F288329

General Info

Members Datasets Scaffolds Average Seq Length
187 154 374 505

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0061496|Ga0501033_0061496_154_1788
Length 544
Sequence MTPTTTPTDPTRDSSPSAGALAGRREWAALGVLMLPLLLVSMDVSVLYFAIPAITADLEPSGTQQLWIFDIYAFVLAGLLMTMGALGDRFGRRRLLLAGAAAFGAASLVAAYANSAETLIAARAVLGLGGATLMPSTMALLRTMFTDPGQRAKAIGLWSGVMTGGIALGSVLSGVLVQYFWWGSVFLVNLPAMAMLLLLGPLLLPESRSPEPGRFDLVSVPLSLAAVLPVVYGLKEIPTEGWNVRYVVSVTVGLLFAALFVHRQRTAAAPMIPPALLRVRGFSPALALNLLSSFAMLGSAFFTTQYLQSVLGMSALEAALWALLPSVLIGVAAPVAAGLVRRGVDRAYVVAGGFVVAAGGYGLLALAGADSLWVVLXXAGVLASGIVTVMSQVTDLALGAAPVERAGTASSLMETASEFGGALGMAVLGAIGTAVYRHGVGSEAPEAARQTLGGALAVAEGMPGDAGAGLVAVARGAFVDGMRGAAVTGAVLLLAAACLALRTLRATRPHPAAAPPHEHAQPDLARGAGNCAPSHARSAADEPA

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
6 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
7 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
8 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
9 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
10 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
11 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
12 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
13 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
14 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
15 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
16 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
17 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
18 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
19 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
20 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
21 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
22 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
23 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
24 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
25 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
26 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
27 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
28 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
29 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
30 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
31 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
32 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
33 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
34 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
35 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
36 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
37 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
38 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
39 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
40 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
41 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
42 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
43 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
44 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
45 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
46 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
47 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
48 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
49 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
50 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
51 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
52 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
53 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
54 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
55 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
56 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
57 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
58 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
59 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
60 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
61 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
62 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
63 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
64 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
65 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
66 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
67 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
68 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
69 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
70 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
71 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
72 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
73 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
74 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
75 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
76 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
77 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
78 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
79 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
80 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
81 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
82 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
83 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
84 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
85 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
86 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
87 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
88 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
89 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
90 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
99 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
100 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
101 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
102 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
103 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
104 2643221647 Streptomyces sp. Root369 Isolate Unclassified
105 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
106 2643221714 Streptomyces sp. Root264 Isolate Unclassified
107 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
108 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
109 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
110 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
111 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
112 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
113 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
114 2808606448 Streptomyces sp. 193411 Isolate Unclassified
115 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
116 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
117 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
118 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
119 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
120 2867428634 Streptomyces sp. RP5T Isolate Unclassified
121 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
122 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
123 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
124 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
125 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
126 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
127 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
128 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
129 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
130 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
131 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
132 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
133 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
134 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
135 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
136 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
137 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
138 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
139 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
140 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
141 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
142 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
143 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
144 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
145 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
146 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
147 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
148 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
149 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
150 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
151 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
152 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
153 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
154 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.12
Metatranscriptomes 0
Isolates 28.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 0.53
Rhizosphere 75.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0061496 3300049570 Bacteria 2767
2 JGI24739J22299_10006641 3300001989 Bacteria 4355
3 rootL2_10074994 3300003322 Bacteria 2716
4 rootH1_10123589 3300003323 Bacteria 1960
5 Ga0068856_100319903 3300005614 Bacteria 1569
6 Ga0105246_10019328 3300011119 Bacteria 4351
7 Ga0157372_10316398 3300013307 Bacteria 1817
8 Ga0183367_1013 3300015688 Bacteria 334176
9 Ga0209758_1003938 3300025297 Bacteria 12900
10 Ga0207667_10159868 3300025949 Bacteria 2317
11 Ga0307517_10035283 3300028786 Bacteria 5667
12 Ga0307515_10003908 3300028794 Bacteria 31077
13 Ga0307511_10000110 3300030521 Bacteria 74100
14 Ga0307512_10004360 3300030522 Bacteria 15591
15 Ga0307512_10025418 3300030522 Bacteria 5248
16 Ga0307513_10074719 3300031456 Bacteria 3523
17 Ga0307513_10094089 3300031456 Bacteria 3043
18 Ga0307509_10019149 3300031507 Bacteria 7823
19 Ga0307509_10055138 3300031507 Bacteria 4226
20 Ga0307508_10025433 3300031616 Bacteria 5368
21 Ga0307508_10029060 3300031616 Bacteria 4997
22 Ga0307508_10083629 3300031616 Bacteria 2774
23 Ga0307514_10017217 3300031649 Bacteria 5951
24 Ga0307514_10017890 3300031649 Bacteria 5823
25 Ga0307516_10002503 3300031730 Bacteria 24497
26 Ga0307407_10047904 3300031903 Bacteria 2429
27 Ga0307507_10076544 3300033179 Bacteria 2983
28 Ga0307510_10006475 3300033180 Bacteria 13969
29 Ga0307510_10036589 3300033180 Bacteria 5461
30 Ga0395898_0003904 3300037466 Bacteria 16464
31 Ga0439436_0004432 3300041404 Bacteria 4300
32 Ga0439448_0009314 3300042005 Bacteria 2892
33 Ga0439457_005311 3300042014 Bacteria 3256
34 Ga0450903_000078 3300042138 Bacteria 19917
35 Ga0439458_0007696 3300042157 Bacteria 2399
36 Ga0466969_0024290 3300044656 Bacteria 3117
37 Ga0466969_0059238 3300044656 Bacteria 1862
38 Ga0466972_0014341 3300044658 Bacteria 3970
39 Ga0466972_0017327 3300044658 Bacteria 3606
40 Ga0466972_0031682 3300044658 Bacteria 2599
41 Ga0466965_0009406 3300044683 Bacteria 4542
42 Ga0466966_0014570 3300044684 Bacteria 5204
43 Ga0466966_0014935 3300044684 Bacteria 5139
44 Ga0466961_0001381 3300044693 Bacteria 15000
45 Ga0466961_0005365 3300044693 Bacteria 8067
46 Ga0466963_0001198 3300044694 Bacteria 13658
47 Ga0466963_0028812 3300044694 Bacteria 3569
48 Ga0466971_0052457 3300044719 Bacteria 1837
49 Ga0466968_0014174 3300044735 Bacteria 3147
50 Ga0466970_0000805 3300044765 Bacteria 15119
51 Ga0466957_0003459 3300044842 Bacteria 8666
52 Ga0466959_0000282 3300045049 Bacteria 31016
53 Ga0466959_0029458 3300045049 Bacteria 4067
54 Ga0466958_0001340 3300045836 Bacteria 11623
55 Ga0466967_0004656 3300045976 Bacteria 9308
56 Ga0466967_0032138 3300045976 Bacteria 4428
57 Ga0495617_005301 3300046452 Bacteria 4589
58 Ga0495592_0084307 3300046454 Bacteria 2293
59 Ga0495603_0004341 3300046455 Bacteria 8457
60 Ga0495603_0009402 3300046455 Bacteria 5906
61 Ga0495603_0039686 3300046455 Bacteria 2819
62 Ga0495603_0040888 3300046455 Bacteria 2773
63 Ga0495590_0027932 3300046457 Bacteria 1979
64 Ga0495629_0008887 3300046459 Bacteria 7389
65 Ga0495638_0111023 3300046460 Bacteria 1629
66 Ga0495651_0043206 3300046462 Bacteria 3497
67 Ga0495639_0008776 3300046475 Bacteria 4336
68 Ga0495664_0037214 3300046477 Bacteria 2871
69 Ga0495607_0031569 3300046501 Bacteria 3241
70 Ga0495606_0004674 3300046507 Bacteria 13530
71 Ga0495616_0061163 3300046513 Bacteria 1847
72 Ga0495620_0016735 3300046515 Bacteria 3671
73 Ga0495620_0044166 3300046515 Bacteria 1937
74 Ga0495628_0022205 3300046516 Bacteria 5215
75 Ga0495630_0147419 3300046517 Bacteria 1790
76 Ga0495631_0045573 3300046518 Bacteria 1930
77 Ga0495632_0085660 3300046519 Bacteria 1499
78 Ga0495637_0029533 3300046520 Bacteria 2440
79 Ga0495643_0001682 3300046522 Bacteria 19312
80 Ga0495652_0036114 3300046529 Bacteria 4298
81 Ga0495654_0039938 3300046530 Bacteria 2340
82 Ga0495640_0012623 3300046533 Bacteria 6448
83 Ga0495587_0001766 3300046536 Bacteria 14457
84 Ga0495597_0048245 3300046542 Bacteria 1884
85 Ga0495656_0053752 3300046615 Bacteria 1731
86 Ga0495668_0067246 3300046616 Bacteria 1971
87 Ga0495634_0003954 3300046642 Bacteria 11759
88 Ga0495588_0007507 3300046674 Bacteria 4966
89 Ga0495657_0021178 3300046675 Bacteria 4666
90 Ga0495657_0023857 3300046675 Bacteria 4365
91 Ga0495646_0035674 3300046680 Bacteria 3084
92 Ga0495613_0010275 3300046689 Bacteria 6953
93 Ga0495624_0032968 3300046690 Bacteria 3356
94 Ga0495671_0086101 3300046692 Bacteria 1539
95 Ga0495649_0040996 3300046694 Bacteria 2533
96 Ga0495649_0049304 3300046694 Bacteria 2287
97 Ga0495589_0009978 3300046794 Bacteria 4933
98 Ga0495589_0024037 3300046794 Bacteria 3098
99 Ga0495589_0069845 3300046794 Bacteria 1717
100 Ga0495581_0048446 3300047315 Bacteria 2454
101 Ga0495604_0046299 3300047317 Bacteria 3391
102 Ga0495636_0008742 3300047318 Bacteria 3991
103 Ga0495636_0018189 3300047318 Bacteria 2818
104 Ga0495676_0012596 3300047321 Bacteria 7615
105 Ga0495676_0030620 3300047321 Bacteria 4562
106 Ga0495680_0014645 3300047322 Bacteria 6782
107 Ga0495683_0033057 3300047323 Bacteria 2633
108 Ga0495687_023010 3300047443 Bacteria 2983
109 Ga0495675_0091229 3300047444 Bacteria 1912
110 Ga0495685_008958 3300047447 Bacteria 3336
111 Ga0495685_009348 3300047447 Bacteria 3273
112 Ga0495602_0052464 3300048088 Bacteria 3622
113 Ga0495614_0008105 3300048089 Bacteria 4671
114 Ga0495614_0009683 3300048089 Bacteria 4258
115 Ga0495614_0026381 3300048089 Bacteria 2504
116 Ga0495626_0024575 3300048091 Bacteria 2952
117 Ga0501032_0098514 3300049569 Bacteria 1937
118 Ga0501032_0114106 3300049569 Bacteria 1787
119 Ga0501034_0022658 3300049571 Bacteria 6398
120 Ga0501034_0116726 3300049571 Bacteria 2657
121 Ga0501036_0017450 3300049572 Bacteria 6000
122 Ga0501037_0010869 3300049573 Bacteria 6688
123 Ga0501043_0045944 3300049579 Bacteria 3433
124 Ga0501043_0126101 3300049579 Bacteria 2007
125 Ga0501047_0136665 3300049581 Bacteria 2331
126 Ga0501048_0010032 3300049582 Bacteria 7086
127 Ga0501035_0064365 3300049822 Bacteria 3259
128 Ga0501044_0050027 3300049823 Bacteria 4314
129 Ga0501044_0092618 3300049823 Bacteria 3048
130 Ga0501044_0096231 3300049823 Bacteria 2982
131 nmdc:mga06z11_19605_c1 3300050494 Bacteria 3113
132 Ga0500640_033954 3300053095 Bacteria 2239
133 Ga0466962_0000341 3300061719 Bacteria 20008
134 2585311252 2582581313 Bacteria 10042643
135 2585317879 2582581314 Bacteria 11452267
136 2616700500 2616644814 Bacteria 11555299
137 2644269478 2643221647 Bacteria 10741251
138 2644437875 2643221678 Bacteria 9540101
139 2644633490 2643221714 Bacteria 9015452
140 2784590537 2784132148 Bacteria 8627943
141 2785341056 2784746763 Bacteria 9783172
142 2785371694 2784746768 Bacteria 10036182
143 2786672805 2786546132 Bacteria 10419719
144 2793975808 2791355406 Bacteria 11364898
145 2808844159 2808606359 Bacteria 9866990
146 2808913770 2808606375 Bacteria 9466072
147 2809234230 2808606448 Bacteria 8656184
148 2812355808 2811994879 Bacteria 9313447
149 2812478609 2811994917 Bacteria 7761064
150 2819699392 2818991463 Bacteria 7948711
151 2862284587 2862281513 Bacteria 9621493
152 2863408785 2863404153 Bacteria 9672205
153 2867430485 2867428634 Bacteria 9590268
154 2877678896 2877676314 Bacteria 9512378
155 2887484781 2887478801 Bacteria 8972725
156 2912717465 2912715099 Bacteria 9460473
157 2912730023 2912723979 Bacteria 8557534
158 2919472389 2919468124 Bacteria 9133025
159 2946069980 2946064051 Bacteria 8957905
160 2946077884 2946072368 Bacteria 8999607
161 2947226789 2947224130 Bacteria 9938529
162 2954005690 2954002825 Bacteria 9173742
163 2954383860 2954380949 Bacteria 10050426
164 2954679109 2954673503 Bacteria 9685905
165 2954685044 2954682443 Bacteria 9862841
166 2954694659 2954691527 Bacteria 10720516
167 2954709863 2954701450 Bacteria 10834262
168 2954714161 2954711539 Bacteria 10867210
169 2954724114 2954721474 Bacteria 10456478
170 2954737725 2954731030 Bacteria 10243860
171 2954743010 2954740390 Bacteria 10229294
172 2954756561 2954749733 Bacteria 10366972
173 2954761968 2954759201 Bacteria 9358192
174 2990046230 2990044586 Bacteria 6603797
175 2990061179 2990059506 Bacteria 9321252
176 2997604242 2997600082 Bacteria 9896405
177 3006496720 3006493962 Bacteria 8825450
178 8008577019 8008574985 Bacteria 7815457
179 8023631173 8023623736 Bacteria 8593882
180 8047895907 8047893842 Bacteria 11723082
181 8048129183 8048127548 Bacteria 11053136
182 8048363027 8048356638 Bacteria 11044339
183 8048372931 8048369669 Bacteria 11666822
184 8048381865 8048379754 Bacteria 11877923
185 8048409155 8048406513 Bacteria 8936924
186 8056672202 8056667051 Bacteria 6953971
187 8056834053 8056829672 Bacteria 9045328
188 Ga0501033_0061496
189 JGI24739J22299_10006641
190 rootL2_10074994
191 rootH1_10123589
192 Ga0068856_100319903
193 Ga0105246_10019328
194 Ga0157372_10316398
195 Ga0183367_1013
196 Ga0209758_1003938
197 Ga0207667_10159868
198 Ga0307517_10035283
199 Ga0307515_10003908
200 Ga0307511_10000110
201 Ga0307512_10004360
202 Ga0307512_10025418
203 Ga0307513_10074719
204 Ga0307513_10094089
205 Ga0307509_10019149
206 Ga0307509_10055138
207 Ga0307508_10025433
208 Ga0307508_10029060
209 Ga0307508_10083629
210 Ga0307514_10017217
211 Ga0307514_10017890
212 Ga0307516_10002503
213 Ga0307407_10047904
214 Ga0307507_10076544
215 Ga0307510_10006475
216 Ga0307510_10036589
217 Ga0395898_0003904
218 Ga0439436_0004432
219 Ga0439448_0009314
220 Ga0439457_005311
221 Ga0450903_000078
222 Ga0439458_0007696
223 Ga0466969_0024290
224 Ga0466969_0059238
225 Ga0466972_0014341
226 Ga0466972_0017327
227 Ga0466972_0031682
228 Ga0466965_0009406
229 Ga0466966_0014570
230 Ga0466966_0014935
231 Ga0466961_0001381
232 Ga0466961_0005365
233 Ga0466963_0001198
234 Ga0466963_0028812
235 Ga0466971_0052457
236 Ga0466968_0014174
237 Ga0466970_0000805
238 Ga0466957_0003459
239 Ga0466959_0000282
240 Ga0466959_0029458
241 Ga0466958_0001340
242 Ga0466967_0004656
243 Ga0466967_0032138
244 Ga0495617_005301
245 Ga0495592_0084307
246 Ga0495603_0004341
247 Ga0495603_0009402
248 Ga0495603_0039686
249 Ga0495603_0040888
250 Ga0495590_0027932
251 Ga0495629_0008887
252 Ga0495638_0111023
253 Ga0495651_0043206
254 Ga0495639_0008776
255 Ga0495664_0037214
256 Ga0495607_0031569
257 Ga0495606_0004674
258 Ga0495616_0061163
259 Ga0495620_0016735
260 Ga0495620_0044166
261 Ga0495628_0022205
262 Ga0495630_0147419
263 Ga0495631_0045573
264 Ga0495632_0085660
265 Ga0495637_0029533
266 Ga0495643_0001682
267 Ga0495652_0036114
268 Ga0495654_0039938
269 Ga0495640_0012623
270 Ga0495587_0001766
271 Ga0495597_0048245
272 Ga0495656_0053752
273 Ga0495668_0067246
274 Ga0495634_0003954
275 Ga0495588_0007507
276 Ga0495657_0021178
277 Ga0495657_0023857
278 Ga0495646_0035674
279 Ga0495613_0010275
280 Ga0495624_0032968
281 Ga0495671_0086101
282 Ga0495649_0040996
283 Ga0495649_0049304
284 Ga0495589_0009978
285 Ga0495589_0024037
286 Ga0495589_0069845
287 Ga0495581_0048446
288 Ga0495604_0046299
289 Ga0495636_0008742
290 Ga0495636_0018189
291 Ga0495676_0012596
292 Ga0495676_0030620
293 Ga0495680_0014645
294 Ga0495683_0033057
295 Ga0495687_023010
296 Ga0495675_0091229
297 Ga0495685_008958
298 Ga0495685_009348
299 Ga0495602_0052464
300 Ga0495614_0008105
301 Ga0495614_0009683
302 Ga0495614_0026381
303 Ga0495626_0024575
304 Ga0501032_0098514
305 Ga0501032_0114106
306 Ga0501034_0022658
307 Ga0501034_0116726
308 Ga0501036_0017450
309 Ga0501037_0010869
310 Ga0501043_0045944
311 Ga0501043_0126101
312 Ga0501047_0136665
313 Ga0501048_0010032
314 Ga0501035_0064365
315 Ga0501044_0050027
316 Ga0501044_0092618
317 Ga0501044_0096231
318 nmdc:mga06z11_19605_c1
319 Ga0500640_033954
320 Ga0466962_0000341
321 2585311252
322 2585317879
323 2616700500
324 2644269478
325 2644437875
326 2644633490
327 2784590537
328 2785341056
329 2785371694
330 2786672805
331 2793975808
332 2808844159
333 2808913770
334 2809234230
335 2812355808
336 2812478609
337 2819699392
338 2862284587
339 2863408785
340 2867430485
341 2877678896
342 2887484781
343 2912717465
344 2912730023
345 2919472389
346 2946069980
347 2946077884
348 2947226789
349 2954005690
350 2954383860
351 2954679109
352 2954685044
353 2954694659
354 2954709863
355 2954714161
356 2954724114
357 2954737725
358 2954743010
359 2954756561
360 2954761968
361 2990046230
362 2990061179
363 2997604242
364 3006496720
365 8008577019
366 8023631173
367 8047895907
368 8048129183
369 8048363027
370 8048372931
371 8048381865
372 8048409155
373 8056672202
374 8056834053

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

33

425

0.86

PF00083

Sugar_tr

Sugar (and other) transporter

38

209

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.9024 10 497
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8701 10 497
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8481 23 499
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8365 23 499
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8263 23 502
ID Description Score Start End Superfamily
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9373 24 264 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9369 24 228 1.20.1250.20
af_Q2FW85_14_250_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9347 24 258 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9299 24 264 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9239 24 228 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A0S2C953-F1-model_v4 deleted 0.9479 20 169
AF-A0A6G7YGG6-F1-model_v4 MFS transporter 0.9314 31 500 GO:0005886
GO:0022857
AF-A0A3D5J5P7-F1-model_v4 Major facilitator superfamily (MFS) profile domain-containing protein 0.9274 22 191 GO:0005886
GO:0022857
AF-A0A7X7SSR9-F1-model_v4 MFS transporter 0.9233 1 210 GO:0016020
GO:0022857
AF-A0A7X7SSR9-F1-model_v4 MFS transporter 0.919 1 210 GO:0016020
GO:0022857

Map