F288815

General Info

Members Datasets Scaffolds Average Seq Length
188 135 376 153

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100200144|Ga0070682_1002001443
Length 173
Sequence MPSTPDPVADPASEQARHRNVVMVAQVLAAAGASGRVVELADAVRTAADAAAALSCEVAAIANSLVFMADGEPVLILTSGAHRVDTARVANLLGVGRLRRATPDQVRAATGQPIGGVAPVGHPQPVRTLVDVALREFPVVWAAGGIPHAVFPTTFEELVRITGGEPVTVTPEG

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
81 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
82 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
94 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
95 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
96 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
103 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
104 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
105 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
106 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
107 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
108 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
109 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
110 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
111 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
112 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
113 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
114 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
115 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
116 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
117 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
118 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
128 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
132 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
133 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
134 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
135 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.81
Metatranscriptomes 1.6
Isolates 1.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 12.23
Rhizosphere 84.57
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100200144 3300005337 Bacteria 1408
2 Ga0070658_10283300 3300005327 Bacteria 1411
3 Ga0070683_100195339 3300005329 Bacteria 1921
4 Ga0070683_100782840 3300005329 Bacteria 914
5 Ga0070682_100022695 3300005337 Bacteria 3719
6 Ga0068868_100215918 3300005338 Bacteria 1604
7 Ga0070671_101219241 3300005355 Unclassified 662
8 Ga0070659_100668115 3300005366 Bacteria 897
9 Ga0070667_100674882 3300005367 Bacteria 955
10 Ga0070714_100523286 3300005435 Bacteria 1133
11 Ga0070700_100737251 3300005441 Bacteria 787
12 Ga0070663_100035540 3300005455 Bacteria 3457
13 Ga0070678_100356414 3300005456 Bacteria 1259
14 Ga0070681_10705353 3300005458 Bacteria 925
15 Ga0070685_10315052 3300005466 Bacteria 1058
16 Ga0070685_10431365 3300005466 Bacteria 919
17 Ga0070679_100682072 3300005530 Bacteria 970
18 Ga0070684_100291710 3300005535 Bacteria 1496
19 Ga0070684_100530464 3300005535 Bacteria 1092
20 Ga0070686_100674672 3300005544 Bacteria 822
21 Ga0070665_101218404 3300005548 Bacteria 763
22 Ga0068855_100088386 3300005563 Bacteria 3580
23 Ga0068857_100046371 3300005577 Bacteria 3857
24 Ga0068854_100069599 3300005578 Bacteria 2569
25 Ga0068856_100034417 3300005614 Bacteria 4962
26 Ga0068856_100309008 3300005614 Bacteria 1599
27 Ga0068852_100005778 3300005616 Bacteria 8882
28 Ga0068852_100510855 3300005616 Bacteria 1198
29 Ga0068852_100530942 3300005616 Bacteria 1175
30 Ga0068864_100060474 3300005618 Bacteria 3280
31 Ga0068866_10504776 3300005718 Bacteria 801
32 Ga0068863_100508921 3300005841 Bacteria 1186
33 Ga0068863_100633527 3300005841 Bacteria 1060
34 Ga0068858_100352917 3300005842 Bacteria 1409
35 Ga0068860_100332338 3300005843 Bacteria 1493
36 Ga0070715_10076208 3300006163 Bacteria 1511
37 Ga0070712_100452688 3300006175 Bacteria 1069
38 Ga0075428_100463930 3300006844 Bacteria 1356
39 Ga0075430_100968258 3300006846 Bacteria 701
40 Ga0075435_101136956 3300007076 Bacteria 683
41 Ga0105244_10189446 3300009036 Bacteria 973
42 Ga0105240_10099685 3300009093 Bacteria 3536
43 Ga0111539_10227425 3300009094 Bacteria 2172
44 Ga0105245_10068097 3300009098 Bacteria 3225
45 Ga0105245_10135928 3300009098 Bacteria 2310
46 Ga0105245_10363486 3300009098 Bacteria 1437
47 Ga0105245_11132708 3300009098 Bacteria 829
48 Ga0105243_10374159 3300009148 Bacteria 1315
49 Ga0105243_10916932 3300009148 Bacteria 873
50 Ga0105242_11056777 3300009176 Bacteria 823
51 Ga0105248_10068458 3300009177 Bacteria 3985
52 Ga0105238_12275389 3300009551 Bacteria 577
53 Ga0105249_10923982 3300009553 Unclassified 940
54 Ga0105239_10751964 3300010375 Bacteria 1116
55 Ga0105246_10295070 3300011119 Bacteria 1306
56 Ga0157369_10622528 3300013105 Bacteria 1114
57 Ga0157372_10710818 3300013307 Bacteria 1169
58 Ga0163163_10004570 3300014325 Bacteria 11814
59 Ga0163163_10371220 3300014325 Bacteria 1488
60 Ga0157380_10828349 3300014326 Bacteria 945
61 Ga0157376_10469030 3300014969 Bacteria 1232
62 Ga0206354_10536635 3300020081 Bacteria 992
63 Ga0206353_11123508 3300020082 Bacteria 4022
64 Ga0206353_11576640 3300020082 Bacteria 1409
65 Ga0207642_10130848 3300025899 Bacteria 1309
66 Ga0207688_10049922 3300025901 Bacteria 2340
67 Ga0207688_10099240 3300025901 Bacteria 1680
68 Ga0207688_10421481 3300025901 Bacteria 829
69 Ga0207643_10286281 3300025908 Bacteria 1023
70 Ga0207705_11278789 3300025909 Bacteria 561
71 Ga0207695_10655311 3300025913 Bacteria 931
72 Ga0207693_10399883 3300025915 Bacteria 1074
73 Ga0207652_10495227 3300025921 Bacteria 1100
74 Ga0207687_10100417 3300025927 Bacteria 2128
75 Ga0207687_10322755 3300025927 Bacteria 1250
76 Ga0207700_10105481 3300025928 Bacteria 2257
77 Ga0207664_10712435 3300025929 Bacteria 902
78 Ga0207690_10272030 3300025932 Bacteria 1316
79 Ga0207665_10392038 3300025939 Bacteria 1056
80 Ga0207711_10051944 3300025941 Bacteria 3512
81 Ga0207661_10486276 3300025944 Bacteria 1127
82 Ga0207667_10055614 3300025949 Bacteria 4160
83 Ga0207667_10398266 3300025949 Bacteria 1402
84 Ga0207640_10477514 3300025981 Bacteria 1033
85 Ga0207658_10546434 3300025986 Bacteria 1036
86 Ga0207703_10184119 3300026035 Bacteria 1845
87 Ga0207703_10541318 3300026035 Bacteria 1097
88 Ga0207678_10059739 3300026067 Bacteria 3280
89 Ga0207708_10553702 3300026075 Bacteria 970
90 Ga0207702_10027190 3300026078 Bacteria 4751
91 Ga0207641_10531095 3300026088 Bacteria 1145
92 Ga0207676_10024384 3300026095 Bacteria 4475
93 Ga0207674_10067870 3300026116 Bacteria 3589
94 Ga0207674_10262474 3300026116 Bacteria 1674
95 Ga0207675_100118810 3300026118 Bacteria 2500
96 Ga0207675_100833711 3300026118 Bacteria 936
97 Ga0207683_10446591 3300026121 Bacteria 1192
98 Ga0207683_11059708 3300026121 Bacteria 752
99 Ga0207698_10019881 3300026142 Bacteria 4610
100 Ga0207698_10195594 3300026142 Bacteria 1806
101 Ga0207698_10374090 3300026142 Bacteria 1353
102 Ga0207428_10617198 3300027907 Bacteria 780
103 Ga0268266_10874407 3300028379 Bacteria 869
104 Ga0307511_10191013 3300030521 Bacteria 1082
105 Ga0373943_0255982 3300035170 Bacteria 984
106 Ga0373942_0005554 3300035207 Bacteria 2922
107 Ga0373927_0122250 3300035695 Bacteria 1699
108 Ga0451853_2455567 3300041512 Bacteria 592
109 Ga0466972_0059120 3300044658 Bacteria 1840
110 Ga0466966_0043997 3300044684 Bacteria 2860
111 Ga0466966_0075479 3300044684 Bacteria 2106
112 Ga0466966_0136096 3300044684 Bacteria 1502
113 Ga0466966_0334153 3300044684 Bacteria 910
114 Ga0466961_0017814 3300044693 Bacteria 4564
115 Ga0466961_0135003 3300044693 Bacteria 1546
116 Ga0466961_0242124 3300044693 Bacteria 1109
117 Ga0466961_0434625 3300044693 Unclassified 795
118 Ga0466961_0509462 3300044693 Bacteria 726
119 Ga0466963_0372671 3300044694 Bacteria 1006
120 Ga0466964_0199101 3300044706 Bacteria 960
121 Ga0466971_0082243 3300044719 Bacteria 1470
122 Ga0466970_0062656 3300044765 Bacteria 1994
123 Ga0466970_0182134 3300044765 Bacteria 1166
124 Ga0466970_0231213 3300044765 Bacteria 1033
125 Ga0466970_0236199 3300044765 Bacteria 1022
126 Ga0466959_0180521 3300045049 Bacteria 1476
127 Ga0466958_0315264 3300045836 Bacteria 1005
128 Ga0466958_0583927 3300045836 Bacteria 726
129 Ga0466967_0199656 3300045976 Bacteria 1894
130 Ga0466967_0210836 3300045976 Bacteria 1842
131 Ga0466967_0266039 3300045976 Bacteria 1641
132 Ga0466967_1032065 3300045976 Bacteria 819
133 Ga0495629_0055506 3300046459 Bacteria 2770
134 Ga0495641_0418303 3300046461 Bacteria 608
135 Ga0495662_0500024 3300046476 Bacteria 596
136 Ga0495664_0077301 3300046477 Bacteria 1993
137 Ga0495664_0625077 3300046477 Bacteria 639
138 Ga0495665_0000709 3300046531 Bacteria 17165
139 Ga0495586_0003928 3300046535 Bacteria 7975
140 Ga0495587_0022960 3300046536 Bacteria 3836
141 Ga0495645_0012546 3300046543 Bacteria 5973
142 Ga0495667_0016886 3300046559 Bacteria 4928
143 Ga0495635_0074917 3300046663 Bacteria 2319
144 Ga0495635_0199783 3300046663 Bacteria 1356
145 Ga0495588_0045063 3300046674 Bacteria 2260
146 Ga0495588_0545849 3300046674 Bacteria 607
147 Ga0495600_0017269 3300046809 Bacteria 4587
148 Ga0495581_0046099 3300047315 Bacteria 2518
149 Ga0495675_0019304 3300047444 Bacteria 4330
150 Ga0496101_0616131 3300048904 Bacteria 858
151 Ga0496101_1068824 3300048904 Unclassified 634
152 Ga0496102_0569120 3300048905 Bacteria 1056
153 Ga0496104_0056783 3300048907 Bacteria 3703
154 Ga0496104_0179870 3300048907 Bacteria 2025
155 Ga0496104_0414188 3300048907 Bacteria 1260
156 Ga0496104_0632313 3300048907 Bacteria 980
157 Ga0496105_0062564 3300048908 Bacteria 3071
158 Ga0496105_0616133 3300048908 Bacteria 841
159 Ga0496108_0008680 3300048911 Bacteria 8239
160 Ga0496108_0031873 3300048911 Bacteria 4375
161 Ga0496108_0055150 3300048911 Bacteria 3336
162 Ga0496108_0247651 3300048911 Bacteria 1550
163 Ga0496109_0034884 3300048912 Bacteria 4535
164 Ga0496109_0049158 3300048912 Bacteria 3838
165 Ga0496109_0200670 3300048912 Bacteria 1875
166 Ga0496110_0024454 3300048913 Bacteria 5148
167 Ga0496110_0251576 3300048913 Bacteria 1608
168 Ga0496111_0039786 3300048914 Bacteria 3373
169 Ga0496112_0030955 3300048915 Bacteria 5184
170 Ga0496113_0092517 3300048916 Bacteria 2332
171 Ga0496114_0001963 3300048917 Bacteria 15637
172 Ga0496114_0251825 3300048917 Bacteria 1554
173 Ga0501032_0002322 3300049569 Bacteria 14909
174 Ga0501034_0000016 3300049571 Bacteria 289751
175 Ga0501037_0038366 3300049573 Bacteria 3529
176 Ga0501043_0031178 3300049579 Bacteria 4192
177 Ga0501047_0598753 3300049581 Bacteria 924
178 Ga0501073_0418531 3300049589 Bacteria 926
179 Ga0501035_1012610 3300049822 Bacteria 653
180 Ga0501044_0521601 3300049823 Bacteria 1088
181 nmdc:mga03n38_145595_c1 3300050490 Bacteria 1187
182 nmdc:mga09592_1004189_c1 3300050508 Bacteria 697
183 nmdc:mga08y16_494693_c1 3300050511 Bacteria 1243
184 Ga0500568_0000957 3300053139 Bacteria 19852
185 Ga0466962_0059465 3300061719 Bacteria 1824
186 2816425230 2816332119 Bacteria 8120218
187 2816505439 2816332139 Bacteria 9138787
188 2870783542 2870782633 Bacteria 9624083
189 Ga0070682_100200144
190 Ga0070658_10283300
191 Ga0070683_100195339
192 Ga0070683_100782840
193 Ga0070682_100022695
194 Ga0068868_100215918
195 Ga0070671_101219241
196 Ga0070659_100668115
197 Ga0070667_100674882
198 Ga0070714_100523286
199 Ga0070700_100737251
200 Ga0070663_100035540
201 Ga0070678_100356414
202 Ga0070681_10705353
203 Ga0070685_10315052
204 Ga0070685_10431365
205 Ga0070679_100682072
206 Ga0070684_100291710
207 Ga0070684_100530464
208 Ga0070686_100674672
209 Ga0070665_101218404
210 Ga0068855_100088386
211 Ga0068857_100046371
212 Ga0068854_100069599
213 Ga0068856_100034417
214 Ga0068856_100309008
215 Ga0068852_100005778
216 Ga0068852_100510855
217 Ga0068852_100530942
218 Ga0068864_100060474
219 Ga0068866_10504776
220 Ga0068863_100508921
221 Ga0068863_100633527
222 Ga0068858_100352917
223 Ga0068860_100332338
224 Ga0070715_10076208
225 Ga0070712_100452688
226 Ga0075428_100463930
227 Ga0075430_100968258
228 Ga0075435_101136956
229 Ga0105244_10189446
230 Ga0105240_10099685
231 Ga0111539_10227425
232 Ga0105245_10068097
233 Ga0105245_10135928
234 Ga0105245_10363486
235 Ga0105245_11132708
236 Ga0105243_10374159
237 Ga0105243_10916932
238 Ga0105242_11056777
239 Ga0105248_10068458
240 Ga0105238_12275389
241 Ga0105249_10923982
242 Ga0105239_10751964
243 Ga0105246_10295070
244 Ga0157369_10622528
245 Ga0157372_10710818
246 Ga0163163_10004570
247 Ga0163163_10371220
248 Ga0157380_10828349
249 Ga0157376_10469030
250 Ga0206354_10536635
251 Ga0206353_11123508
252 Ga0206353_11576640
253 Ga0207642_10130848
254 Ga0207688_10049922
255 Ga0207688_10099240
256 Ga0207688_10421481
257 Ga0207643_10286281
258 Ga0207705_11278789
259 Ga0207695_10655311
260 Ga0207693_10399883
261 Ga0207652_10495227
262 Ga0207687_10100417
263 Ga0207687_10322755
264 Ga0207700_10105481
265 Ga0207664_10712435
266 Ga0207690_10272030
267 Ga0207665_10392038
268 Ga0207711_10051944
269 Ga0207661_10486276
270 Ga0207667_10055614
271 Ga0207667_10398266
272 Ga0207640_10477514
273 Ga0207658_10546434
274 Ga0207703_10184119
275 Ga0207703_10541318
276 Ga0207678_10059739
277 Ga0207708_10553702
278 Ga0207702_10027190
279 Ga0207641_10531095
280 Ga0207676_10024384
281 Ga0207674_10067870
282 Ga0207674_10262474
283 Ga0207675_100118810
284 Ga0207675_100833711
285 Ga0207683_10446591
286 Ga0207683_11059708
287 Ga0207698_10019881
288 Ga0207698_10195594
289 Ga0207698_10374090
290 Ga0207428_10617198
291 Ga0268266_10874407
292 Ga0307511_10191013
293 Ga0373943_0255982
294 Ga0373942_0005554
295 Ga0373927_0122250
296 Ga0451853_2455567
297 Ga0466972_0059120
298 Ga0466966_0043997
299 Ga0466966_0075479
300 Ga0466966_0136096
301 Ga0466966_0334153
302 Ga0466961_0017814
303 Ga0466961_0135003
304 Ga0466961_0242124
305 Ga0466961_0434625
306 Ga0466961_0509462
307 Ga0466963_0372671
308 Ga0466964_0199101
309 Ga0466971_0082243
310 Ga0466970_0062656
311 Ga0466970_0182134
312 Ga0466970_0231213
313 Ga0466970_0236199
314 Ga0466959_0180521
315 Ga0466958_0315264
316 Ga0466958_0583927
317 Ga0466967_0199656
318 Ga0466967_0210836
319 Ga0466967_0266039
320 Ga0466967_1032065
321 Ga0495629_0055506
322 Ga0495641_0418303
323 Ga0495662_0500024
324 Ga0495664_0077301
325 Ga0495664_0625077
326 Ga0495665_0000709
327 Ga0495586_0003928
328 Ga0495587_0022960
329 Ga0495645_0012546
330 Ga0495667_0016886
331 Ga0495635_0074917
332 Ga0495635_0199783
333 Ga0495588_0045063
334 Ga0495588_0545849
335 Ga0495600_0017269
336 Ga0495581_0046099
337 Ga0495675_0019304
338 Ga0496101_0616131
339 Ga0496101_1068824
340 Ga0496102_0569120
341 Ga0496104_0056783
342 Ga0496104_0179870
343 Ga0496104_0414188
344 Ga0496104_0632313
345 Ga0496105_0062564
346 Ga0496105_0616133
347 Ga0496108_0008680
348 Ga0496108_0031873
349 Ga0496108_0055150
350 Ga0496108_0247651
351 Ga0496109_0034884
352 Ga0496109_0049158
353 Ga0496109_0200670
354 Ga0496110_0024454
355 Ga0496110_0251576
356 Ga0496111_0039786
357 Ga0496112_0030955
358 Ga0496113_0092517
359 Ga0496114_0001963
360 Ga0496114_0251825
361 Ga0501032_0002322
362 Ga0501034_0000016
363 Ga0501037_0038366
364 Ga0501043_0031178
365 Ga0501047_0598753
366 Ga0501073_0418531
367 Ga0501035_1012610
368 Ga0501044_0521601
369 nmdc:mga03n38_145595_c1
370 nmdc:mga09592_1004189_c1
371 nmdc:mga08y16_494693_c1
372 Ga0500568_0000957
373 Ga0466962_0059465
374 2816425230
375 2816505439
376 2870783542

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04073

tRNA_edit

Aminoacyl-tRNA editing domain

41

161

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rij-assembly3.cif.gz_C epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.9016 1 150
2cx5-assembly3.cif.gz_C crystal structure of a putative trans-editing enzyme for prolyl trna synthetase 0.8944 1 150
3rij-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8918 1 150
1wdv-assembly2.cif.gz_B crystal structure of hypothetical protein ape2540 0.8892 8 150
3ri0-assembly2.cif.gz_B epitope backbone grafting by computational design for improved presentation of linear epitopes on scaffold proteins 0.8865 3 150
ID Description Score Start End Superfamily
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.9016 1 150 3.90.960.10
af_Q4D973_68_232_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.884 3 150 3.90.960.10
af_Q4DLP0_103_258_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8826 38 151 3.90.960.10
3rijC00 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8791 1 150 3.90.960.10
af_A4HRV9_8_202_3.90.960.10 Alpha Beta;Alpha-Beta Complex;YbaK protein;YbaK/aminoacyl-tRNA synthetase-associated domain 0.8726 19 151 3.90.960.10
ID Description Score Start End GO Terms
AF-A0A6J6F315-F1-model_v4 Unannotated protein 0.9953 48 151 GO:0002161
AF-A0A511CUC9-F1-model_v4 YbaK/aminoacyl-tRNA synthetase-associated domain-containing protein 0.9929 7 151 GO:0002161
AF-A0A353FY59-F1-model_v4 deleted 0.9886 43 150
AF-A0A561SUG0-F1-model_v4 Prolyl-tRNA editing enzyme YbaK/EbsC (Cys-tRNA(Pro) deacylase) 0.9857 1 151 GO:0002161
AF-A0A367FDG1-F1-model_v4 YbaK/EbsC family protein 0.9856 26 151 GO:0002161

Map