F288032

General Info

Members Datasets Scaffolds Average Seq Length
187 88 374 137

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0884412|Ga0436364_0884412_112_579
Length 155
Sequence VKRSRYGIYMATDPQTDPQSPAQLTDEQWRERLSPEQYEVLRHQATEPPFTGKYVSVKDDGMYRCAGCGAELFDSDTKFESGTGWPSFYEPAVAQNVELRRDRSLFMERTEVICRRCGGHLGHVFDDGPAPTGLRYCINSCALDLDGANPPDPQT

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
6 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
7 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
8 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
9 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
10 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
11 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
12 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
13 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
14 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
15 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
16 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
17 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
18 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
19 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
20 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
21 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
25 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
26 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
27 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
28 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
29 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
30 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
31 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
32 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
33 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
34 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
35 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
36 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
37 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
38 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
39 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
40 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
41 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
42 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
43 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
44 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
45 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
46 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
47 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
48 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
49 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
50 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
51 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
52 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
53 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
54 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
55 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
56 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
57 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
58 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
59 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
60 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
61 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
62 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
63 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
66 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
67 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
68 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
69 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
70 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
71 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
72 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
73 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
74 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
75 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
76 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
77 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
80 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
81 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
82 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
83 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
84 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
85 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
86 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
87 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
88 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.95
Rhizosphere 74.87
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0884412 3300037853 Bacteria 1011
2 Ga0070714_100143539 3300005435 Bacteria 2145
3 Ga0070714_100252031 3300005435 Bacteria 1632
4 Ga0070714_100355260 3300005435 Bacteria 1377
5 Ga0070714_100886777 3300005435 Bacteria 866
6 Ga0070713_100046070 3300005436 Bacteria 3576
7 Ga0070713_100170588 3300005436 Bacteria 1949
8 Ga0070713_100180893 3300005436 Bacteria 1895
9 Ga0070713_101018921 3300005436 Bacteria 799
10 Ga0070710_10293717 3300005437 Bacteria 1058
11 Ga0070711_101824886 3300005439 Bacteria 534
12 Ga0070717_10099395 3300006028 Bacteria 2468
13 Ga0070717_10287755 3300006028 Bacteria 1458
14 Ga0070717_10326988 3300006028 Bacteria 1367
15 Ga0070717_10375144 3300006028 Bacteria 1275
16 Ga0070715_10245009 3300006163 Bacteria 934
17 Ga0070712_100044903 3300006175 Bacteria 3048
18 Ga0070712_100484510 3300006175 Bacteria 1034
19 Ga0105242_10005094 3300009176 Bacteria 10145
20 Ga0157369_12192566 3300013105 Bacteria 560
21 Ga0213873_10032589 3300021358 Bacteria 1303
22 Ga0213873_10051303 3300021358 Bacteria 1093
23 Ga0213874_10008509 3300021377 Bacteria 2503
24 Ga0213874_10240807 3300021377 Bacteria 664
25 Ga0213876_10014646 3300021384 Bacteria 4154
26 Ga0213876_10023324 3300021384 Bacteria 3269
27 Ga0213876_10054911 3300021384 Bacteria 2103
28 Ga0213876_10063088 3300021384 Bacteria 1956
29 Ga0213876_10111126 3300021384 Bacteria 1454
30 Ga0213875_10014585 3300021388 Bacteria 3832
31 Ga0213875_10034858 3300021388 Bacteria 2375
32 Ga0207692_10041221 3300025898 Bacteria 2284
33 Ga0207685_10112781 3300025905 Bacteria 1181
34 Ga0207693_10024998 3300025915 Bacteria 4737
35 Ga0207663_10238518 3300025916 Bacteria 1332
36 Ga0207646_10077742 3300025922 Bacteria 2965
37 Ga0207700_10006903 3300025928 Bacteria 6903
38 Ga0207700_10547339 3300025928 Bacteria 1027
39 Ga0207700_10562791 3300025928 Bacteria 1013
40 Ga0207664_10013104 3300025929 Bacteria 5944
41 Ga0207664_10119081 3300025929 Bacteria 2207
42 Ga0207664_10222909 3300025929 Bacteria 1636
43 Ga0207664_10773357 3300025929 Bacteria 864
44 Ga0207686_10026765 3300025934 Bacteria 3369
45 Ga0207665_10293587 3300025939 Bacteria 1213
46 Ga0373953_0033001 3300035117 Bacteria 2023
47 Ga0373943_0395161 3300035170 Bacteria 798
48 Ga0373955_0163999 3300035172 Bacteria 1313
49 Ga0373924_0163750 3300035410 Bacteria 976
50 Ga0373933_1054866 3300035724 Bacteria 535
51 Ga0373937_0056892 3300036401 Bacteria 3591
52 Ga0373937_1166960 3300036401 Bacteria 719
53 Ga0395900_0001735 3300037418 Bacteria 25153
54 Ga0395898_0133360 3300037466 Bacteria 2378
55 Ga0395905_0036510 3300037471 Bacteria 4616
56 Ga0436364_0275867 3300037853 Bacteria 5303
57 Ga0436364_0502934 3300037853 Bacteria 555
58 Ga0436364_0692112 3300037853 Bacteria 2665
59 Ga0436364_1016607 3300037853 Bacteria 6584
60 Ga0436364_1118931 3300037853 Bacteria 16338
61 Ga0395901_0663578 3300038443 Bacteria 1044
62 Ga0436365_0194199 3300039437 Bacteria 703
63 Ga0436365_0958193 3300039437 Bacteria 3661
64 Ga0436365_1094104 3300039437 Bacteria 4533
65 Ga0436365_1148315 3300039437 Bacteria 3153
66 Ga0436365_1279707 3300039437 Bacteria 1458
67 Ga0436365_1370684 3300039437 Bacteria 10172
68 Ga0436365_1429123 3300039437 Bacteria 8655
69 Ga0436365_1603112 3300039437 Bacteria 10339
70 Ga0436363_0024734 3300039450 Bacteria 652
71 Ga0436363_0137760 3300039450 Bacteria 4358
72 Ga0436363_0171783 3300039450 Bacteria 14687
73 Ga0436363_0310676 3300039450 Bacteria 550
74 Ga0436363_0574546 3300039450 Bacteria 1206
75 Ga0436363_0622950 3300039450 Bacteria 583
76 Ga0436363_0952247 3300039450 Bacteria 1186
77 Ga0436363_0985952 3300039450 Bacteria 1825
78 Ga0436363_1054230 3300039450 Bacteria 1993
79 Ga0436363_1610057 3300039450 Bacteria 982
80 Ga0436362_0242306 3300039453 Bacteria 1072
81 Ga0436362_0293775 3300039453 Bacteria 7880
82 Ga0436362_0470369 3300039453 Bacteria 1744
83 Ga0436362_0673027 3300039453 Bacteria 806
84 Ga0436362_1277710 3300039453 Bacteria 982
85 Ga0451789_0227120 3300041443 Bacteria 842
86 Ga0451804_0573234 3300041463 Bacteria 526
87 Ga0451853_2633193 3300041512 Bacteria 714
88 Ga0466969_0008564 3300044656 Bacteria 5428
89 Ga0466969_0016586 3300044656 Bacteria 3853
90 Ga0466969_0265380 3300044656 Bacteria 778
91 Ga0466969_0267257 3300044656 Bacteria 775
92 Ga0466969_0339579 3300044656 Bacteria 680
93 Ga0466965_0331890 3300044683 Bacteria 830
94 Ga0466965_0863118 3300044683 Bacteria 526
95 Ga0466966_0084454 3300044684 Bacteria 1975
96 Ga0466966_0139375 3300044684 Bacteria 1483
97 Ga0466961_0029838 3300044693 Bacteria 3504
98 Ga0466961_0041509 3300044693 Bacteria 2950
99 Ga0466961_0328088 3300044693 Bacteria 933
100 Ga0466961_0343459 3300044693 Bacteria 909
101 Ga0466961_0439744 3300044693 Bacteria 790
102 Ga0466963_0029724 3300044694 Bacteria 3520
103 Ga0466963_0072348 3300044694 Bacteria 2323
104 Ga0466963_0301035 3300044694 Bacteria 1128
105 Ga0466963_0377639 3300044694 Bacteria 999
106 Ga0466963_0386659 3300044694 Bacteria 986
107 Ga0466963_0711357 3300044694 Bacteria 709
108 Ga0466964_0154181 3300044706 Bacteria 1068
109 Ga0466971_0008501 3300044719 Bacteria 4477
110 Ga0466971_0045837 3300044719 Bacteria 1964
111 Ga0466971_0421929 3300044719 Bacteria 652
112 Ga0466968_0008152 3300044735 Bacteria 4006
113 Ga0466968_0057530 3300044735 Bacteria 1672
114 Ga0466968_0259398 3300044735 Bacteria 827
115 Ga0466970_0048515 3300044765 Bacteria 2264
116 Ga0466970_0066181 3300044765 Bacteria 1940
117 Ga0466970_0233241 3300044765 Bacteria 1029
118 Ga0466957_0013142 3300044842 Bacteria 4800
119 Ga0466957_0037812 3300044842 Bacteria 2906
120 Ga0466957_0063868 3300044842 Bacteria 2264
121 Ga0466957_0246463 3300044842 Bacteria 1187
122 Ga0466957_0405352 3300044842 Bacteria 933
123 Ga0466959_0016938 3300045049 Bacteria 5334
124 Ga0466959_0027333 3300045049 Bacteria 4232
125 Ga0466959_0073272 3300045049 Bacteria 2478
126 Ga0466959_0077694 3300045049 Bacteria 2395
127 Ga0466959_0132416 3300045049 Bacteria 1767
128 Ga0466959_0150245 3300045049 Bacteria 1642
129 Ga0466959_0196172 3300045049 Bacteria 1407
130 Ga0466959_0268192 3300045049 Bacteria 1174
131 Ga0466959_0311431 3300045049 Bacteria 1077
132 Ga0466959_0484474 3300045049 Bacteria 837
133 Ga0466959_0580792 3300045049 Bacteria 754
134 Ga0466959_1005410 3300045049 Bacteria 555
135 Ga0466958_0001085 3300045836 Bacteria 12516
136 Ga0466958_0005298 3300045836 Bacteria 6918
137 Ga0466958_0059792 3300045836 Bacteria 2319
138 Ga0466958_0143984 3300045836 Bacteria 1501
139 Ga0466958_0288141 3300045836 Bacteria 1053
140 Ga0466958_0339560 3300045836 Bacteria 966
141 Ga0466967_0008251 3300045976 Bacteria 7607
142 Ga0466967_0440512 3300045976 Bacteria 1272
143 Ga0466967_0471364 3300045976 Bacteria 1229
144 Ga0466967_0806285 3300045976 Bacteria 932
145 Ga0466967_2528197 3300045976 Bacteria 508
146 Ga0466967_2580536 3300045976 Bacteria 503
147 Ga0495592_0085973 3300046454 Bacteria 2266
148 Ga0495629_0145409 3300046459 Bacteria 1649
149 Ga0495651_0051746 3300046462 Bacteria 3165
150 Ga0495608_0076690 3300046511 Bacteria 2176
151 Ga0495618_0153204 3300046514 Bacteria 1472
152 Ga0495630_0820774 3300046517 Bacteria 710
153 Ga0495652_0266367 3300046529 Bacteria 1262
154 Ga0495652_0414126 3300046529 Bacteria 951
155 Ga0495665_0398138 3300046531 Bacteria 699
156 Ga0495640_0054898 3300046533 Bacteria 2727
157 Ga0495587_0079108 3300046536 Bacteria 1907
158 Ga0495667_0007227 3300046559 Bacteria 7536
159 Ga0495634_0169798 3300046642 Bacteria 1371
160 Ga0495635_0113989 3300046663 Bacteria 1845
161 Ga0495657_0640129 3300046675 Bacteria 613
162 Ga0495599_0481872 3300046678 Bacteria 732
163 Ga0495623_0121268 3300046679 Bacteria 1574
164 Ga0495646_0086375 3300046680 Bacteria 1819
165 Ga0495600_0045457 3300046809 Bacteria 2865
166 Ga0495604_0025945 3300047317 Bacteria 4667
167 Ga0495604_0267050 3300047317 Bacteria 1161
168 Ga0495674_0174484 3300047319 Bacteria 1792
169 Ga0495680_0029505 3300047322 Bacteria 4491
170 Ga0495602_0281642 3300048088 Bacteria 1224
171 Ga0495602_0454352 3300048088 Bacteria 904
172 Ga0496100_0252978 3300048903 Bacteria 1304
173 Ga0496102_0693732 3300048905 Bacteria 941
174 Ga0496104_0185364 3300048907 Bacteria 1992
175 Ga0496104_1433488 3300048907 Bacteria 594
176 Ga0496108_0776038 3300048911 Bacteria 828
177 Ga0496111_0326913 3300048914 Bacteria 1135
178 Ga0496112_0080438 3300048915 Bacteria 3222
179 Ga0496112_0734360 3300048915 Bacteria 914
180 Ga0496113_0563530 3300048916 Bacteria 913
181 Ga0496114_0190606 3300048917 Bacteria 1794
182 Ga0496115_0127019 3300048918 Bacteria 2101
183 Ga0495601_0183027 3300053077 Bacteria 1370
184 Ga0495655_0048546 3300053083 Bacteria 1115
185 Ga0495595_0006303 3300053084 Bacteria 4832
186 Ga0495619_0151907 3300053085 Bacteria 1597
187 Ga0466962_0006037 3300061719 Bacteria 5826
188 Ga0436364_0884412
189 Ga0070714_100143539
190 Ga0070714_100252031
191 Ga0070714_100355260
192 Ga0070714_100886777
193 Ga0070713_100046070
194 Ga0070713_100170588
195 Ga0070713_100180893
196 Ga0070713_101018921
197 Ga0070710_10293717
198 Ga0070711_101824886
199 Ga0070717_10099395
200 Ga0070717_10287755
201 Ga0070717_10326988
202 Ga0070717_10375144
203 Ga0070715_10245009
204 Ga0070712_100044903
205 Ga0070712_100484510
206 Ga0105242_10005094
207 Ga0157369_12192566
208 Ga0213873_10032589
209 Ga0213873_10051303
210 Ga0213874_10008509
211 Ga0213874_10240807
212 Ga0213876_10014646
213 Ga0213876_10023324
214 Ga0213876_10054911
215 Ga0213876_10063088
216 Ga0213876_10111126
217 Ga0213875_10014585
218 Ga0213875_10034858
219 Ga0207692_10041221
220 Ga0207685_10112781
221 Ga0207693_10024998
222 Ga0207663_10238518
223 Ga0207646_10077742
224 Ga0207700_10006903
225 Ga0207700_10547339
226 Ga0207700_10562791
227 Ga0207664_10013104
228 Ga0207664_10119081
229 Ga0207664_10222909
230 Ga0207664_10773357
231 Ga0207686_10026765
232 Ga0207665_10293587
233 Ga0373953_0033001
234 Ga0373943_0395161
235 Ga0373955_0163999
236 Ga0373924_0163750
237 Ga0373933_1054866
238 Ga0373937_0056892
239 Ga0373937_1166960
240 Ga0395900_0001735
241 Ga0395898_0133360
242 Ga0395905_0036510
243 Ga0436364_0275867
244 Ga0436364_0502934
245 Ga0436364_0692112
246 Ga0436364_1016607
247 Ga0436364_1118931
248 Ga0395901_0663578
249 Ga0436365_0194199
250 Ga0436365_0958193
251 Ga0436365_1094104
252 Ga0436365_1148315
253 Ga0436365_1279707
254 Ga0436365_1370684
255 Ga0436365_1429123
256 Ga0436365_1603112
257 Ga0436363_0024734
258 Ga0436363_0137760
259 Ga0436363_0171783
260 Ga0436363_0310676
261 Ga0436363_0574546
262 Ga0436363_0622950
263 Ga0436363_0952247
264 Ga0436363_0985952
265 Ga0436363_1054230
266 Ga0436363_1610057
267 Ga0436362_0242306
268 Ga0436362_0293775
269 Ga0436362_0470369
270 Ga0436362_0673027
271 Ga0436362_1277710
272 Ga0451789_0227120
273 Ga0451804_0573234
274 Ga0451853_2633193
275 Ga0466969_0008564
276 Ga0466969_0016586
277 Ga0466969_0265380
278 Ga0466969_0267257
279 Ga0466969_0339579
280 Ga0466965_0331890
281 Ga0466965_0863118
282 Ga0466966_0084454
283 Ga0466966_0139375
284 Ga0466961_0029838
285 Ga0466961_0041509
286 Ga0466961_0328088
287 Ga0466961_0343459
288 Ga0466961_0439744
289 Ga0466963_0029724
290 Ga0466963_0072348
291 Ga0466963_0301035
292 Ga0466963_0377639
293 Ga0466963_0386659
294 Ga0466963_0711357
295 Ga0466964_0154181
296 Ga0466971_0008501
297 Ga0466971_0045837
298 Ga0466971_0421929
299 Ga0466968_0008152
300 Ga0466968_0057530
301 Ga0466968_0259398
302 Ga0466970_0048515
303 Ga0466970_0066181
304 Ga0466970_0233241
305 Ga0466957_0013142
306 Ga0466957_0037812
307 Ga0466957_0063868
308 Ga0466957_0246463
309 Ga0466957_0405352
310 Ga0466959_0016938
311 Ga0466959_0027333
312 Ga0466959_0073272
313 Ga0466959_0077694
314 Ga0466959_0132416
315 Ga0466959_0150245
316 Ga0466959_0196172
317 Ga0466959_0268192
318 Ga0466959_0311431
319 Ga0466959_0484474
320 Ga0466959_0580792
321 Ga0466959_1005410
322 Ga0466958_0001085
323 Ga0466958_0005298
324 Ga0466958_0059792
325 Ga0466958_0143984
326 Ga0466958_0288141
327 Ga0466958_0339560
328 Ga0466967_0008251
329 Ga0466967_0440512
330 Ga0466967_0471364
331 Ga0466967_0806285
332 Ga0466967_2528197
333 Ga0466967_2580536
334 Ga0495592_0085973
335 Ga0495629_0145409
336 Ga0495651_0051746
337 Ga0495608_0076690
338 Ga0495618_0153204
339 Ga0495630_0820774
340 Ga0495652_0266367
341 Ga0495652_0414126
342 Ga0495665_0398138
343 Ga0495640_0054898
344 Ga0495587_0079108
345 Ga0495667_0007227
346 Ga0495634_0169798
347 Ga0495635_0113989
348 Ga0495657_0640129
349 Ga0495599_0481872
350 Ga0495623_0121268
351 Ga0495646_0086375
352 Ga0495600_0045457
353 Ga0495604_0025945
354 Ga0495604_0267050
355 Ga0495674_0174484
356 Ga0495680_0029505
357 Ga0495602_0281642
358 Ga0495602_0454352
359 Ga0496100_0252978
360 Ga0496102_0693732
361 Ga0496104_0185364
362 Ga0496104_1433488
363 Ga0496108_0776038
364 Ga0496111_0326913
365 Ga0496112_0080438
366 Ga0496112_0734360
367 Ga0496113_0563530
368 Ga0496114_0190606
369 Ga0496115_0127019
370 Ga0495601_0183027
371 Ga0495655_0048546
372 Ga0495595_0006303
373 Ga0495619_0151907
374 Ga0466962_0006037

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01641

SelR

SelR domain

28

147

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hch-assembly1.cif.gz_A structure of the c-terminal domain (msrb) of neisseria meningitidis pilb (complex with substrate) 0.9744 8 132
7cto-assembly1.cif.gz_A staphylococcus aureus msrb 0.9684 18 132
7cto-assembly6.cif.gz_F staphylococcus aureus msrb 0.9684 18 132
3cxk-assembly1.cif.gz_A 1.7 a crystal structure of methionine-r-sulfoxide reductase from burkholderia pseudomallei: crystallization in a microfluidic crystal card. 0.9667 8 133
7cto-assembly5.cif.gz_E staphylococcus aureus msrb 0.9658 18 132
ID Description Score Start End Superfamily
af_P34436_5_152_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9849 8 133 2.170.150.20
af_I6YA00_1_135_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9748 7 134 2.170.150.20
af_Q78J03_33_175_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9747 6 135 2.170.150.20
af_Q8BU85_97_242_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9744 9 133 2.170.150.20
3cezB00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.9695 7 133 2.170.150.20
ID Description Score Start End GO Terms
AF-A0A5S3P3C7-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9984 7 134 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A1V5G958-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.998 7 134 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A7C5V0G3-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9978 7 133 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A6I2GW64-F1-model_v4 Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) (Peptide-methionine (R)-S-oxide reductase) 0.9976 9 133 GO:0005737
GO:0006979
GO:0008270
GO:0030091
GO:0033743
AF-A0A2W4ZZQ8-F1-model_v4 peptide-methionine (R)-S-oxide reductase (EC 1.8.4.12) 0.9976 7 135 GO:0005737
GO:0006979
GO:0030091
GO:0033743

Map