F288158

General Info

Members Datasets Scaffolds Average Seq Length
187 131 177 254

Family's Representative Sequence

Representative Sequence 3300046471|Ga0495650_0037509|Ga0495650_0037509_312_1184
Length 290
Sequence LTLLSHKFLLPERRCASFLHERGLLPADTEKKMGKLDEQIAIVTGASSGIGEAIAQLYASEGASVLIVHHDDPHEAFRIVREICADGGKAIAAQADVRNEAGVDHALATARNAFGDPTLLVNSAGVDASGIEVSDMPTEQFMNVLRTNLVGPFLFCRAFVQGLKATGKKGKIINISSVHEDIPRAGAADYCASKGGLRNLTRCLALELAPLGITANGIAPGMVLTPMNQDAIDDPEKLKEQVASIPLKRAAQPEEVAELALYLASKAADYASGATFTLDGGLAMNLGQGA

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
8 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
9 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
10 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
71 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
72 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
81 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
82 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
83 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
84 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
85 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
86 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
87 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
88 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
89 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
90 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
91 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
92 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
104 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
109 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
110 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
111 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
112 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
113 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
119 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
120 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
121 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
122 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
123 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
124 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
125 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
126 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
127 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
128 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
129 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
130 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
131 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.65
Metatranscriptomes 0
Isolates 5.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.3
Nodule 0
Rhizoplane 1.6
Rhizosphere 71.66
Stem 0
Stem Tuber 0
Unclassified 14.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10004022 3300002459 Bacteria 2976
2 Ga0055530_10009305 3300003791 Bacteria 3794
3 Ga0065704_10252659 3300005289 Bacteria 985
4 Ga0070658_10001006 3300005327 Bacteria 24131
5 Ga0070670_100018467 3300005331 Bacteria 5983
6 Ga0070668_100000026 3300005347 Bacteria 92584
7 Ga0070668_100034832 3300005347 Bacteria 3837
8 Ga0070669_100033923 3300005353 Bacteria 3694
9 Ga0070671_100000266 3300005355 Bacteria 35281
10 Ga0070667_100000019 3300005367 Bacteria 224710
11 Ga0070667_100000089 3300005367 Bacteria 113661
12 Ga0070678_100612547 3300005456 Bacteria 973
13 Ga0070679_100153083 3300005530 Bacteria 2282
14 Ga0068853_100003098 3300005539 Bacteria 12711
15 Ga0070665_100015052 3300005548 Bacteria 7765
16 Ga0070665_100303040 3300005548 Bacteria 1601
17 Ga0068855_100193574 3300005563 Bacteria 2292
18 Ga0068857_100014635 3300005577 Bacteria 6842
19 Ga0068857_100342581 3300005577 Bacteria 1383
20 Ga0068854_100013348 3300005578 Bacteria 5389
21 Ga0068856_100012642 3300005614 Bacteria 8173
22 Ga0068856_100135079 3300005614 Bacteria 2472
23 Ga0068856_100316391 3300005614 Bacteria 1578
24 Ga0068852_100002240 3300005616 Bacteria 13269
25 Ga0068852_100010719 3300005616 Bacteria 6863
26 Ga0068859_100104189 3300005617 Bacteria 2896
27 Ga0068859_100146652 3300005617 Bacteria 2435
28 Ga0068864_100010955 3300005618 Bacteria 7496
29 Ga0068851_10029970 3300005834 Bacteria 2696
30 Ga0068863_100004376 3300005841 Bacteria 13926
31 Ga0068858_100003226 3300005842 Bacteria 16280
32 Ga0068860_100000042 3300005843 Bacteria 227404
33 Ga0068860_100000148 3300005843 Bacteria 113661
34 Ga0068862_100013521 3300005844 Bacteria 6760
35 Ga0075370_10055785 3300006353 Bacteria 2245
36 Ga0097620_100104182 3300006931 Bacteria 2896
37 Ga0097620_100146651 3300006931 Bacteria 2435
38 Ga0105240_10030583 3300009093 Bacteria 6996
39 Ga0105248_10011619 3300009177 Bacteria 9700
40 Ga0157372_10396902 3300013307 Bacteria 1607
41 Ga0183363_1001 3300015690 Bacteria 611534
42 Ga0209050_1001007 3300025298 Bacteria 35235
43 Ga0209050_1033577 3300025298 Unclassified 1553
44 Ga0207697_10062249 3300025315 Bacteria 1553
45 Ga0207647_10064963 3300025904 Bacteria 2216
46 Ga0207705_10000009 3300025909 Bacteria 576128
47 Ga0207695_10038028 3300025913 Bacteria 5187
48 Ga0207652_10009509 3300025921 Bacteria 7816
49 Ga0207650_10000657 3300025925 Bacteria 27265
50 Ga0207644_10000067 3300025931 Bacteria 76116
51 Ga0207667_10121144 3300025949 Bacteria 2695
52 Ga0207668_10000081 3300025972 Bacteria 72145
53 Ga0207668_10009473 3300025972 Bacteria 5840
54 Ga0207640_10019496 3300025981 Bacteria 4008
55 Ga0207658_10000002 3300025986 Bacteria 1364188
56 Ga0207658_10000069 3300025986 Bacteria 113687
57 Ga0207703_10003677 3300026035 Bacteria 12782
58 Ga0207639_10006159 3300026041 Bacteria 8144
59 Ga0207639_10111180 3300026041 Bacteria 2233
60 Ga0207702_10002082 3300026078 Bacteria 19328
61 Ga0207702_10224936 3300026078 Bacteria 1750
62 Ga0207702_10397945 3300026078 Bacteria 1328
63 Ga0207641_10001591 3300026088 Bacteria 22178
64 Ga0207641_10049453 3300026088 Bacteria 3552
65 Ga0207676_10027084 3300026095 Bacteria 4266
66 Ga0207674_10019228 3300026116 Bacteria 7405
67 Ga0207674_10430586 3300026116 Bacteria 1275
68 Ga0207683_10314120 3300026121 Bacteria 1435
69 Ga0207698_10126740 3300026142 Bacteria 2173
70 Ga0268266_10007198 3300028379 Bacteria 10074
71 Ga0268264_10000001 3300028381 Bacteria 1221000
72 Ga0268264_10000217 3300028381 Bacteria 113674
73 Ga0307408_100016700 3300031548 Bacteria 4906
74 Ga0307405_10018263 3300031731 Bacteria 3866
75 Ga0307405_10021474 3300031731 Bacteria 3630
76 Ga0307405_10464129 3300031731 Bacteria 1007
77 Ga0307413_10048426 3300031824 Bacteria 2540
78 Ga0307413_10101079 3300031824 Bacteria 1905
79 Ga0307413_10263131 3300031824 Bacteria 1287
80 Ga0307413_10422899 3300031824 Bacteria 1050
81 Ga0307410_10014837 3300031852 Bacteria 4600
82 Ga0307410_10211804 3300031852 Bacteria 1485
83 Ga0307410_10353804 3300031852 Bacteria 1174
84 Ga0307406_10036406 3300031901 Bacteria 3032
85 Ga0307406_10041789 3300031901 Bacteria 2859
86 Ga0307407_10155426 3300031903 Bacteria 1491
87 Ga0307412_10025889 3300031911 Bacteria 3639
88 Ga0307412_10066546 3300031911 Bacteria 2443
89 Ga0307412_10372603 3300031911 Bacteria 1153
90 Ga0307409_100175595 3300031995 Bacteria 1890
91 Ga0307416_100092739 3300032002 Bacteria 2599
92 Ga0307414_10003863 3300032004 Bacteria 8064
93 Ga0307414_10049837 3300032004 Bacteria 2897
94 Ga0307414_10062563 3300032004 Bacteria 2642
95 Ga0307411_10014796 3300032005 Bacteria 4356
96 Ga0307411_10060005 3300032005 Bacteria 2524
97 Ga0307415_100017380 3300032126 Bacteria 4311
98 Ga0307415_100461975 3300032126 Bacteria 1100
99 Ga0495638_0030074 3300046460 Bacteria 3499
100 Ga0495638_0069516 3300046460 Bacteria 2158
101 Ga0495650_0037509 3300046471 Bacteria 2109
102 Ga0495596_0001479 3300046500 Bacteria 13427
103 Ga0495610_0002582 3300046512 Bacteria 15032
104 Ga0495663_0002151 3300046525 Bacteria 6009
105 Ga0495654_0121978 3300046530 Bacteria 1178
106 Ga0495633_0027985 3300046558 Bacteria 2749
107 Ga0495673_0033576 3300047469 Unclassified 2380
108 Ga0495686_0000084 3300047472 Bacteria 198253
109 Ga0495686_0036562 3300047472 Bacteria 3152
110 Ga0495626_0002509 3300048091 Bacteria 12657
111 Ga0496102_0000034 3300048905 Bacteria 213826
112 Ga0496103_0000026 3300048906 Bacteria 213826
113 Ga0496105_0154823 3300048908 Bacteria 1883
114 Ga0496116_0000093 3300048919 Bacteria 205660
115 Ga0496116_0005056 3300048919 Bacteria 12407
116 Ga0496117_0000072 3300048920 Bacteria 238366
117 Ga0496118_0000030 3300048921 Bacteria 339946
118 Ga0496118_0096978 3300048921 Bacteria 2008
119 Ga0496119_0058429 3300048922 Bacteria 2324
120 Ga0496119_0156841 3300048922 Bacteria 1214
121 Ga0496121_0000168 3300048924 Bacteria 144896
122 Ga0496121_0000512 3300048924 Bacteria 73820
123 Ga0496121_0003037 3300048924 Bacteria 24370
124 Ga0496122_0018477 3300048925 Bacteria 6434
125 Ga0496123_0023428 3300048926 Bacteria 4725
126 Ga0496124_0000061 3300048927 Bacteria 238225
127 Ga0496124_0001125 3300048927 Bacteria 42064
128 Ga0496125_0027500 3300048928 Bacteria 5154
129 Ga0496125_0033294 3300048928 Bacteria 4562
130 Ga0496125_0047392 3300048928 Bacteria 3594
131 Ga0496125_0071096 3300048928 Bacteria 2720
132 Ga0496125_0153809 3300048928 Bacteria 1575
133 Ga0496126_0000371 3300048929 Bacteria 92747
134 Ga0496126_0014860 3300048929 Bacteria 7853
135 Ga0501032_0008346 3300049569 Bacteria 7550
136 Ga0501032_0029013 3300049569 Bacteria 3800
137 Ga0501033_0378701 3300049570 Bacteria 989
138 Ga0501034_0117047 3300049571 Bacteria 2653
139 Ga0501034_0197257 3300049571 Bacteria 1972
140 Ga0501034_0490404 3300049571 Bacteria 1143
141 Ga0501037_0060071 3300049573 Bacteria 2773
142 Ga0501038_0013064 3300049574 Bacteria 7573
143 Ga0501038_0275445 3300049574 Bacteria 1326
144 Ga0501039_0152736 3300049575 Bacteria 1814
145 Ga0501043_0007004 3300049579 Bacteria 8981
146 Ga0501043_0268986 3300049579 Bacteria 1309
147 Ga0501047_0002410 3300049581 Bacteria 17866
148 Ga0501047_0186598 3300049581 Bacteria 1939
149 Ga0501048_0086215 3300049582 Bacteria 2215
150 Ga0501070_0102611 3300049586 Bacteria 2365
151 Ga0501073_0168062 3300049589 Bacteria 1518
152 Ga0501074_0030523 3300049590 Bacteria 3906
153 Ga0501080_0135454 3300049742 Bacteria 2279
154 Ga0501282_001505 3300049778 Bacteria 2579
155 Ga0501035_0233132 3300049822 Bacteria 1568
156 Ga0501044_0000077 3300049823 Bacteria 119196
157 Ga0501044_0040689 3300049823 Bacteria 4843
158 Ga0501044_0094308 3300049823 Bacteria 3018
159 nmdc:mga0k408_114629_c1 3300050493 Bacteria 1594
160 nmdc:mga0k408_8442_c1 3300050493 Bacteria 5529
161 nmdc:mga07m45_46774_c1 3300050496 Bacteria 2431
162 Ga0500643_000326 3300053087 Bacteria 38307
163 Ga0500647_0007038 3300053091 Bacteria 4800
164 Ga0500572_000681 3300053111 Bacteria 11163
165 Ga0500592_000322 3300053116 Bacteria 8191
166 Ga0500607_000082 3300053121 Bacteria 70790
167 Ga0500608_011410 3300053122 Bacteria 3858
168 Ga0500559_0000199 3300053136 Bacteria 47863
169 Ga0500568_0039896 3300053139 Bacteria 1893
170 Ga0500590_038305 3300053148 Bacteria 2474
171 Ga0500590_089255 3300053148 Bacteria 1500
172 Ga0500604_0120870 3300053151 Unclassified 876
173 Ga0500624_000024 3300053157 Bacteria 114404
174 Ga0500627_0037182 3300053158 Bacteria 2077
175 Ga0500636_0007790 3300053177 Bacteria 6195
176 Ga0500645_003328 3300053730 Bacteria 6597
177 Ga0500552_007381 3300053733 Bacteria 1266

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10011619 Ga0105248_100116195 229
2 3300048928 Ga0496125_0027500 Ga0496125_0027500_2020_2817 229
3 3300032005 Ga0307411_10060005 Ga0307411_100600052 234
4 3300046525 Ga0495663_0002151 Ga0495663_0002151_1147_1968 234
5 3300048922 Ga0496119_0156841 Ga0496119_0156841_24_728 234
6 3300053116 Ga0500592_000322 Ga0500592_000322_5080_5901 234
7 3300053139 Ga0500568_0039896 Ga0500568_0039896_890_1711 234
8 3300025315 Ga0207697_10062249 Ga0207697_100622492 235
9 3300031824 Ga0307413_10048426 Ga0307413_100484261 236
10 3300031852 Ga0307410_10014837 Ga0307410_100148376 236
11 3300031903 Ga0307407_10155426 Ga0307407_101554262 236
12 3300031995 Ga0307409_100175595 Ga0307409_1001755952 236
13 3300032004 Ga0307414_10049837 Ga0307414_100498372 236
14 3300049569 Ga0501032_0029013 Ga0501032_0029013_2800_3591 236
15 3300049571 Ga0501034_0197257 Ga0501034_0197257_449_1240 236
16 3300049573 Ga0501037_0060071 Ga0501037_0060071_382_1173 236
17 3300049574 Ga0501038_0013064 Ga0501038_0013064_1119_1910 236
18 3300049579 Ga0501043_0268986 Ga0501043_0268986_489_1280 236
19 3300049581 Ga0501047_0186598 Ga0501047_0186598_877_1668 236
20 3300049586 Ga0501070_0102611 Ga0501070_0102611_1268_2059 236
21 3300049589 Ga0501073_0168062 Ga0501073_0168062_364_1155 236
22 3300049590 Ga0501074_0030523 Ga0501074_0030523_1081_1872 236
23 3300049742 Ga0501080_0135454 Ga0501080_0135454_460_1251 236
24 3300049823 Ga0501044_0040689 Ga0501044_0040689_199_990 236
25 3300046512 Ga0495610_0002582 Ga0495610_0002582_4247_5038 242
26 3300047472 Ga0495686_0036562 Ga0495686_0036562_623_1390 243
27 3300048905 Ga0496102_0000034 Ga0496102_0000034_202885_203640 243
28 3300048906 Ga0496103_0000026 Ga0496103_0000026_202885_203640 243
29 3300048908 Ga0496105_0154823 Ga0496105_0154823_917_1672 243
30 3300048919 Ga0496116_0005056 Ga0496116_0005056_10187_10942 243
31 3300048920 Ga0496117_0000072 Ga0496117_0000072_227425_228180 243
32 3300048921 Ga0496118_0000030 Ga0496118_0000030_10187_10942 243
33 3300048922 Ga0496119_0058429 Ga0496119_0058429_1368_2123 243
34 3300048927 Ga0496124_0000061 Ga0496124_0000061_10187_10942 243
35 3300005530 Ga0070679_100153083 Ga0070679_1001530832 244
36 3300025921 Ga0207652_10009509 Ga0207652_100095092 244
37 3300003791 Ga0055530_10009305 Ga0055530_100093054 245
38 3300025298 Ga0209050_1001007 Ga0209050_100100718 245
39 3300047469 Ga0495673_0033576 Ga0495673_0033576_45_791 248
40 3300048928 Ga0496125_0033294 Ga0496125_0033294_3421_4188 248
41 3300031824 Ga0307413_10101079 Ga0307413_101010792 249
42 3300049822 Ga0501035_0233132 Ga0501035_0233132_402_1193 249
43 3300050493 nmdc:mga0k408_114629_c1 nmdc:mga0k408_114629_c1_825_1574 249
44 3300005289 Ga0065704_10252659 Ga0065704_102526591 250
45 3300005347 Ga0070668_100034832 Ga0070668_1000348323 250
46 3300005841 Ga0068863_100004376 Ga0068863_1000043764 250
47 3300025972 Ga0207668_10009473 Ga0207668_100094732 250
48 3300031548 Ga0307408_100016700 Ga0307408_1000167003 250
49 3300031731 Ga0307405_10018263 Ga0307405_100182633 250
50 3300031731 Ga0307405_10021474 Ga0307405_100214743 250
51 3300031731 Ga0307405_10464129 Ga0307405_104641291 250
52 3300031824 Ga0307413_10263131 Ga0307413_102631312 250
53 3300031824 Ga0307413_10422899 Ga0307413_104228992 250
54 3300031852 Ga0307410_10211804 Ga0307410_102118042 250
55 3300031852 Ga0307410_10353804 Ga0307410_103538042 250
56 3300031901 Ga0307406_10036406 Ga0307406_100364064 250
57 3300031901 Ga0307406_10041789 Ga0307406_100417892 250
58 3300031911 Ga0307412_10025889 Ga0307412_100258892 250
59 3300031911 Ga0307412_10066546 Ga0307412_100665462 250
60 3300031911 Ga0307412_10372603 Ga0307412_103726032 250
61 3300032002 Ga0307416_100092739 Ga0307416_1000927392 250
62 3300032004 Ga0307414_10003863 Ga0307414_100038636 250
63 3300032004 Ga0307414_10062563 Ga0307414_100625633 250
64 3300032005 Ga0307411_10014796 Ga0307411_100147962 250
65 3300032126 Ga0307415_100017380 Ga0307415_1000173803 250
66 3300032126 Ga0307415_100461975 Ga0307415_1004619752 250
67 3300048928 Ga0496125_0071096 Ga0496125_0071096_375_1142 250
68 iso_pu_bacteria 2739367865 2740029715 251
69 iso_pu_bacteria 2574179768 2574428991 252
70 3300005539 Ga0068853_100003098 Ga0068853_10000309810 253
71 3300005577 Ga0068857_100014635 Ga0068857_1000146356 253
72 3300005614 Ga0068856_100316391 Ga0068856_1003163912 253
73 3300005616 Ga0068852_100010719 Ga0068852_1000107192 253
74 3300005834 Ga0068851_10029970 Ga0068851_100299702 253
75 3300026041 Ga0207639_10006159 Ga0207639_100061596 253
76 3300026078 Ga0207702_10397945 Ga0207702_103979451 253
77 3300026116 Ga0207674_10019228 Ga0207674_100192286 253
78 3300048924 Ga0496121_0000512 Ga0496121_0000512_56056_56877 253
79 3300048929 Ga0496126_0014860 Ga0496126_0014860_671_1492 253
80 3300015690 Ga0183363_1001 Ga0183363_1001466 254
81 3300046460 Ga0495638_0030074 Ga0495638_0030074_892_1656 254
82 3300048928 Ga0496125_0153809 Ga0496125_0153809_668_1432 254
83 3300049569 Ga0501032_0008346 Ga0501032_0008346_3763_4554 254
84 3300049571 Ga0501034_0490404 Ga0501034_0490404_167_958 254
85 3300049579 Ga0501043_0007004 Ga0501043_0007004_1189_1980 254
86 3300049581 Ga0501047_0002410 Ga0501047_0002410_7183_7974 254
87 3300049582 Ga0501048_0086215 Ga0501048_0086215_815_1606 254
88 3300049823 Ga0501044_0094308 Ga0501044_0094308_518_1309 254
89 iso_pu_bacteria 2582581305 2585261019 254
90 iso_pu_bacteria 2830075706 2830077727 254
91 3300005614 Ga0068856_100135079 Ga0068856_1001350792 255
92 3300026078 Ga0207702_10224936 Ga0207702_102249362 255
93 3300026116 Ga0207674_10430586 Ga0207674_104305862 255
94 3300049575 Ga0501039_0152736 Ga0501039_0152736_936_1709 256
95 3300005327 Ga0070658_10001006 Ga0070658_1000100618 257
96 3300005367 Ga0070667_100000089 Ga0070667_10000008967 257
97 3300005456 Ga0070678_100612547 Ga0070678_1006125471 257
98 3300005548 Ga0070665_100303040 Ga0070665_1003030402 257
99 3300005563 Ga0068855_100193574 Ga0068855_1001935743 257
100 3300005577 Ga0068857_100342581 Ga0068857_1003425812 257
101 3300005578 Ga0068854_100013348 Ga0068854_1000133485 257
102 3300005614 Ga0068856_100012642 Ga0068856_1000126428 257
103 3300005616 Ga0068852_100002240 Ga0068852_1000022402 257
104 3300005617 Ga0068859_100104189 Ga0068859_1001041893 257
105 3300005843 Ga0068860_100000148 Ga0068860_10000014864 257
106 3300006353 Ga0075370_10055785 Ga0075370_100557852 257
107 3300006931 Ga0097620_100104182 Ga0097620_1001041823 257
108 3300009093 Ga0105240_10030583 Ga0105240_100305838 257
109 3300013307 Ga0157372_10396902 Ga0157372_103969022 257
110 3300025904 Ga0207647_10064963 Ga0207647_100649632 257
111 3300025909 Ga0207705_10000009 Ga0207705_10000009261 257
112 3300025913 Ga0207695_10038028 Ga0207695_100380286 257
113 3300025949 Ga0207667_10121144 Ga0207667_101211442 257
114 3300025981 Ga0207640_10019496 Ga0207640_100194962 257
115 3300025986 Ga0207658_10000069 Ga0207658_1000006961 257
116 3300026041 Ga0207639_10111180 Ga0207639_101111802 257
117 3300026078 Ga0207702_10002082 Ga0207702_1000208219 257
118 3300026088 Ga0207641_10049453 Ga0207641_100494534 257
119 3300026121 Ga0207683_10314120 Ga0207683_103141201 257
120 3300026142 Ga0207698_10126740 Ga0207698_101267401 257
121 3300028381 Ga0268264_10000217 Ga0268264_1000021761 257
122 3300046460 Ga0495638_0069516 Ga0495638_0069516_910_1683 257
123 3300046530 Ga0495654_0121978 Ga0495654_0121978_354_1127 257
124 3300046558 Ga0495633_0027985 Ga0495633_0027985_596_1369 257
125 3300050496 nmdc:mga07m45_46774_c1 nmdc:mga07m45_46774_c1_1360_2133 257
126 3300053111 Ga0500572_000681 Ga0500572_000681_7601_8374 257
127 3300053121 Ga0500607_000082 Ga0500607_000082_38382_39155 257
128 3300053136 Ga0500559_0000199 Ga0500559_0000199_8300_9073 257
129 3300053148 Ga0500590_038305 Ga0500590_038305_1581_2354 257
130 3300053148 Ga0500590_089255 Ga0500590_089255_159_932 257
131 3300053151 Ga0500604_0120870 Ga0500604_0120870_66_839 257
132 3300053157 Ga0500624_000024 Ga0500624_000024_13161_13934 257
133 3300053730 Ga0500645_003328 Ga0500645_003328_3524_4297 257
134 3300053733 Ga0500552_007381 Ga0500552_007381_48_821 257
135 3300049823 Ga0501044_0000077 Ga0501044_0000077_100726_101502 258
136 3300053158 Ga0500627_0037182 Ga0500627_0037182_1029_1805 258
137 3300053177 Ga0500636_0007790 Ga0500636_0007790_664_1440 258
138 3300049778 Ga0501282_001505 Ga0501282_001505_1679_2458 259
139 3300053091 Ga0500647_0007038 Ga0500647_0007038_3266_4045 259
140 iso_pu_bacteria 2643221541 2643730931 259
141 iso_pu_bacteria 2643221605 2644038103 259
142 iso_pu_bacteria 2643221606 2644044416 259
143 iso_pu_bacteria 2643221671 2644391660 259
144 iso_pu_bacteria 2919138771 2919140518 259
145 3300047472 Ga0495686_0000084 Ga0495686_0000084_110233_111021 261
146 iso_pu_bacteria 3000017691 3000019619 262
147 3300002459 JGI24751J29686_10004022 JGI24751J29686_100040221 263
148 3300005331 Ga0070670_100018467 Ga0070670_1000184672 263
149 3300005347 Ga0070668_100000026 Ga0070668_10000002661 263
150 3300005353 Ga0070669_100033923 Ga0070669_1000339234 263
151 3300005355 Ga0070671_100000266 Ga0070671_10000026625 263
152 3300005367 Ga0070667_100000019 Ga0070667_100000019178 263
153 3300005548 Ga0070665_100015052 Ga0070665_1000150523 263
154 3300005617 Ga0068859_100146652 Ga0068859_1001466523 263
155 3300005618 Ga0068864_100010955 Ga0068864_1000109558 263
156 3300005842 Ga0068858_100003226 Ga0068858_10000322613 263
157 3300005843 Ga0068860_100000042 Ga0068860_1000000424 263
158 3300005844 Ga0068862_100013521 Ga0068862_1000135216 263
159 3300006931 Ga0097620_100146651 Ga0097620_1001466513 263
160 3300025298 Ga0209050_1033577 Ga0209050_10335772 263
161 3300025925 Ga0207650_10000657 Ga0207650_100006573 263
162 3300025931 Ga0207644_10000067 Ga0207644_1000006715 263
163 3300025972 Ga0207668_10000081 Ga0207668_1000008125 263
164 3300025986 Ga0207658_10000002 Ga0207658_10000002205 263
165 3300026035 Ga0207703_10003677 Ga0207703_1000367710 263
166 3300026088 Ga0207641_10001591 Ga0207641_1000159116 263
167 3300026095 Ga0207676_10027084 Ga0207676_100270842 263
168 3300028379 Ga0268266_10007198 Ga0268266_100071989 263
169 3300028381 Ga0268264_10000001 Ga0268264_10000001530 263
170 3300046471 Ga0495650_0037509 Ga0495650_0037509_312_1184 263
171 3300046500 Ga0495596_0001479 Ga0495596_0001479_6689_7480 263
172 3300048091 Ga0495626_0002509 Ga0495626_0002509_5220_6011 263
173 3300048919 Ga0496116_0000093 Ga0496116_0000093_72903_73694 263
174 3300048921 Ga0496118_0096978 Ga0496118_0096978_136_927 263
175 3300048924 Ga0496121_0000168 Ga0496121_0000168_9175_9966 263
176 3300048924 Ga0496121_0003037 Ga0496121_0003037_21495_22328 263
177 3300048925 Ga0496122_0018477 Ga0496122_0018477_178_969 263
178 3300048926 Ga0496123_0023428 Ga0496123_0023428_3756_4547 263
179 3300048927 Ga0496124_0001125 Ga0496124_0001125_15952_16785 263
180 3300048928 Ga0496125_0047392 Ga0496125_0047392_1218_2009 263
181 3300048929 Ga0496126_0000371 Ga0496126_0000371_17823_18614 263
182 3300049570 Ga0501033_0378701 Ga0501033_0378701_67_858 263
183 3300049571 Ga0501034_0117047 Ga0501034_0117047_348_1139 263
184 3300049574 Ga0501038_0275445 Ga0501038_0275445_86_877 263
185 3300050493 nmdc:mga0k408_8442_c1 nmdc:mga0k408_8442_c1_4262_5071 263
186 3300053087 Ga0500643_000326 Ga0500643_000326_8716_9552 263
187 3300053122 Ga0500608_011410 Ga0500608_011410_2581_3375 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

39

236

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

45

283

0.95

PF08659

KR

KR domain

40

211

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8jfi-assembly2.cif.gz_E crystal structure of 3-oxoacyl-acp reductase fabg in complex with nadp+ and 3-keto-hexanoyl-acp from helicobacter pylori 0.9671 12 255
1gco-assembly1.cif.gz_A crystal structure of glucose dehydrogenase complexed with nad+ 0.9633 12 263
1gee-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant q252l complexed with nad+ 0.963 12 263
4dmm-assembly2.cif.gz_D 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with nadp 0.9625 12 255
1g6k-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant e96a complexed with nad+ 0.9621 12 263
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9601 11 257 3.40.50.720
af_B7FAC8_69_312_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.959 12 255 3.40.50.720
4urfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9549 5 255 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9547 12 262 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 12 255 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7W0A461-F1-model_v4 SDR family oxidoreductase 0.9822 5 257 GO:0016491
AF-A0A7Y9HVC3-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9814 5 256 GO:0047936
AF-A0A7K1YA16-F1-model_v4 SDR family oxidoreductase 0.9782 5 263 GO:0016616
AF-A0A1P8LWI3-F1-model_v4 Uncharacterized protein 0.9761 9 257 GO:0016616
AF-A0A6J4KQY4-F1-model_v4 3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100) 0.9759 57 257 GO:0004316

Feature Viewer

pLDDT pTM Quality
93.47 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map