F289740

General Info

Members Datasets Scaffolds Average Seq Length
188 117 188 124

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_3939404|Ga0451853_3939404_376_771
Length 131
Sequence LRVVTSAEDAKTLIEIAVERFIEEVPALAPLKLVFGVELRGRGDVQMYRVELFGKDQEMQVTKGIAEDARVRVQMPRSFFNVMAKEAHIADWREAFTYGQAKATGVDQILKLIVHVVEKQEERLRTRRARS

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
66 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
67 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
68 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
69 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
70 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
71 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
72 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
76 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
86 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
87 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
88 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
89 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
93 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
94 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
95 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
96 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
97 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
100 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
108 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
112 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
113 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
114 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
115 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
116 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
117 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 2.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 6.91
Rhizosphere 88.3
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100071482 3300005339 Bacteria 2709
2 Ga0070671_100612028 3300005355 Bacteria 942
3 Ga0070709_10178827 3300005434 Bacteria 1488
4 Ga0070709_10361047 3300005434 Bacteria 1076
5 Ga0070709_10500768 3300005434 Bacteria 923
6 Ga0070709_10788039 3300005434 Bacteria 745
7 Ga0070709_10798348 3300005434 Bacteria 741
8 Ga0070714_100304748 3300005435 Bacteria 1486
9 Ga0070714_100734321 3300005435 Bacteria 954
10 Ga0070714_100952145 3300005435 Unclassified 835
11 Ga0070714_102191382 3300005435 Bacteria 538
12 Ga0070713_100304618 3300005436 Bacteria 1468
13 Ga0070710_10158743 3300005437 Bacteria 1401
14 Ga0070710_10732027 3300005437 Bacteria 701
15 Ga0070711_100049447 3300005439 Bacteria 2880
16 Ga0070711_100252244 3300005439 Bacteria 1385
17 Ga0070711_100275748 3300005439 Bacteria 1328
18 Ga0070711_100439147 3300005439 Bacteria 1066
19 Ga0068867_100552994 3300005459 Bacteria 997
20 Ga0070707_100409200 3300005468 Bacteria 1317
21 Ga0070698_101882625 3300005471 Bacteria 551
22 Ga0070679_102067688 3300005530 Bacteria 519
23 Ga0070697_100450634 3300005536 Bacteria 1121
24 Ga0070696_101764546 3300005546 Unclassified 534
25 Ga0068856_101764387 3300005614 Bacteria 631
26 Ga0068861_100449088 3300005719 Bacteria 1155
27 Ga0081455_10222159 3300005937 Unclassified 1399
28 Ga0070717_10314725 3300006028 Bacteria 1394
29 Ga0070717_10414811 3300006028 Bacteria 1211
30 Ga0070717_10720024 3300006028 Bacteria 907
31 Ga0070717_11473150 3300006028 Bacteria 618
32 Ga0070717_11632844 3300006028 Unclassified 584
33 Ga0075365_10313196 3300006038 Bacteria 1105
34 Ga0070716_100652983 3300006173 Bacteria 798
35 Ga0070716_101270739 3300006173 Bacteria 594
36 Ga0070712_100026266 3300006175 Bacteria 3877
37 Ga0070712_100037947 3300006175 Bacteria 3288
38 Ga0070712_100382459 3300006175 Bacteria 1159
39 Ga0070712_100429262 3300006175 Bacteria 1097
40 Ga0075367_10891843 3300006178 Bacteria 567
41 Ga0075430_100017320 3300006846 Bacteria 6136
42 Ga0075434_102028550 3300006871 Bacteria 580
43 Ga0075435_100600973 3300007076 Unclassified 954
44 Ga0105240_10062140 3300009093 Bacteria 4651
45 Ga0105241_10966368 3300009174 Bacteria 795
46 Ga0105241_11160440 3300009174 Bacteria 730
47 Ga0105237_10008839 3300009545 Bacteria 10859
48 Ga0105237_10638166 3300009545 Bacteria 1072
49 Ga0157378_11227561 3300013297 Bacteria 790
50 Ga0157378_11574410 3300013297 Unclassified 703
51 Ga0157372_11232742 3300013307 Bacteria 864
52 Ga0206354_10462400 3300020081 Bacteria 503
53 Ga0206354_10890221 3300020081 Bacteria 1144
54 Ga0206353_11402535 3300020082 Bacteria 681
55 Ga0206353_11465217 3300020082 Bacteria 788
56 Ga0207685_10159181 3300025905 Bacteria 1029
57 Ga0207699_10164409 3300025906 Bacteria 1480
58 Ga0207699_10696090 3300025906 Bacteria 744
59 Ga0207699_11367264 3300025906 Unclassified 524
60 Ga0207695_10020069 3300025913 Bacteria 7667
61 Ga0207671_10001682 3300025914 Bacteria 25096
62 Ga0207693_10074923 3300025915 Bacteria 2650
63 Ga0207693_10108580 3300025915 Bacteria 2177
64 Ga0207693_10224546 3300025915 Bacteria 1475
65 Ga0207693_10225074 3300025915 Bacteria 1473
66 Ga0207693_10245813 3300025915 Bacteria 1404
67 Ga0207693_10340199 3300025915 Bacteria 1174
68 Ga0207663_10000560 3300025916 Bacteria 16421
69 Ga0207663_10392035 3300025916 Bacteria 1060
70 Ga0207663_10972424 3300025916 Archaea 680
71 Ga0207663_10979762 3300025916 Bacteria 678
72 Ga0207657_10036702 3300025919 Bacteria 4384
73 Ga0207646_10656490 3300025922 Bacteria 939
74 Ga0207700_11126251 3300025928 Bacteria 701
75 Ga0207700_11214156 3300025928 Bacteria 673
76 Ga0207664_10275300 3300025929 Bacteria 1476
77 Ga0207644_10870086 3300025931 Bacteria 755
78 Ga0207686_11284314 3300025934 Unclassified 601
79 Ga0207704_10693208 3300025938 Unclassified 843
80 Ga0207665_10162453 3300025939 Bacteria 1607
81 Ga0207665_10429394 3300025939 Bacteria 1011
82 Ga0207665_10500154 3300025939 Bacteria 939
83 Ga0207665_10637462 3300025939 Bacteria 834
84 Ga0207640_10376994 3300025981 Unclassified 1148
85 Ga0207702_11124760 3300026078 Bacteria 779
86 Ga0265337_1007269 3300028556 Bacteria 4156
87 Ga0265326_10000848 3300028558 Bacteria 11180
88 Ga0265326_10154573 3300028558 Bacteria 655
89 Ga0265319_1000088 3300028563 Bacteria 71590
90 Ga0265319_1000109 3300028563 Bacteria 63717
91 Ga0265319_1119754 3300028563 Bacteria 820
92 Ga0265318_10043496 3300028577 Bacteria 1701
93 Ga0265322_10067941 3300028654 Bacteria 1011
94 Ga0265322_10150873 3300028654 Bacteria 664
95 Ga0265336_10000060 3300028666 Bacteria 103055
96 Ga0265336_10013651 3300028666 Bacteria 2705
97 Ga0265338_10000234 3300028800 Bacteria 103028
98 Ga0265338_10071609 3300028800 Bacteria 2965
99 Ga0265338_10198142 3300028800 Bacteria 1516
100 Ga0265324_10025297 3300029957 Bacteria 2104
101 Ga0265324_10146153 3300029957 Bacteria 803
102 Ga0265320_10002605 3300031240 Bacteria 12528
103 Ga0265320_10027351 3300031240 Bacteria 2975
104 Ga0265320_10061389 3300031240 Bacteria 1792
105 Ga0265320_10146523 3300031240 Bacteria 1067
106 Ga0265340_10000014 3300031247 Bacteria 103055
107 Ga0265339_10096793 3300031249 Bacteria 1540
108 Ga0265339_10179327 3300031249 Bacteria 1056
109 Ga0265327_10049748 3300031251 Bacteria 2197
110 Ga0265327_10053932 3300031251 Bacteria 2083
111 Ga0265327_10383617 3300031251 Bacteria 611
112 Ga0265316_10015946 3300031344 Bacteria 6541
113 Ga0265316_10341457 3300031344 Bacteria 1085
114 Ga0265313_10203678 3300031595 Bacteria 822
115 Ga0265314_10021969 3300031711 Bacteria 4894
116 Ga0265342_10089182 3300031712 Bacteria 1770
117 Ga0307409_100715926 3300031995 Bacteria 1002
118 Ga0373927_0419812 3300035695 Bacteria 883
119 Ga0373937_0879507 3300036401 Bacteria 845
120 Ga0373925_0304277 3300037068 Bacteria 1288
121 Ga0436363_0110983 3300039450 Unclassified 533
122 Ga0436363_0814969 3300039450 Bacteria 611
123 Ga0436363_1102101 3300039450 Unclassified 1596
124 Ga0451833_0106145 3300041491 Bacteria 1853
125 Ga0451853_3939404 3300041512 Bacteria 1095
126 Ga0439458_0203882 3300042157 Bacteria 542
127 Ga0466972_0268400 3300044658 Bacteria 797
128 Ga0466966_0024762 3300044684 Bacteria 3926
129 Ga0466963_0167313 3300044694 Bacteria 1532
130 Ga0466957_0529594 3300044842 Bacteria 819
131 Ga0466960_0037183 3300044901 Bacteria 2283
132 Ga0466960_0046864 3300044901 Bacteria 2071
133 Ga0466960_0112431 3300044901 Bacteria 1417
134 Ga0466960_0223919 3300044901 Bacteria 1036
135 Ga0466958_0460830 3300045836 Bacteria 823
136 Ga0466967_0172689 3300045976 Bacteria 2035
137 Ga0466967_2607252 3300045976 Unclassified 500
138 Ga0495651_0185804 3300046462 Bacteria 1467
139 Ga0495653_0000183 3300046463 Bacteria 51182
140 Ga0495653_0138350 3300046463 Bacteria 1716
141 Ga0495653_0529212 3300046463 Bacteria 732
142 Ga0495580_0673413 3300046472 Bacteria 679
143 Ga0495664_0000151 3300046477 Bacteria 34848
144 Ga0495618_0000054 3300046514 Bacteria 83787
145 Ga0495630_0093680 3300046517 Bacteria 2270
146 Ga0495652_0162968 3300046529 Bacteria 1729
147 Ga0495645_0000228 3300046543 Bacteria 40598
148 Ga0495645_0000354 3300046543 Bacteria 32418
149 Ga0495634_0187542 3300046642 Bacteria 1292
150 Ga0495657_0000006 3300046675 Bacteria 250610
151 Ga0495646_0143347 3300046680 Bacteria 1334
152 Ga0495646_0269728 3300046680 Bacteria 907
153 Ga0495658_0165854 3300046683 Bacteria 1365
154 Ga0495600_0136659 3300046809 Bacteria 1592
155 Ga0495604_0000961 3300047317 Bacteria 24030
156 Ga0495676_0093573 3300047321 Bacteria 2241
157 Ga0495684_0002026 3300047471 Bacteria 16297
158 Ga0495684_0029960 3300047471 Bacteria 4178
159 Ga0495593_0577063 3300047673 Unclassified 564
160 Ga0495602_0456572 3300048088 Bacteria 901
161 Ga0496100_0000874 3300048903 Bacteria 14382
162 Ga0496101_0997592 3300048904 Bacteria 659
163 Ga0496102_0000096 3300048905 Bacteria 124941
164 Ga0496103_0000035 3300048906 Bacteria 182242
165 Ga0496103_0047147 3300048906 Bacteria 2662
166 Ga0496103_0263374 3300048906 Bacteria 1109
167 Ga0496104_0000028 3300048907 Bacteria 203377
168 Ga0496105_0102317 3300048908 Bacteria 2366
169 Ga0496105_0265557 3300048908 Bacteria 1387
170 Ga0496110_0004930 3300048913 Bacteria 10423
171 Ga0496111_0003455 3300048914 Bacteria 9771
172 Ga0496115_0000226 3300048918 Bacteria 51586
173 Ga0496115_0000298 3300048918 Bacteria 42677
174 Ga0496121_0001544 3300048924 Bacteria 38548
175 Ga0501069_0666228 3300049585 Bacteria 627
176 Ga0501076_1213377 3300049592 Bacteria 621
177 Ga0501079_0244753 3300049741 Unclassified 1401
178 Ga0501080_0043187 3300049742 Bacteria 4197
179 nmdc:mga00v17_389169_c1 3300050491 Bacteria 906
180 nmdc:mga0qj67_17896_c1 3300050509 Bacteria 5395
181 nmdc:mga0n895_207670_c1 3300050512 Bacteria 1989
182 nmdc:mga0rr50_461062_c1 3300050513 Bacteria 1078
183 Ga0495601_0002385 3300053077 Bacteria 10658
184 Ga0495601_0019677 3300053077 Bacteria 4119
185 Ga0495612_0000049 3300053078 Bacteria 54959
186 Ga0495612_0160959 3300053078 Bacteria 980
187 Ga0495612_0438817 3300053078 Bacteria 596
188 Ga0501082_1139481 3300060353 Bacteria 682

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046463 Ga0495653_0138350 Ga0495653_0138350_607_918 103
2 3300025915 Ga0207693_10340199 Ga0207693_103401992 107
3 3300039450 Ga0436363_1102101 Ga0436363_1102101_1129_1461 110
4 3300041491 Ga0451833_0106145 Ga0451833_0106145_907_1299 111
5 3300025934 Ga0207686_11284314 Ga0207686_112843142 113
6 3300005434 Ga0070709_10178827 Ga0070709_101788272 116
7 3300005437 Ga0070710_10732027 Ga0070710_107320271 116
8 3300005439 Ga0070711_100275748 Ga0070711_1002757482 116
9 3300006028 Ga0070717_11632844 Ga0070717_116328441 116
10 3300006173 Ga0070716_100652983 Ga0070716_1006529831 116
11 3300006175 Ga0070712_100382459 Ga0070712_1003824592 116
12 3300025915 Ga0207693_10225074 Ga0207693_102250742 117
13 3300025939 Ga0207665_10637462 Ga0207665_106374622 117
14 3300005435 Ga0070714_102191382 Ga0070714_1021913821 118
15 3300041512 Ga0451853_3939404 Ga0451853_3939404_376_771 122
16 3300044842 Ga0466957_0529594 Ga0466957_0529594_349_720 122
17 3300045836 Ga0466958_0460830 Ga0466958_0460830_376_747 122
18 3300045976 Ga0466967_0172689 Ga0466967_0172689_1253_1624 122
19 3300005355 Ga0070671_100612028 Ga0070671_1006120282 123
20 3300005434 Ga0070709_10361047 Ga0070709_103610471 123
21 3300005434 Ga0070709_10500768 Ga0070709_105007682 123
22 3300005434 Ga0070709_10788039 Ga0070709_107880392 123
23 3300005434 Ga0070709_10798348 Ga0070709_107983481 123
24 3300005435 Ga0070714_100304748 Ga0070714_1003047482 123
25 3300005435 Ga0070714_100734321 Ga0070714_1007343212 123
26 3300005435 Ga0070714_100952145 Ga0070714_1009521451 123
27 3300005436 Ga0070713_100304618 Ga0070713_1003046182 123
28 3300005437 Ga0070710_10158743 Ga0070710_101587431 123
29 3300005439 Ga0070711_100049447 Ga0070711_1000494473 123
30 3300005439 Ga0070711_100252244 Ga0070711_1002522443 123
31 3300005439 Ga0070711_100439147 Ga0070711_1004391472 123
32 3300005459 Ga0068867_100552994 Ga0068867_1005529942 123
33 3300005468 Ga0070707_100409200 Ga0070707_1004092002 123
34 3300005471 Ga0070698_101882625 Ga0070698_1018826251 123
35 3300005530 Ga0070679_102067688 Ga0070679_1020676881 123
36 3300005536 Ga0070697_100450634 Ga0070697_1004506341 123
37 3300005546 Ga0070696_101764546 Ga0070696_1017645461 123
38 3300005614 Ga0068856_101764387 Ga0068856_1017643872 123
39 3300005719 Ga0068861_100449088 Ga0068861_1004490882 123
40 3300005937 Ga0081455_10222159 Ga0081455_102221593 123
41 3300006028 Ga0070717_10314725 Ga0070717_103147254 123
42 3300006028 Ga0070717_10720024 Ga0070717_107200242 123
43 3300006028 Ga0070717_11473150 Ga0070717_114731502 123
44 3300006173 Ga0070716_101270739 Ga0070716_1012707391 123
45 3300006175 Ga0070712_100026266 Ga0070712_1000262666 123
46 3300006175 Ga0070712_100037947 Ga0070712_1000379473 123
47 3300006175 Ga0070712_100429262 Ga0070712_1004292622 123
48 3300006871 Ga0075434_102028550 Ga0075434_1020285501 123
49 3300007076 Ga0075435_100600973 Ga0075435_1006009733 123
50 3300009093 Ga0105240_10062140 Ga0105240_100621404 123
51 3300009174 Ga0105241_10966368 Ga0105241_109663681 123
52 3300009174 Ga0105241_11160440 Ga0105241_111604401 123
53 3300009545 Ga0105237_10008839 Ga0105237_100088392 123
54 3300009545 Ga0105237_10638166 Ga0105237_106381662 123
55 3300013297 Ga0157378_11227561 Ga0157378_112275612 123
56 3300013297 Ga0157378_11574410 Ga0157378_115744101 123
57 3300013307 Ga0157372_11232742 Ga0157372_112327422 123
58 3300020081 Ga0206354_10462400 Ga0206354_104624002 123
59 3300020081 Ga0206354_10890221 Ga0206354_108902212 123
60 3300020082 Ga0206353_11465217 Ga0206353_114652172 123
61 3300025905 Ga0207685_10159181 Ga0207685_101591813 123
62 3300025906 Ga0207699_10164409 Ga0207699_101644092 123
63 3300025906 Ga0207699_10696090 Ga0207699_106960903 123
64 3300025906 Ga0207699_11367264 Ga0207699_113672641 123
65 3300025913 Ga0207695_10020069 Ga0207695_100200694 123
66 3300025914 Ga0207671_10001682 Ga0207671_100016825 123
67 3300025915 Ga0207693_10074923 Ga0207693_100749232 123
68 3300025915 Ga0207693_10108580 Ga0207693_101085803 123
69 3300025915 Ga0207693_10224546 Ga0207693_102245462 123
70 3300025915 Ga0207693_10245813 Ga0207693_102458132 123
71 3300025916 Ga0207663_10000560 Ga0207663_1000056013 123
72 3300025916 Ga0207663_10392035 Ga0207663_103920353 123
73 3300025916 Ga0207663_10972424 Ga0207663_109724241 123
74 3300025916 Ga0207663_10979762 Ga0207663_109797622 123
75 3300025922 Ga0207646_10656490 Ga0207646_106564902 123
76 3300025928 Ga0207700_11126251 Ga0207700_111262512 123
77 3300025928 Ga0207700_11214156 Ga0207700_112141562 123
78 3300025929 Ga0207664_10275300 Ga0207664_102753002 123
79 3300025931 Ga0207644_10870086 Ga0207644_108700862 123
80 3300025938 Ga0207704_10693208 Ga0207704_106932082 123
81 3300025939 Ga0207665_10162453 Ga0207665_101624531 123
82 3300025939 Ga0207665_10429394 Ga0207665_104293943 123
83 3300025939 Ga0207665_10500154 Ga0207665_105001542 123
84 3300025981 Ga0207640_10376994 Ga0207640_103769942 123
85 3300026078 Ga0207702_11124760 Ga0207702_111247602 123
86 3300028556 Ga0265337_1007269 Ga0265337_10072696 123
87 3300028558 Ga0265326_10000848 Ga0265326_1000084811 123
88 3300028558 Ga0265326_10154573 Ga0265326_101545732 123
89 3300028563 Ga0265319_1000088 Ga0265319_100008840 123
90 3300028563 Ga0265319_1000109 Ga0265319_100010962 123
91 3300028654 Ga0265322_10067941 Ga0265322_100679412 123
92 3300028666 Ga0265336_10000060 Ga0265336_1000006061 123
93 3300028666 Ga0265336_10013651 Ga0265336_100136513 123
94 3300028800 Ga0265338_10000234 Ga0265338_1000023462 123
95 3300028800 Ga0265338_10071609 Ga0265338_100716093 123
96 3300029957 Ga0265324_10025297 Ga0265324_100252974 123
97 3300031240 Ga0265320_10027351 Ga0265320_100273513 123
98 3300031240 Ga0265320_10061389 Ga0265320_100613894 123
99 3300031247 Ga0265340_10000014 Ga0265340_1000001452 123
100 3300031249 Ga0265339_10096793 Ga0265339_100967932 123
101 3300031251 Ga0265327_10049748 Ga0265327_100497482 123
102 3300031251 Ga0265327_10053932 Ga0265327_100539324 123
103 3300031251 Ga0265327_10383617 Ga0265327_103836172 123
104 3300031344 Ga0265316_10341457 Ga0265316_103414574 123
105 3300031712 Ga0265342_10089182 Ga0265342_100891822 123
106 3300035695 Ga0373927_0419812 Ga0373927_0419812_54_428 123
107 3300036401 Ga0373937_0879507 Ga0373937_0879507_443_817 123
108 3300037068 Ga0373925_0304277 Ga0373925_0304277_280_654 123
109 3300039450 Ga0436363_0110983 Ga0436363_0110983_113_487 123
110 3300039450 Ga0436363_0814969 Ga0436363_0814969_161_535 123
111 3300042157 Ga0439458_0203882 Ga0439458_0203882_59_430 123
112 3300044684 Ga0466966_0024762 Ga0466966_0024762_1029_1403 123
113 3300044694 Ga0466963_0167313 Ga0466963_0167313_670_1047 123
114 3300044901 Ga0466960_0112431 Ga0466960_0112431_977_1351 123
115 3300046462 Ga0495651_0185804 Ga0495651_0185804_313_690 123
116 3300046463 Ga0495653_0000183 Ga0495653_0000183_4814_5191 123
117 3300046463 Ga0495653_0529212 Ga0495653_0529212_250_624 123
118 3300046472 Ga0495580_0673413 Ga0495580_0673413_238_612 123
119 3300046477 Ga0495664_0000151 Ga0495664_0000151_19911_20285 123
120 3300046514 Ga0495618_0000054 Ga0495618_0000054_59980_60357 123
121 3300046517 Ga0495630_0093680 Ga0495630_0093680_1778_2155 123
122 3300046529 Ga0495652_0162968 Ga0495652_0162968_240_614 123
123 3300046543 Ga0495645_0000228 Ga0495645_0000228_18203_18580 123
124 3300046543 Ga0495645_0000354 Ga0495645_0000354_3224_3595 123
125 3300046642 Ga0495634_0187542 Ga0495634_0187542_39_413 123
126 3300046675 Ga0495657_0000006 Ga0495657_0000006_190327_190704 123
127 3300046680 Ga0495646_0143347 Ga0495646_0143347_108_485 123
128 3300046680 Ga0495646_0269728 Ga0495646_0269728_111_485 123
129 3300046683 Ga0495658_0165854 Ga0495658_0165854_370_744 123
130 3300046809 Ga0495600_0136659 Ga0495600_0136659_27_401 123
131 3300047317 Ga0495604_0000961 Ga0495604_0000961_14455_14829 123
132 3300047321 Ga0495676_0093573 Ga0495676_0093573_1074_1448 123
133 3300047471 Ga0495684_0002026 Ga0495684_0002026_6185_6559 123
134 3300047471 Ga0495684_0029960 Ga0495684_0029960_2755_3132 123
135 3300047673 Ga0495593_0577063 Ga0495593_0577063_100_474 123
136 3300048088 Ga0495602_0456572 Ga0495602_0456572_205_579 123
137 3300048903 Ga0496100_0000874 Ga0496100_0000874_9893_10267 123
138 3300048904 Ga0496101_0997592 Ga0496101_0997592_223_597 123
139 3300048905 Ga0496102_0000096 Ga0496102_0000096_30264_30638 123
140 3300048906 Ga0496103_0000035 Ga0496103_0000035_30077_30451 123
141 3300048906 Ga0496103_0047147 Ga0496103_0047147_727_1101 123
142 3300048906 Ga0496103_0263374 Ga0496103_0263374_520_894 123
143 3300048907 Ga0496104_0000028 Ga0496104_0000028_40747_41124 123
144 3300048908 Ga0496105_0102317 Ga0496105_0102317_996_1373 123
145 3300048908 Ga0496105_0265557 Ga0496105_0265557_433_807 123
146 3300048913 Ga0496110_0004930 Ga0496110_0004930_980_1357 123
147 3300048914 Ga0496111_0003455 Ga0496111_0003455_8214_8591 123
148 3300048918 Ga0496115_0000226 Ga0496115_0000226_46477_46851 123
149 3300048918 Ga0496115_0000298 Ga0496115_0000298_12113_12487 123
150 3300049585 Ga0501069_0666228 Ga0501069_0666228_68_439 123
151 3300049592 Ga0501076_1213377 Ga0501076_1213377_126_497 123
152 3300050512 nmdc:mga0n895_207670_c1 nmdc:mga0n895_207670_c1_314_691 123
153 3300050513 nmdc:mga0rr50_461062_c1 nmdc:mga0rr50_461062_c1_445_822 123
154 3300053077 Ga0495601_0002385 Ga0495601_0002385_9435_9809 123
155 3300053077 Ga0495601_0019677 Ga0495601_0019677_2990_3367 123
156 3300053078 Ga0495612_0000049 Ga0495612_0000049_7987_8364 123
157 3300053078 Ga0495612_0160959 Ga0495612_0160959_253_627 123
158 3300053078 Ga0495612_0438817 Ga0495612_0438817_87_458 123
159 3300060353 Ga0501082_1139481 Ga0501082_1139481_78_449 123
160 3300005339 Ga0070660_100071482 Ga0070660_1000714823 124
161 3300006028 Ga0070717_10414811 Ga0070717_104148114 124
162 3300006038 Ga0075365_10313196 Ga0075365_103131962 124
163 3300006178 Ga0075367_10891843 Ga0075367_108918431 124
164 3300006846 Ga0075430_100017320 Ga0075430_1000173204 124
165 3300020082 Ga0206353_11402535 Ga0206353_114025352 124
166 3300025919 Ga0207657_10036702 Ga0207657_100367026 124
167 3300028563 Ga0265319_1119754 Ga0265319_11197542 124
168 3300028577 Ga0265318_10043496 Ga0265318_100434963 124
169 3300028654 Ga0265322_10150873 Ga0265322_101508731 124
170 3300028800 Ga0265338_10198142 Ga0265338_101981422 124
171 3300029957 Ga0265324_10146153 Ga0265324_101461531 124
172 3300031240 Ga0265320_10002605 Ga0265320_100026053 124
173 3300031240 Ga0265320_10146523 Ga0265320_101465232 124
174 3300031249 Ga0265339_10179327 Ga0265339_101793271 124
175 3300031344 Ga0265316_10015946 Ga0265316_100159466 124
176 3300031595 Ga0265313_10203678 Ga0265313_102036782 124
177 3300031711 Ga0265314_10021969 Ga0265314_100219694 124
178 3300031995 Ga0307409_100715926 Ga0307409_1007159262 124
179 3300044658 Ga0466972_0268400 Ga0466972_0268400_54_428 124
180 3300044901 Ga0466960_0037183 Ga0466960_0037183_71_445 124
181 3300044901 Ga0466960_0046864 Ga0466960_0046864_1015_1389 124
182 3300044901 Ga0466960_0223919 Ga0466960_0223919_583_960 124
183 3300045976 Ga0466967_2607252 Ga0466967_2607252_102_479 124
184 3300048924 Ga0496121_0001544 Ga0496121_0001544_20755_21129 124
185 3300049741 Ga0501079_0244753 Ga0501079_0244753_398_775 124
186 3300049742 Ga0501080_0043187 Ga0501080_0043187_1832_2209 124
187 3300050491 nmdc:mga00v17_389169_c1 nmdc:mga00v17_389169_c1_519_893 124
188 3300050509 nmdc:mga0qj67_17896_c1 nmdc:mga0qj67_17896_c1_3945_4319 124

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ia9-assembly1.cif.gz_B-2 spnk methyltransferase from the spinosyn biosynthetic pathway in complex with mg 0.8207 27 68
6pc0-assembly1.cif.gz_A crystal structure of helicobacter pylori ppx/gppa 0.8055 29 53
3zx2-assembly2.cif.gz_C ntpdase1 in complex with decavanadate 0.804 28 53
3zx0-assembly1.cif.gz_B ntpdase1 in complex with heptamolybdate 0.8031 28 52
4brp-assembly1.cif.gz_D legionella pneumophila ntpdase1 crystal form v (part-open) 0.7967 29 53
ID Description Score Start End Superfamily
4c23A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.81 29 55 3.30.420.40
4br9B01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8004 27 52 3.30.420.40
af_Q4CQ47_5_296_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.7993 27 55 3.30.230.10
af_X1WH23_7_262_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.793 27 53 3.30.420.40
3zx3D01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7892 26 52 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A7V9CG26-F1-model_v4 SCP2 domain-containing protein 0.9807 5 123
AF-A0A6J4T321-F1-model_v4 SCP2 domain-containing protein 0.9785 5 122
AF-A0A7W0MUA7-F1-model_v4 SCP2 domain-containing protein 0.9681 5 124
AF-A0A660L8X4-F1-model_v4 SCP-2 sterol transfer family protein 0.9501 1 123
AF-A0A7K0S2R3-F1-model_v4 SCP2 domain-containing protein 0.9498 1 124

Feature Viewer

pLDDT pTM Quality
91.76 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map