F287616

General Info

Members Datasets Scaffolds Average Seq Length
187 105 374 106

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10001873|Ga0105237_1000187317
Length 108
Sequence MNNYNFYTYILTNYNRKVLYTGVTSVLEGRLYEHYFGLNNTDQKISFTTKYKCFYLVWYERHQYIQHAIEREKEIKGWVREKKIKLIEEENPNWEFLNQSIMDWPPEK

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
30 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
35 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
36 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
39 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
40 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
41 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
42 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
61 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
68 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
69 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
70 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
73 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
77 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
82 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
86 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
87 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
90 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
91 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
94 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
97 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
98 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
99 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
100 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
101 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
102 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
103 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
104 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
105 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 0.53
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.76
Nodule 0
Rhizoplane 1.6
Rhizosphere 82.35
Stem 0
Stem Tuber 0
Unclassified 8.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10001873 3300009545 Bacteria 26849
2 JGI24737J22298_10032067 3300001990 Bacteria 1639
3 JGI24737J22298_10044011 3300001990 Unclassified 1366
4 JGI24735J21928_10254304 3300002067 Unclassified 512
5 JGI25162J39368_1000011 3300002737 Bacteria 379156
6 rootH1_10095750 3300003316 Bacteria 6476
7 rootH2_10002321 3300003320 Bacteria 110257
8 rootL2_10088709 3300003322 Bacteria 4706
9 rootH1_10008833 3300003323 Bacteria 6304
10 Ga0055530_10001703 3300003791 Bacteria 15567
11 Ga0058863_11800105 3300004799 Bacteria 4333
12 Ga0065714_10013280 3300005288 Bacteria 2227
13 Ga0065714_10084421 3300005288 Bacteria 2172
14 Ga0065714_10117317 3300005288 Bacteria 1344
15 Ga0065714_10479628 3300005288 Bacteria 535
16 Ga0070658_10000056 3300005327 Bacteria 114761
17 Ga0070658_10909571 3300005327 Bacteria 765
18 Ga0070658_11594502 3300005327 Unclassified 566
19 Ga0070658_11727014 3300005327 Unclassified 542
20 Ga0070680_100020902 3300005336 Bacteria 5197
21 Ga0068868_100404031 3300005338 Bacteria 1179
22 Ga0070710_11276862 3300005437 Bacteria 545
23 Ga0070663_100026001 3300005455 Bacteria 3959
24 Ga0070662_100000853 3300005457 Bacteria 18740
25 Ga0070681_10050496 3300005458 Bacteria 4149
26 Ga0070681_11676639 3300005458 Unclassified 562
27 Ga0070679_100080977 3300005530 Bacteria 3236
28 Ga0068853_100240907 3300005539 Unclassified 1658
29 Ga0068853_102485531 3300005539 Unclassified 501
30 Ga0070665_100000017 3300005548 Bacteria 448013
31 Ga0070665_100000367 3300005548 Bacteria 67579
32 Ga0068855_100159951 3300005563 Bacteria 2557
33 Ga0068855_100310590 3300005563 Bacteria 1744
34 Ga0068855_102618549 3300005563 Bacteria 500
35 Ga0075366_10000431 3300006195 Bacteria 19580
36 Ga0075366_10011519 3300006195 Bacteria 4994
37 Ga0068871_101071365 3300006358 Bacteria 753
38 Ga0105240_10000083 3300009093 Bacteria 192934
39 Ga0105240_10024082 3300009093 Bacteria 8037
40 Ga0105240_10086491 3300009093 Bacteria 3839
41 Ga0105240_10263579 3300009093 Bacteria 1987
42 Ga0105240_10280554 3300009093 Unclassified 1914
43 Ga0105240_10424329 3300009093 Bacteria 1493
44 Ga0105240_10747877 3300009093 Bacteria 1063
45 Ga0105241_10113043 3300009174 Bacteria 2176
46 Ga0105241_10209066 3300009174 Bacteria 1634
47 Ga0105241_10903370 3300009174 Bacteria 820
48 Ga0105237_10000167 3300009545 Bacteria 92638
49 Ga0105237_10002528 3300009545 Bacteria 22649
50 Ga0105237_10061682 3300009545 Bacteria 3748
51 Ga0105237_10100615 3300009545 Bacteria 2882
52 Ga0105237_10613252 3300009545 Unclassified 1095
53 Ga0105237_12680293 3300009545 Bacteria 509
54 Ga0105238_10050164 3300009551 Bacteria 4201
55 Ga0105239_10000006 3300010375 Bacteria 442319
56 Ga0105239_10006501 3300010375 Bacteria 13551
57 Ga0105239_10680170 3300010375 Bacteria 1176
58 Ga0105239_11371087 3300010375 Bacteria 816
59 Ga0105239_12173938 3300010375 Bacteria 645
60 Ga0157373_10025109 3300013100 Bacteria 4314
61 Ga0157373_10124905 3300013100 Bacteria 1809
62 Ga0157371_10001836 3300013102 Bacteria 21402
63 Ga0157371_10160808 3300013102 Bacteria 1604
64 Ga0157371_10999592 3300013102 Bacteria 638
65 Ga0157369_10001293 3300013105 Bacteria 31090
66 Ga0157369_10065447 3300013105 Bacteria 3912
67 Ga0157369_10265675 3300013105 Bacteria 1789
68 Ga0157369_11014390 3300013105 Bacteria 849
69 Ga0157374_10173136 3300013296 Bacteria 2106
70 Ga0157374_10259649 3300013296 Bacteria 1711
71 Ga0157378_10065834 3300013297 Bacteria 3244
72 Ga0163162_10015548 3300013306 Bacteria 7437
73 Ga0163162_11916253 3300013306 Bacteria 678
74 Ga0163162_13104949 3300013306 Bacteria 533
75 Ga0157372_10000327 3300013307 Bacteria 52004
76 Ga0157375_10210276 3300013308 Bacteria 2103
77 Ga0213872_10078826 3300021361 Bacteria 1480
78 Ga0209437_100017 3300025233 Bacteria 694471
79 Ga0209026_1020056 3300025250 Bacteria 1042
80 Ga0209129_1020465 3300025258 Bacteria 1231
81 Ga0209233_1033585 3300025261 Bacteria 1177
82 Ga0209455_1001458 3300025272 Bacteria 10640
83 Ga0209676_1000039 3300025292 Bacteria 443158
84 Ga0209050_1000033 3300025298 Bacteria 442615
85 Ga0207705_10000028 3300025909 Bacteria 240636
86 Ga0207705_10152059 3300025909 Bacteria 1735
87 Ga0207705_11358135 3300025909 Bacteria 541
88 Ga0207654_10075685 3300025911 Bacteria 2012
89 Ga0207707_10045075 3300025912 Bacteria 3843
90 Ga0207695_10000127 3300025913 Bacteria 227338
91 Ga0207695_10018279 3300025913 Bacteria 8111
92 Ga0207695_10023389 3300025913 Bacteria 6982
93 Ga0207695_10101979 3300025913 Bacteria 2863
94 Ga0207695_10442525 3300025913 Bacteria 1183
95 Ga0207695_11059777 3300025913 Bacteria 690
96 Ga0207671_10002631 3300025914 Bacteria 18882
97 Ga0207671_10004324 3300025914 Bacteria 13650
98 Ga0207671_10011444 3300025914 Bacteria 7224
99 Ga0207671_10144492 3300025914 Bacteria 1834
100 Ga0207671_10432554 3300025914 Unclassified 1047
101 Ga0207671_10512568 3300025914 Bacteria 956
102 Ga0207660_10037459 3300025917 Bacteria 3380
103 Ga0207652_10021742 3300025921 Bacteria 5298
104 Ga0207706_10000553 3300025933 Bacteria 39805
105 Ga0207667_10000020 3300025949 Bacteria 374770
106 Ga0207667_10167799 3300025949 Bacteria 2256
107 Ga0207667_11059231 3300025949 Bacteria 796
108 Ga0207667_11936985 3300025949 Bacteria 551
109 Ga0207677_10394641 3300026023 Bacteria 1172
110 Ga0207639_10176778 3300026041 Unclassified 1812
111 Ga0207678_10061767 3300026067 Bacteria 3223
112 Ga0268266_10000053 3300028379 Bacteria 295181
113 Ga0268266_10000195 3300028379 Bacteria 105788
114 Ga0265338_10012221 3300028800 Bacteria 9807
115 Ga0265338_10761553 3300028800 Bacteria 665
116 Ga0307412_10038898 3300031911 Bacteria 3067
117 Ga0307412_10317168 3300031911 Bacteria 1239
118 Ga0307510_10000328 3300033180 Bacteria 44214
119 Ga0373941_0008959 3300035115 Bacteria 2506
120 Ga0395899_0000002 3300037312 Bacteria 1324310
121 Ga0395900_0004510 3300037418 Bacteria 14733
122 Ga0395900_0007136 3300037418 Bacteria 11577
123 Ga0395900_0691219 3300037418 Unclassified 954
124 Ga0395900_1320430 3300037418 Bacteria 635
125 Ga0395898_0377448 3300037466 Bacteria 1352
126 Ga0395898_0581670 3300037466 Bacteria 1062
127 Ga0395905_0001917 3300037471 Bacteria 23877
128 Ga0395901_0027048 3300038443 Bacteria 5892
129 Ga0395901_0028065 3300038443 Bacteria 5789
130 Ga0436361_1111083 3300039447 Bacteria 43355
131 Ga0451793_0264738 3300041452 Bacteria 914
132 Ga0451798_0354864 3300041458 Bacteria 832
133 Ga0451806_142311 3300041462 Bacteria 728
134 Ga0451853_2701280 3300041512 Bacteria 650
135 Ga0439445_0114717 3300042004 Bacteria 770
136 Ga0466957_0223062 3300044842 Bacteria 1245
137 Ga0495629_0040479 3300046459 Bacteria 3278
138 Ga0495638_0534893 3300046460 Bacteria 585
139 Ga0495650_0124234 3300046471 Bacteria 947
140 Ga0495585_0000089 3300046492 Bacteria 96296
141 Ga0495585_0000354 3300046492 Bacteria 44420
142 Ga0495585_0019482 3300046492 Bacteria 3911
143 Ga0495583_0007918 3300046506 Bacteria 6586
144 Ga0495606_0266065 3300046507 Bacteria 944
145 Ga0495616_0024898 3300046513 Bacteria 3204
146 Ga0495637_0028696 3300046520 Bacteria 2483
147 Ga0495648_0008823 3300046524 Bacteria 7888
148 Ga0495648_0010125 3300046524 Bacteria 7220
149 Ga0495652_0680545 3300046529 Bacteria 694
150 Ga0495622_0012975 3300046557 Bacteria 3867
151 Ga0495633_0000035 3300046558 Bacteria 185403
152 Ga0495625_0000013 3300046660 Bacteria 345151
153 Ga0495625_0000358 3300046660 Bacteria 69690
154 Ga0495625_0000486 3300046660 Bacteria 59478
155 Ga0495625_0001421 3300046660 Bacteria 29255
156 Ga0495625_0042655 3300046660 Bacteria 3295
157 Ga0495625_0082333 3300046660 Unclassified 2238
158 Ga0495625_0089024 3300046660 Bacteria 2138
159 Ga0495625_0207111 3300046660 Unclassified 1291
160 Ga0495625_0630493 3300046660 Unclassified 640
161 Ga0495625_0751760 3300046660 Bacteria 571
162 Ga0495661_0012437 3300046665 Bacteria 5745
163 Ga0495658_0016307 3300046683 Bacteria 3824
164 Ga0495658_0018125 3300046683 Bacteria 3653
165 Ga0495671_0226178 3300046692 Bacteria 905
166 Ga0495649_0000010 3300046694 Bacteria 430552
167 Ga0495600_0232446 3300046809 Bacteria 1177
168 Ga0495683_0187272 3300047323 Bacteria 941
169 Ga0495673_0293636 3300047469 Bacteria 584
170 Ga0495686_0053780 3300047472 Bacteria 2523
171 Ga0495686_0171792 3300047472 Bacteria 1260
172 Ga0496126_1365466 3300048929 Bacteria 513
173 Ga0495682_0036691 3300049460 Bacteria 1804
174 nmdc:mga0k408_173307_c1 3300050493 Bacteria 1286
175 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
176 nmdc:mga0k408_6564_c1 3300050493 Bacteria 6197
177 nmdc:mga07m45_49741_c1 3300050496 Bacteria 2360
178 Ga0500614_005395 3300053123 Bacteria 2683
179 Ga0500618_000004 3300053125 Bacteria 293180
180 Ga0500616_0083835 3300053153 Bacteria 1596
181 Ga0500622_0001600 3300053156 Bacteria 17790
182 Ga0500622_0092879 3300053156 Bacteria 1495
183 Ga0500624_000346 3300053157 Bacteria 15210
184 Ga0500624_000570 3300053157 Bacteria 10191
185 Ga0500634_0184677 3300053161 Bacteria 934
186 2919440521 2919437846 Bacteria 6199444
187 2919442685 2919437846 Bacteria 6199444
188 Ga0105237_10001873
189 JGI24737J22298_10032067
190 JGI24737J22298_10044011
191 JGI24735J21928_10254304
192 JGI25162J39368_1000011
193 rootH1_10095750
194 rootH2_10002321
195 rootL2_10088709
196 rootH1_10008833
197 Ga0055530_10001703
198 Ga0058863_11800105
199 Ga0065714_10013280
200 Ga0065714_10084421
201 Ga0065714_10117317
202 Ga0065714_10479628
203 Ga0070658_10000056
204 Ga0070658_10909571
205 Ga0070658_11594502
206 Ga0070658_11727014
207 Ga0070680_100020902
208 Ga0068868_100404031
209 Ga0070710_11276862
210 Ga0070663_100026001
211 Ga0070662_100000853
212 Ga0070681_10050496
213 Ga0070681_11676639
214 Ga0070679_100080977
215 Ga0068853_100240907
216 Ga0068853_102485531
217 Ga0070665_100000017
218 Ga0070665_100000367
219 Ga0068855_100159951
220 Ga0068855_100310590
221 Ga0068855_102618549
222 Ga0075366_10000431
223 Ga0075366_10011519
224 Ga0068871_101071365
225 Ga0105240_10000083
226 Ga0105240_10024082
227 Ga0105240_10086491
228 Ga0105240_10263579
229 Ga0105240_10280554
230 Ga0105240_10424329
231 Ga0105240_10747877
232 Ga0105241_10113043
233 Ga0105241_10209066
234 Ga0105241_10903370
235 Ga0105237_10000167
236 Ga0105237_10002528
237 Ga0105237_10061682
238 Ga0105237_10100615
239 Ga0105237_10613252
240 Ga0105237_12680293
241 Ga0105238_10050164
242 Ga0105239_10000006
243 Ga0105239_10006501
244 Ga0105239_10680170
245 Ga0105239_11371087
246 Ga0105239_12173938
247 Ga0157373_10025109
248 Ga0157373_10124905
249 Ga0157371_10001836
250 Ga0157371_10160808
251 Ga0157371_10999592
252 Ga0157369_10001293
253 Ga0157369_10065447
254 Ga0157369_10265675
255 Ga0157369_11014390
256 Ga0157374_10173136
257 Ga0157374_10259649
258 Ga0157378_10065834
259 Ga0163162_10015548
260 Ga0163162_11916253
261 Ga0163162_13104949
262 Ga0157372_10000327
263 Ga0157375_10210276
264 Ga0213872_10078826
265 Ga0209437_100017
266 Ga0209026_1020056
267 Ga0209129_1020465
268 Ga0209233_1033585
269 Ga0209455_1001458
270 Ga0209676_1000039
271 Ga0209050_1000033
272 Ga0207705_10000028
273 Ga0207705_10152059
274 Ga0207705_11358135
275 Ga0207654_10075685
276 Ga0207707_10045075
277 Ga0207695_10000127
278 Ga0207695_10018279
279 Ga0207695_10023389
280 Ga0207695_10101979
281 Ga0207695_10442525
282 Ga0207695_11059777
283 Ga0207671_10002631
284 Ga0207671_10004324
285 Ga0207671_10011444
286 Ga0207671_10144492
287 Ga0207671_10432554
288 Ga0207671_10512568
289 Ga0207660_10037459
290 Ga0207652_10021742
291 Ga0207706_10000553
292 Ga0207667_10000020
293 Ga0207667_10167799
294 Ga0207667_11059231
295 Ga0207667_11936985
296 Ga0207677_10394641
297 Ga0207639_10176778
298 Ga0207678_10061767
299 Ga0268266_10000053
300 Ga0268266_10000195
301 Ga0265338_10012221
302 Ga0265338_10761553
303 Ga0307412_10038898
304 Ga0307412_10317168
305 Ga0307510_10000328
306 Ga0373941_0008959
307 Ga0395899_0000002
308 Ga0395900_0004510
309 Ga0395900_0007136
310 Ga0395900_0691219
311 Ga0395900_1320430
312 Ga0395898_0377448
313 Ga0395898_0581670
314 Ga0395905_0001917
315 Ga0395901_0027048
316 Ga0395901_0028065
317 Ga0436361_1111083
318 Ga0451793_0264738
319 Ga0451798_0354864
320 Ga0451806_142311
321 Ga0451853_2701280
322 Ga0439445_0114717
323 Ga0466957_0223062
324 Ga0495629_0040479
325 Ga0495638_0534893
326 Ga0495650_0124234
327 Ga0495585_0000089
328 Ga0495585_0000354
329 Ga0495585_0019482
330 Ga0495583_0007918
331 Ga0495606_0266065
332 Ga0495616_0024898
333 Ga0495637_0028696
334 Ga0495648_0008823
335 Ga0495648_0010125
336 Ga0495652_0680545
337 Ga0495622_0012975
338 Ga0495633_0000035
339 Ga0495625_0000013
340 Ga0495625_0000358
341 Ga0495625_0000486
342 Ga0495625_0001421
343 Ga0495625_0042655
344 Ga0495625_0082333
345 Ga0495625_0089024
346 Ga0495625_0207111
347 Ga0495625_0630493
348 Ga0495625_0751760
349 Ga0495661_0012437
350 Ga0495658_0016307
351 Ga0495658_0018125
352 Ga0495671_0226178
353 Ga0495649_0000010
354 Ga0495600_0232446
355 Ga0495683_0187272
356 Ga0495673_0293636
357 Ga0495686_0053780
358 Ga0495686_0171792
359 Ga0496126_1365466
360 Ga0495682_0036691
361 nmdc:mga0k408_173307_c1
362 nmdc:mga0k408_22_c2
363 nmdc:mga0k408_6564_c1
364 nmdc:mga07m45_49741_c1
365 Ga0500614_005395
366 Ga0500618_000004
367 Ga0500616_0083835
368 Ga0500622_0001600
369 Ga0500622_0092879
370 Ga0500624_000346
371 Ga0500624_000570
372 Ga0500634_0184677
373 2919440521
374 2919442685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01541

GIY-YIG

GIY-YIG catalytic domain

5

85

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6seh-assembly1.cif.gz_C recognition and processing of branched dna substrates by slx1-slx4 nuclease 0.7826 12 81
7cq4-assembly1.cif.gz_A crystal structure of slx1-slx4 in complex with 5'flap dna 0.7798 11 78
4xlg-assembly1.cif.gz_A c. glabrata slx1 in complex with slx4ccd. 0.7764 11 78
7cq3-assembly1.cif.gz_A crystal structure of slx1-slx4 0.774 11 78
7cq2-assembly1.cif.gz_A crystal structure of slx1-slx4 0.7656 11 82
ID Description Score Start End Superfamily
af_Q2G2W7_1_82_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8926 12 94 3.40.1440.10
af_Q2G2W7_1_82_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.8639 12 94 3.40.1440.10
af_P38324_11_132_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.7763 13 78 3.40.1440.10
af_P45472_1_97_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.7289 12 113 3.40.1440.10
af_Q9P7M3_4_108_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.7287 12 77 3.40.1440.10
ID Description Score Start End GO Terms
AF-A0A2H9VNZ7-F1-model_v4 Putative endonuclease 0.9725 10 113 GO:0004519
AF-A0A4Q5LIA9-F1-model_v4 GIY-YIG nuclease family protein 0.9698 10 113
AF-H8KNM2-F1-model_v4 Putative endonuclease containing a URI domain 0.9608 10 112 GO:0004519
AF-A0A0E4BF90-F1-model_v4 deleted 0.9573 11 105
AF-A0A444W4D6-F1-model_v4 GIY-YIG catalytic domain protein 0.9554 27 105

Map