F289439

General Info

Members Datasets Scaffolds Average Seq Length
188 134 178 148

Family's Representative Sequence

Representative Sequence 3300017792|Ga0163161_11775862|Ga0163161_117758621
Length 162
Sequence MAAKDSTGVDAMEIALRIGQCLGALWTLPNTLAGLAAGLVALARSARARLQGPALVFHRVPFGPGGALTLGQVILHTGESLDVDARTYWCRQHGGNDCVRIADHEHAHVYQYLVLGPLFLPLYFLCGGISWRNRFEQAADRYAQTGKGWWPWPRPALPQQAR

Samples

Sample ID Description Type Environment
1 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
4 2643221573 Lysobacter sp. Root604 Isolate Unclassified
5 2643221695 Lysobacter sp. Root494 Isolate Unclassified
6 2643221720 Lysobacter sp. Root916 Isolate Unclassified
7 2643221728 Lysobacter sp. Root983 Isolate Unclassified
8 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
9 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
13 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
36 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
37 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
38 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
39 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
48 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
49 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
76 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
77 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
96 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
97 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
98 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
99 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
102 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
103 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
104 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
105 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
106 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
107 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
110 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
111 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
112 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
113 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
118 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
119 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
120 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
121 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
122 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
123 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
124 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
125 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
126 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
127 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
128 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
129 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
130 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
131 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
132 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
133 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
134 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.68
Metatranscriptomes 0
Isolates 5.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.87
Nodule 0
Rhizoplane 1.6
Rhizosphere 69.68
Stem 0
Stem Tuber 0
Unclassified 5.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1049365 3300002987 Bacteria 581
2 Ga0055526_1042207 3300003771 Bacteria 1126
3 Ga0055524_1012119 3300003775 Bacteria 3327
4 Ga0055524_1014931 3300003775 Bacteria 2856
5 Ga0055524_1023882 3300003775 Bacteria 1956
6 Ga0055536_1002671 3300003781 Bacteria 9895
7 Ga0055536_1019939 3300003781 Bacteria 2089
8 Ga0055536_1051991 3300003781 Bacteria 895
9 Ga0055534_1008799 3300003784 Bacteria 2253
10 Ga0055528_1036330 3300003790 Bacteria 1179
11 Ga0055530_10002131 3300003791 Bacteria 13146
12 Ga0055531_10007014 3300003794 Bacteria 6246
13 Ga0055531_10011325 3300003794 Bacteria 4319
14 Ga0055531_10015830 3300003794 Bacteria 3295
15 Ga0055531_10025959 3300003794 Bacteria 2106
16 Ga0070658_10430611 3300005327 Bacteria 1135
17 Ga0070670_100874021 3300005331 Bacteria 814
18 Ga0068869_100667487 3300005334 Bacteria 884
19 Ga0070680_100462412 3300005336 Bacteria 1084
20 Ga0070660_100043866 3300005339 Bacteria 3418
21 Ga0070660_100283998 3300005339 Bacteria 1355
22 Ga0070668_100025903 3300005347 Bacteria 4447
23 Ga0070675_101419944 3300005354 Bacteria 640
24 Ga0070659_100273096 3300005366 Bacteria 1405
25 Ga0070667_100145225 3300005367 Bacteria 2080
26 Ga0070672_100030970 3300005543 Bacteria 4024
27 Ga0070672_101873817 3300005543 Bacteria 539
28 Ga0070693_100773785 3300005547 Bacteria 709
29 Ga0070693_101403205 3300005547 Bacteria 543
30 Ga0070664_101752941 3300005564 Bacteria 589
31 Ga0068852_101158102 3300005616 Bacteria 794
32 Ga0068863_100667185 3300005841 Bacteria 1032
33 Ga0105240_10002163 3300009093 Bacteria 32091
34 Ga0105248_11837841 3300009177 Unclassified 687
35 Ga0105238_11338736 3300009551 Bacteria 742
36 Ga0105032_100214 3300009979 Bacteria 5993
37 Ga0105028_111845 3300009993 Bacteria 921
38 Ga0105239_12487212 3300010375 Bacteria 603
39 Ga0157315_1002192 3300012508 Bacteria 1193
40 Ga0157316_1061116 3300012510 Bacteria 546
41 Ga0157371_10021978 3300013102 Bacteria 4682
42 Ga0157370_10347858 3300013104 Bacteria 1366
43 Ga0157369_10055158 3300013105 Bacteria 4290
44 Ga0157378_10456031 3300013297 Bacteria 1270
45 Ga0157372_10367143 3300013307 Bacteria 1677
46 Ga0163161_11775862 3300017792 Bacteria 548
47 Ga0207425_1036525 3300025245 Bacteria 953
48 Ga0209673_1011687 3300025273 Bacteria 3601
49 Ga0209130_1008815 3300025284 Bacteria 2938
50 Ga0209675_1002457 3300025291 Bacteria 9513
51 Ga0209675_1007889 3300025291 Bacteria 3998
52 Ga0209675_1038042 3300025291 Bacteria 1075
53 Ga0209676_1000700 3300025292 Bacteria 46962
54 Ga0209676_1003080 3300025292 Bacteria 10744
55 Ga0209676_1003909 3300025292 Bacteria 8667
56 Ga0209676_1005421 3300025292 Bacteria 6673
57 Ga0209676_1006961 3300025292 Bacteria 5445
58 Ga0209676_1012556 3300025292 Bacteria 3318
59 Ga0209676_1020736 3300025292 Bacteria 2223
60 Ga0209025_1040559 3300025294 Bacteria 2011
61 Ga0209564_1018745 3300025295 Bacteria 2622
62 Ga0209758_1010509 3300025297 Bacteria 5527
63 Ga0209758_1029007 3300025297 Bacteria 2326
64 Ga0209758_1077755 3300025297 Bacteria 1016
65 Ga0209050_1008106 3300025298 Bacteria 5698
66 Ga0209256_1002665 3300025299 Bacteria 14011
67 Ga0209256_1002748 3300025299 Bacteria 13597
68 Ga0209256_1005729 3300025299 Bacteria 6968
69 Ga0209051_1026760 3300025303 Bacteria 2316
70 Ga0209257_1000478 3300025304 Bacteria 72767
71 Ga0209257_1000570 3300025304 Bacteria 62283
72 Ga0209257_1000615 3300025304 Bacteria 58010
73 Ga0209257_1000890 3300025304 Bacteria 41952
74 Ga0209257_1008984 3300025304 Bacteria 5488
75 Ga0207645_10538172 3300025907 Bacteria 792
76 Ga0207705_10094909 3300025909 Bacteria 2188
77 Ga0207695_10011006 3300025913 Bacteria 10991
78 Ga0207657_10003945 3300025919 Bacteria 15757
79 Ga0207649_10303847 3300025920 Bacteria 1167
80 Ga0207649_10794089 3300025920 Bacteria 738
81 Ga0207652_10172703 3300025921 Bacteria 1940
82 Ga0207652_10299210 3300025921 Bacteria 1452
83 Ga0207650_10606608 3300025925 Bacteria 921
84 Ga0207659_10385660 3300025926 Bacteria 1169
85 Ga0207659_10676466 3300025926 Bacteria 883
86 Ga0207691_10045663 3300025940 Bacteria 4026
87 Ga0207679_10063509 3300025945 Bacteria 2756
88 Ga0207667_10821828 3300025949 Bacteria 925
89 Ga0207668_10037941 3300025972 Bacteria 3229
90 Ga0207677_10131635 3300026023 Bacteria 1900
91 Ga0207639_10387008 3300026041 Bacteria 1257
92 Ga0207678_11999927 3300026067 Bacteria 504
93 Ga0207641_11982480 3300026088 Bacteria 583
94 Ga0207698_11147048 3300026142 Bacteria 791
95 Ga0316177_1000429 3300030731 Bacteria 7389
96 Ga0316176_1023162 3300030732 Bacteria 1360
97 Ga0314311_1214021 3300030733 Bacteria 2175
98 Ga0307408_100489370 3300031548 Bacteria 1075
99 Ga0307413_10101958 3300031824 Bacteria 1899
100 Ga0307413_10801893 3300031824 Bacteria 791
101 Ga0307410_10200301 3300031852 Bacteria 1524
102 Ga0307410_11469389 3300031852 Bacteria 600
103 Ga0307410_11602393 3300031852 Bacteria 575
104 Ga0307407_10104318 3300031903 Bacteria 1766
105 Ga0307412_10113583 3300031911 Bacteria 1938
106 Ga0307412_10273494 3300031911 Bacteria 1323
107 Ga0307412_10722708 3300031911 Bacteria 857
108 Ga0307409_100904958 3300031995 Bacteria 896
109 Ga0307416_100430271 3300032002 Bacteria 1367
110 Ga0307416_100759441 3300032002 Bacteria 1063
111 Ga0307416_102623321 3300032002 Bacteria 601
112 Ga0307414_10144231 3300032004 Bacteria 1868
113 Ga0307414_10249952 3300032004 Bacteria 1473
114 Ga0307414_10750504 3300032004 Bacteria 887
115 Ga0307414_10808874 3300032004 Bacteria 855
116 Ga0307414_11573366 3300032004 Bacteria 612
117 Ga0307414_12152563 3300032004 Bacteria 521
118 Ga0307411_10222919 3300032005 Bacteria 1464
119 Ga0307411_10688100 3300032005 Bacteria 889
120 Ga0307415_100551602 3300032126 Bacteria 1017
121 Ga0373925_1167335 3300037068 Bacteria 633
122 Ga0395900_0807173 3300037418 Bacteria 866
123 Ga0395898_0000853 3300037466 Bacteria 50024
124 Ga0395905_0076818 3300037471 Bacteria 3130
125 Ga0395905_0116146 3300037471 Bacteria 2515
126 Ga0395905_0154147 3300037471 Bacteria 2161
127 Ga0395901_0088573 3300038443 Bacteria 3238
128 Ga0395901_0319377 3300038443 Bacteria 1607
129 Ga0439436_0014560 3300041404 Bacteria 2371
130 Ga0439465_0139346 3300041413 Bacteria 861
131 Ga0451802_1112417 3300041460 Bacteria 914
132 Ga0451807_1872300 3300041486 Bacteria 910
133 Ga0451837_1790371 3300041494 Bacteria 1199
134 Ga0451843_0753548 3300041509 Bacteria 536
135 Ga0439432_004836 3300042006 Bacteria 4884
136 Ga0439432_084366 3300042006 Bacteria 960
137 Ga0439449_0050822 3300042007 Bacteria 1533
138 Ga0439449_0199222 3300042007 Bacteria 749
139 Ga0439462_0008515 3300042015 Bacteria 2588
140 Ga0450898_029991 3300042134 Bacteria 994
141 Ga0450898_154196 3300042134 Bacteria 504
142 Ga0450906_027885 3300042145 Bacteria 1001
143 Ga0495656_0004996 3300046615 Bacteria 4569
144 Ga0495668_0000953 3300046616 Bacteria 32126
145 Ga0495659_0072726 3300046664 Bacteria 1291
146 Ga0495636_0024399 3300047318 Bacteria 2452
147 Ga0496115_0323371 3300048918 Bacteria 1261
148 Ga0496117_0023722 3300048920 Bacteria 4876
149 Ga0496118_0024074 3300048921 Bacteria 5267
150 Ga0496121_0002174 3300048924 Bacteria 30706
151 Ga0496121_0267302 3300048924 Bacteria 1177
152 Ga0496126_0027025 3300048929 Bacteria 5491
153 Ga0501291_082293 3300049514 Bacteria 643
154 Ga0501034_0005364 3300049571 Bacteria 14038
155 Ga0501043_0003536 3300049579 Bacteria 12842
156 Ga0501047_0148011 3300049581 Bacteria 2225
157 Ga0501201_019989 3300049651 Bacteria 704
158 Ga0501202_006573 3300049652 Bacteria 2084
159 Ga0501202_077700 3300049652 Bacteria 775
160 Ga0501207_004807 3300049654 Bacteria 1850
161 Ga0501209_220434 3300049656 Bacteria 588
162 Ga0501217_009270 3300049661 Bacteria 2139
163 Ga0501240_043692 3300049673 Bacteria 752
164 Ga0501242_009275 3300049674 Bacteria 1163
165 Ga0501243_013670 3300049675 Bacteria 1292
166 Ga0501250_007540 3300049680 Bacteria 1179
167 Ga0501250_014558 3300049680 Bacteria 956
168 Ga0501252_011720 3300049682 Bacteria 1052
169 Ga0501259_031058 3300049688 Bacteria 1009
170 Ga0501259_077403 3300049688 Bacteria 725
171 Ga0501225_0040253 3300049705 Bacteria 1288
172 Ga0501241_026470 3300049758 Bacteria 1082
173 Ga0501262_042445 3300049759 Bacteria 683
174 Ga0501266_002515 3300049763 Bacteria 2311
175 Ga0501268_002112 3300049765 Bacteria 2577
176 Ga0501268_063988 3300049765 Bacteria 733
177 Ga0501270_010747 3300049767 Bacteria 1213
178 Ga0501270_044681 3300049767 Bacteria 783

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_12152563 Ga0307414_121525631 129
2 3300037466 Ga0395898_0000853 Ga0395898_0000853_36003_36461 131
3 3300005616 Ga0068852_101158102 Ga0068852_1011581022 134
4 3300025907 Ga0207645_10538172 Ga0207645_105381721 135
5 3300049571 Ga0501034_0005364 Ga0501034_0005364_7292_7726 135
6 3300049581 Ga0501047_0148011 Ga0501047_0148011_1026_1460 135
7 3300032002 Ga0307416_100759441 Ga0307416_1007594412 138
8 3300032005 Ga0307411_10222919 Ga0307411_102229192 138
9 3300005543 Ga0070672_101873817 Ga0070672_1018738171 139
10 3300005547 Ga0070693_101403205 Ga0070693_1014032051 139
11 3300005564 Ga0070664_101752941 Ga0070664_1017529412 139
12 3300009177 Ga0105248_11837841 Ga0105248_118378411 139
13 3300010375 Ga0105239_12487212 Ga0105239_124872121 139
14 3300025920 Ga0207649_10303847 Ga0207649_103038472 139
15 3300025926 Ga0207659_10676466 Ga0207659_106764661 139
16 3300025945 Ga0207679_10063509 Ga0207679_100635094 139
17 3300026023 Ga0207677_10131635 Ga0207677_101316353 139
18 3300026041 Ga0207639_10387008 Ga0207639_103870083 139
19 3300026067 Ga0207678_11999927 Ga0207678_119999271 139
20 3300026142 Ga0207698_11147048 Ga0207698_111470481 139
21 3300037068 Ga0373925_1167335 Ga0373925_1167335_184_615 139
22 3300037471 Ga0395905_0116146 Ga0395905_0116146_293_712 139
23 iso_pu_bacteria 2941489479 2941490667 139
24 3300005331 Ga0070670_100874021 Ga0070670_1008740212 140
25 3300005354 Ga0070675_101419944 Ga0070675_1014199441 140
26 3300025925 Ga0207650_10606608 Ga0207650_106066082 140
27 3300031995 Ga0307409_100904958 Ga0307409_1009049583 140
28 3300005841 Ga0068863_100667185 Ga0068863_1006671852 141
29 3300012510 Ga0157316_1061116 Ga0157316_10611161 141
30 3300017792 Ga0163161_11775862 Ga0163161_117758621 141
31 3300025299 Ga0209256_1002748 Ga0209256_10027487 141
32 3300026088 Ga0207641_11982480 Ga0207641_119824802 141
33 3300031852 Ga0307410_11469389 Ga0307410_114693891 141
34 3300032004 Ga0307414_10750504 Ga0307414_107505042 141
35 iso_pu_bacteria 2524614729 2525556875 141
36 iso_pu_bacteria 2627854209 2630648471 141
37 iso_pu_bacteria 2894414249 2894415846 141
38 3300005334 Ga0068869_100667487 Ga0068869_1006674872 142
39 3300005347 Ga0070668_100025903 Ga0070668_1000259034 142
40 3300005543 Ga0070672_100030970 Ga0070672_1000309702 142
41 3300013297 Ga0157378_10456031 Ga0157378_104560312 142
42 3300025926 Ga0207659_10385660 Ga0207659_103856601 142
43 3300025940 Ga0207691_10045663 Ga0207691_100456631 142
44 3300025972 Ga0207668_10037941 Ga0207668_100379412 142
45 3300030731 Ga0316177_1000429 Ga0316177_10004294 142
46 3300030732 Ga0316176_1023162 Ga0316176_10231622 142
47 3300030733 Ga0314311_1214021 Ga0314311_12140213 142
48 3300031824 Ga0307413_10101958 Ga0307413_101019583 142
49 3300031852 Ga0307410_10200301 Ga0307410_102003013 142
50 3300031852 Ga0307410_11602393 Ga0307410_116023932 142
51 3300031911 Ga0307412_10113583 Ga0307412_101135834 142
52 3300031911 Ga0307412_10273494 Ga0307412_102734942 142
53 3300032002 Ga0307416_102623321 Ga0307416_1026233212 142
54 3300032004 Ga0307414_10249952 Ga0307414_102499523 142
55 3300032005 Ga0307411_10688100 Ga0307411_106881001 142
56 3300032126 Ga0307415_100551602 Ga0307415_1005516023 142
57 3300041404 Ga0439436_0014560 Ga0439436_0014560_979_1407 142
58 3300042006 Ga0439432_004836 Ga0439432_004836_2497_2937 142
59 3300042006 Ga0439432_084366 Ga0439432_084366_125_553 142
60 3300042007 Ga0439449_0050822 Ga0439449_0050822_325_765 142
61 3300042007 Ga0439449_0199222 Ga0439449_0199222_32_460 142
62 3300042015 Ga0439462_0008515 Ga0439462_0008515_154_582 142
63 3300042134 Ga0450898_029991 Ga0450898_029991_210_638 142
64 3300042134 Ga0450898_154196 Ga0450898_154196_20_460 142
65 3300042145 Ga0450906_027885 Ga0450906_027885_85_543 142
66 3300049514 Ga0501291_082293 Ga0501291_082293_34_474 142
67 3300049651 Ga0501201_019989 Ga0501201_019989_112_552 142
68 3300049652 Ga0501202_077700 Ga0501202_077700_194_622 142
69 3300049673 Ga0501240_043692 Ga0501240_043692_147_575 142
70 3300049674 Ga0501242_009275 Ga0501242_009275_526_954 142
71 3300049680 Ga0501250_007540 Ga0501250_007540_489_917 142
72 3300049688 Ga0501259_077403 Ga0501259_077403_20_448 142
73 3300049758 Ga0501241_026470 Ga0501241_026470_268_696 142
74 3300049759 Ga0501262_042445 Ga0501262_042445_100_528 142
75 3300049765 Ga0501268_063988 Ga0501268_063988_278_718 142
76 iso_pu_bacteria 2571042365 2572255143 142
77 iso_pu_bacteria 2643221695 2644529533 142
78 3300003781 Ga0055536_1002671 Ga0055536_10026719 143
79 3300003794 Ga0055531_10007014 Ga0055531_100070147 143
80 3300005367 Ga0070667_100145225 Ga0070667_1001452252 143
81 3300009093 Ga0105240_10002163 Ga0105240_1000216333 143
82 3300009551 Ga0105238_11338736 Ga0105238_113387361 143
83 3300009993 Ga0105028_111845 Ga0105028_1118451 143
84 3300025245 Ga0207425_1036525 Ga0207425_10365252 143
85 3300025291 Ga0209675_1002457 Ga0209675_10024575 143
86 3300025292 Ga0209676_1000700 Ga0209676_100070034 143
87 3300025292 Ga0209676_1005421 Ga0209676_10054213 143
88 3300025297 Ga0209758_1029007 Ga0209758_10290075 143
89 3300025297 Ga0209758_1077755 Ga0209758_10777552 143
90 3300025304 Ga0209257_1000615 Ga0209257_100061525 143
91 3300025913 Ga0207695_10011006 Ga0207695_100110067 143
92 3300037418 Ga0395900_0807173 Ga0395900_0807173_184_627 143
93 3300038443 Ga0395901_0088573 Ga0395901_0088573_1497_1940 143
94 3300038443 Ga0395901_0319377 Ga0395901_0319377_684_1127 143
95 3300041494 Ga0451837_1790371 Ga0451837_1790371_125_568 143
96 3300046615 Ga0495656_0004996 Ga0495656_0004996_1602_2045 143
97 3300046616 Ga0495668_0000953 Ga0495668_0000953_22679_23110 143
98 3300046664 Ga0495659_0072726 Ga0495659_0072726_390_833 143
99 3300047318 Ga0495636_0024399 Ga0495636_0024399_1106_1549 143
100 3300048918 Ga0496115_0323371 Ga0496115_0323371_654_1094 143
101 3300048920 Ga0496117_0023722 Ga0496117_0023722_4161_4601 143
102 3300048921 Ga0496118_0024074 Ga0496118_0024074_4383_4823 143
103 3300048924 Ga0496121_0002174 Ga0496121_0002174_4141_4572 143
104 3300048924 Ga0496121_0267302 Ga0496121_0267302_234_674 143
105 3300048929 Ga0496126_0027025 Ga0496126_0027025_697_1137 143
106 iso_pu_bacteria 2643221573 2643879260 143
107 iso_pu_bacteria 2643221720 2644660559 143
108 iso_pu_bacteria 2643221728 2644697918 143
109 iso_pu_bacteria 8003014200 8003014514 143
110 3300002987 JGI25159J45721_1049365 JGI25159J45721_10493651 144
111 3300003771 Ga0055526_1042207 Ga0055526_10422072 144
112 3300003775 Ga0055524_1012119 Ga0055524_10121196 144
113 3300003775 Ga0055524_1014931 Ga0055524_10149312 144
114 3300003775 Ga0055524_1023882 Ga0055524_10238822 144
115 3300003781 Ga0055536_1019939 Ga0055536_10199394 144
116 3300003781 Ga0055536_1051991 Ga0055536_10519912 144
117 3300003784 Ga0055534_1008799 Ga0055534_10087994 144
118 3300003790 Ga0055528_1036330 Ga0055528_10363303 144
119 3300003791 Ga0055530_10002131 Ga0055530_1000213114 144
120 3300003794 Ga0055531_10011325 Ga0055531_100113253 144
121 3300003794 Ga0055531_10015830 Ga0055531_100158302 144
122 3300003794 Ga0055531_10025959 Ga0055531_100259592 144
123 3300005327 Ga0070658_10430611 Ga0070658_104306111 144
124 3300005336 Ga0070680_100462412 Ga0070680_1004624121 144
125 3300005339 Ga0070660_100043866 Ga0070660_1000438664 144
126 3300005339 Ga0070660_100283998 Ga0070660_1002839983 144
127 3300005366 Ga0070659_100273096 Ga0070659_1002730962 144
128 3300005547 Ga0070693_100773785 Ga0070693_1007737851 144
129 3300009979 Ga0105032_100214 Ga0105032_1002141 144
130 3300012508 Ga0157315_1002192 Ga0157315_10021921 144
131 3300013102 Ga0157371_10021978 Ga0157371_100219784 144
132 3300013104 Ga0157370_10347858 Ga0157370_103478581 144
133 3300013105 Ga0157369_10055158 Ga0157369_100551582 144
134 3300013307 Ga0157372_10367143 Ga0157372_103671432 144
135 3300025273 Ga0209673_1011687 Ga0209673_10116875 144
136 3300025284 Ga0209130_1008815 Ga0209130_10088155 144
137 3300025291 Ga0209675_1007889 Ga0209675_10078895 144
138 3300025291 Ga0209675_1038042 Ga0209675_10380422 144
139 3300025292 Ga0209676_1003080 Ga0209676_10030804 144
140 3300025292 Ga0209676_1003909 Ga0209676_10039092 144
141 3300025292 Ga0209676_1006961 Ga0209676_10069616 144
142 3300025292 Ga0209676_1012556 Ga0209676_10125565 144
143 3300025292 Ga0209676_1020736 Ga0209676_10207362 144
144 3300025294 Ga0209025_1040559 Ga0209025_10405593 144
145 3300025295 Ga0209564_1018745 Ga0209564_10187452 144
146 3300025297 Ga0209758_1010509 Ga0209758_10105096 144
147 3300025298 Ga0209050_1008106 Ga0209050_10081067 144
148 3300025299 Ga0209256_1002665 Ga0209256_10026652 144
149 3300025299 Ga0209256_1005729 Ga0209256_10057293 144
150 3300025303 Ga0209051_1026760 Ga0209051_10267603 144
151 3300025304 Ga0209257_1000478 Ga0209257_100047843 144
152 3300025304 Ga0209257_1000570 Ga0209257_100057026 144
153 3300025304 Ga0209257_1000890 Ga0209257_100089014 144
154 3300025304 Ga0209257_1008984 Ga0209257_10089846 144
155 3300025909 Ga0207705_10094909 Ga0207705_100949093 144
156 3300025919 Ga0207657_10003945 Ga0207657_1000394519 144
157 3300025920 Ga0207649_10794089 Ga0207649_107940892 144
158 3300025921 Ga0207652_10172703 Ga0207652_101727032 144
159 3300025921 Ga0207652_10299210 Ga0207652_102992102 144
160 3300025949 Ga0207667_10821828 Ga0207667_108218282 144
161 3300031548 Ga0307408_100489370 Ga0307408_1004893701 144
162 3300031824 Ga0307413_10801893 Ga0307413_108018932 144
163 3300031903 Ga0307407_10104318 Ga0307407_101043182 144
164 3300031911 Ga0307412_10722708 Ga0307412_107227083 144
165 3300032002 Ga0307416_100430271 Ga0307416_1004302712 144
166 3300032004 Ga0307414_10144231 Ga0307414_101442312 144
167 3300032004 Ga0307414_10808874 Ga0307414_108088742 144
168 3300032004 Ga0307414_11573366 Ga0307414_115733661 144
169 3300037471 Ga0395905_0076818 Ga0395905_0076818_2640_3095 144
170 3300037471 Ga0395905_0154147 Ga0395905_0154147_676_1113 144
171 3300041413 Ga0439465_0139346 Ga0439465_0139346_60_578 144
172 3300041460 Ga0451802_1112417 Ga0451802_1112417_61_534 144
173 3300041486 Ga0451807_1872300 Ga0451807_1872300_252_743 144
174 3300041509 Ga0451843_0753548 Ga0451843_0753548_52_504 144
175 3300049579 Ga0501043_0003536 Ga0501043_0003536_5938_6384 144
176 3300049652 Ga0501202_006573 Ga0501202_006573_25_489 144
177 3300049654 Ga0501207_004807 Ga0501207_004807_882_1346 144
178 3300049656 Ga0501209_220434 Ga0501209_220434_35_499 144
179 3300049661 Ga0501217_009270 Ga0501217_009270_786_1250 144
180 3300049675 Ga0501243_013670 Ga0501243_013670_413_877 144
181 3300049680 Ga0501250_014558 Ga0501250_014558_154_618 144
182 3300049682 Ga0501252_011720 Ga0501252_011720_555_1019 144
183 3300049688 Ga0501259_031058 Ga0501259_031058_220_684 144
184 3300049705 Ga0501225_0040253 Ga0501225_0040253_492_956 144
185 3300049763 Ga0501266_002515 Ga0501266_002515_1737_2201 144
186 3300049765 Ga0501268_002112 Ga0501268_002112_785_1249 144
187 3300049767 Ga0501270_010747 Ga0501270_010747_677_1141 144
188 3300049767 Ga0501270_044681 Ga0501270_044681_115_564 144

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pro-assembly4.cif.gz_A pro region of alpha-lytic protease 0.4661 14 46
4pro-assembly2.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.395 13 64
2o36-assembly1.cif.gz_A crystal structure of engineered thimet oligopeptidase with neurolysin specificity in neurotensin cleavage site 0.3779 41 132
1s4b-assembly1.cif.gz_P crystal structure of human thimet oligopeptidase. 0.3034 16 132
2o36-assembly1.cif.gz_A crystal structure of engineered thimet oligopeptidase with neurolysin specificity in neurotensin cleavage site 0.2668 41 132
ID Description Score Start End Superfamily
af_Q9VYR2_398_592_3.60.20.40 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Gamma-glutamyltranspeptidase, small (S) subunit 0.4966 30 46 3.60.20.40
af_Q9N5V4_446_642_3.60.20.40 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Gamma-glutamyltranspeptidase, small (S) subunit 0.3485 31 52 3.60.20.40
af_Q940L4_260_485_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.3219 32 116 3.40.50.1820
af_Q54YL1_371_580_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.2313 32 116 3.40.50.1820
af_Q8NCG7_269_526_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.2289 32 114 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A4R0YWN3-F1-model_v4 Uncharacterized protein 0.9962 6 140 GO:0016020
AF-A0A3S7KGC7-F1-model_v4 Uncharacterized protein 0.9956 2 140 GO:0016020
AF-A0A7S6UST7-F1-model_v4 Uncharacterized protein 0.9954 2 141 GO:0016020
AF-B8L546-F1-model_v4 Transmembrane protein 0.9952 8 140 GO:0016020
AF-A0A4Q1CT03-F1-model_v4 Uncharacterized protein 0.9946 2 140 GO:0016020

Feature Viewer

pLDDT pTM Quality
86.23 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map