0103798
259 Ga0495608_0102849
260 Ga0495618_0037227
261 Ga0495618_0043511
262 Ga0495643_0004506
263 Ga0495652_0011222
264 Ga0495652_0019759
265 Ga0495640_0061550
266 Ga0495586_0059408
267 Ga0495645_0024323
268 Ga0495633_0026784
269 Ga0495634_0020140
270 Ga0495611_0049010
271 Ga0495635_0095996
272 Ga0495599_0093792
273 Ga0495623_0017184
274 Ga0495623_0023754
275 Ga0495613_0028278
276 Ga0495660_0012970
277 Ga0495604_0003204
278 Ga0495680_0010277
279 Ga0495683_0048996
280 Ga0495675_0020099
281 Ga0495685_000652
282 Ga0495685_028501
283 Ga0495685_036932
284 Ga0495681_0003346
285 Ga0495602_0116653
286 Ga0495602_0204777
287 Ga0496123_0010240
288 Ga0501031_0025558
289 Ga0501031_0064827
290 Ga0501032_0022886
291 Ga0501032_0055701
292 Ga0501034_0001869
293 Ga0501034_0003595
294 Ga0501034_0029947
295 Ga0501036_0112480
296 Ga0501036_0167841
297 Ga0501037_0124151
298 Ga0501038_0060399
299 Ga0501038_0091075
300 Ga0501039_0092988
301 Ga0501043_0048808
302 Ga0501043_0111337
303 Ga0501046_0098448
304 Ga0501047_0000075
305 Ga0501047_0001097
306 Ga0501047_0051105
307 Ga0501047_0088469
308 Ga0501047_0229125
309 Ga0501047_0299063
310 Ga0501048_0012002
311 Ga0501067_0058661
312 Ga0501070_0011362
313 Ga0501073_0136372
314 Ga0501076_0027723
315 Ga0501079_0002915
316 Ga0501080_0146699
317 Ga0501083_0005345
318 Ga0501083_0028459
319 Ga0501035_0000431
320 Ga0501035_0066470
321 Ga0501044_0073652
322 Ga0501044_0123750
323 Ga0501044_0152620
324 Ga0501044_0159336
325 Ga0501045_0152392
326 nmdc:mga06z11_1431_c1
327 nmdc:mga05p37_88765_c1
328 nmdc:mga0n895_9998_c1
329 nmdc:mga08x19_15990_c1
330 nmdc:mga0a205_162274_c1
331 Ga0495612_0004885
332 Ga0500583_0036801
333 Ga0500566_0076659
334 Ga0500640_041395
335 Ga0500560_060196
336 Ga0500569_018191
337 Ga0500614_010153
338 Ga0500559_0110320
339 Ga0500561_0001620
340 Ga0500634_0006806
341 Ga0500587_006559
342 Ga0501084_0007062
343 Ga0466962_0056528
344 2588107368
345 2643887819
346 2644262881
347 2644455143
348 2644539408
349 2645721448
350 2645724578
351 2758225540
352 2768642448
353 2786671053
354 2793975374
355 2862508136
356 2862709137
357 2867347533
358 2912761312
359 2954006834
360 2954385772
361 2954677382
362 2954686771
363 2954696419
364 2954705858
365 2984578158
366 2984593069
367 2990049932
368 2990090071
369 2990257671
370 3003003636
371 3006325731
372 8008485991
373 8025525307
374 8053951915
375 8055068314
376 8055178644

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01554

MatE

MatE

52

212

0.98

PF14667

Polysacc_synt_C

Polysaccharide biosynthesis C-terminal domain

165

263

0.91

PF01554

MatE

MatE

295

375

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7php-assembly1.cif.gz_A structure of multidrug and toxin compound extrusion (mate) transporter norm by nabfab-fiducial assisted cryo-em 0.9427 12 435
6fv8-assembly1.cif.gz_B dimer structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9242 5 438
6z70-assembly1.cif.gz_A structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9185 3 438
6fv6-assembly1.cif.gz_A monomer structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.9183 19 437
6fv7-assembly1.cif.gz_B dimer structure of the mate family multidrug resistance transporter aq_128 from aquifex aeolicus in the outward-facing state 0.917 19 438
ID Description Score Start End Superfamily
af_Q9SVE7_354_513_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9789 245 396 1.20.1250.20
af_P71616_19_179_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9783 26 182 1.20.1250.20
af_P71616_238_398_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9763 245 400 1.20.1250.20
af_K7M452_350_510_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9702 245 396 1.20.1250.20
af_Q5ACZ4_387_544_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9572 247 400 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1E7JWR5-F1-model_v4 MATE family efflux transporter 0.9996 9 445 GO:0005886
GO:0015297
GO:0042910
AF-A0A2U8V949-F1-model_v4 deleted 0.9992 1 445
AF-A0A3R9WIB6-F1-model_v4 deleted 0.9987 24 445
AF-A0A542HQE5-F1-model_v4 Putative MATE family efflux protein 0.9984 1 445 GO:0005886
GO:0015297
GO:0042910
AF-A0A221NZM6-F1-model_v4 MATE family efflux transporter 0.9984 1 445 GO:0005886
GO:0015297
GO:0042910

Map