F287306

General Info

Members Datasets Scaffolds Average Seq Length
187 140 374 270

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100127644|Ga0070706_1001276445
Length 313
Sequence MSGDLFTRSMRWKVAVVSAGLHILSSLRAGPSVRVAFNNAASIEVRQELERECMQSQLETMFERMGARVRVRETFSRNRGIDIRSDKRGEYFDIGVEATDRVEYEVIDIRPRLKHLLLMARRDNGKQKFLCGHDERHWFVCAVPGASVSNVVSAMEALQPSEVRAAVGRKVKRTKNRLHRRNEAFVRQGEWFFVPAPELSVNPKLVLRNEPISRGRGGKPHMCQFLYRTGGELVYVCSRHPRGLLAGEYAALLNSNSNAQNWGWSRMTRDATVYVRGRVWHLDHKTVVLDVWHRVLMNTEYQAPGARAVVFLD

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
88 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
89 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
90 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
94 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
95 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
96 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
97 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
100 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
101 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
102 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
108 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
112 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
113 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
114 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
115 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
123 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
124 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
125 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
126 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
127 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
128 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
129 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
130 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
131 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
132 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
133 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 2.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.07
Nodule 0
Rhizoplane 1.6
Rhizosphere 95.19
Stem 0
Stem Tuber 0
Unclassified 15.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100127644 3300005467 Bacteria 2372
2 Ga0070658_10009797 3300005327 Bacteria 7697
3 Ga0070683_100003554 3300005329 Bacteria 12682
4 Ga0070670_100090213 3300005331 Bacteria 2634
5 Ga0070670_100166249 3300005331 Bacteria 1913
6 Ga0070670_100176541 3300005331 Bacteria 1854
7 Ga0070689_100038070 3300005340 Bacteria 3678
8 Ga0070687_100209495 3300005343 Unclassified 1186
9 Ga0070692_10294525 3300005345 Unclassified 989
10 Ga0070671_100110936 3300005355 Bacteria 2304
11 Ga0070667_100385917 3300005367 Bacteria 1273
12 Ga0070667_100658745 3300005367 Unclassified 967
13 Ga0070694_100482292 3300005444 Unclassified 984
14 Ga0070708_100132198 3300005445 Bacteria 2310
15 Ga0070708_100523519 3300005445 Unclassified 1118
16 Ga0068867_100308606 3300005459 Bacteria 1307
17 Ga0070706_100000721 3300005467 Bacteria 37231
18 Ga0070707_100007848 3300005468 Bacteria 9906
19 Ga0070698_100000285 3300005471 Bacteria 51551
20 Ga0070698_100002513 3300005471 Bacteria 20221
21 Ga0070698_100022075 3300005471 Bacteria 6665
22 Ga0070699_100127859 3300005518 Unclassified 2238
23 Ga0070684_100026874 3300005535 Bacteria 4852
24 Ga0070672_100192781 3300005543 Bacteria 1702
25 Ga0070686_100028297 3300005544 Bacteria 3398
26 Ga0070686_100310627 3300005544 Bacteria 1172
27 Ga0070665_100357627 3300005548 Bacteria 1466
28 Ga0070704_100136286 3300005549 Bacteria 1910
29 Ga0068855_100023889 3300005563 Bacteria 7321
30 Ga0068855_100324417 3300005563 Unclassified 1701
31 Ga0070664_100354485 3300005564 Bacteria 1335
32 Ga0068857_100005004 3300005577 Bacteria 11264
33 Ga0068856_100005326 3300005614 Bacteria 12698
34 Ga0070702_100338532 3300005615 Bacteria 1055
35 Ga0068859_100031508 3300005617 Bacteria 5324
36 Ga0068859_100187481 3300005617 Bacteria 2152
37 Ga0068864_100182852 3300005618 Bacteria 1917
38 Ga0068861_100117332 3300005719 Bacteria 2142
39 Ga0068863_100441371 3300005841 Bacteria 1276
40 Ga0068860_100012691 3300005843 Bacteria 8288
41 Ga0068860_100080248 3300005843 Bacteria 3103
42 Ga0068860_100470570 3300005843 Bacteria 1251
43 Ga0068862_100146524 3300005844 Bacteria 2099
44 Ga0081455_10004384 3300005937 Bacteria 15895
45 Ga0070717_10024536 3300006028 Bacteria 4789
46 Ga0070712_100139828 3300006175 Unclassified 1846
47 Ga0097621_100381855 3300006237 Bacteria 1258
48 Ga0068871_100090292 3300006358 Bacteria 2551
49 Ga0075428_100069498 3300006844 Bacteria 3850
50 Ga0075431_100112598 3300006847 Bacteria 2808
51 Ga0075433_10062228 3300006852 Bacteria 3269
52 Ga0075434_100982592 3300006871 Bacteria 858
53 Ga0097620_100031508 3300006931 Bacteria 5324
54 Ga0097620_100187462 3300006931 Bacteria 2152
55 Ga0111539_10431284 3300009094 Bacteria 1535
56 Ga0111539_10477546 3300009094 Bacteria 1452
57 Ga0105245_10085363 3300009098 Bacteria 2893
58 Ga0114129_10096267 3300009147 Bacteria 4098
59 Ga0105248_10109104 3300009177 Bacteria 3120
60 Ga0105248_10128387 3300009177 Bacteria 2860
61 Ga0105249_10015730 3300009553 Bacteria 6700
62 Ga0105249_10032775 3300009553 Bacteria 4702
63 Ga0105249_10728755 3300009553 Unclassified 1053
64 Ga0105239_10508193 3300010375 Unclassified 1370
65 Ga0157369_10226530 3300013105 Bacteria 1955
66 Ga0157374_10391106 3300013296 Bacteria 1386
67 Ga0157378_10129401 3300013297 Bacteria 2335
68 Ga0157378_10440258 3300013297 Bacteria 1292
69 Ga0163162_10137944 3300013306 Bacteria 2550
70 Ga0163162_10162392 3300013306 Bacteria 2356
71 Ga0163162_10184408 3300013306 Bacteria 2213
72 Ga0163162_10448732 3300013306 Bacteria 1422
73 Ga0157372_10316999 3300013307 Unclassified 1815
74 Ga0157372_10398068 3300013307 Bacteria 1605
75 Ga0157375_10069204 3300013308 Bacteria 3535
76 Ga0163163_10005967 3300014325 Bacteria 10596
77 Ga0163163_10033307 3300014325 Bacteria 4983
78 Ga0163163_10249307 3300014325 Bacteria 1826
79 Ga0163163_10696823 3300014325 Unclassified 1079
80 Ga0157377_10068487 3300014745 Bacteria 2045
81 Ga0157377_10074445 3300014745 Bacteria 1970
82 Ga0157379_10075324 3300014968 Bacteria 3021
83 Ga0157376_10098082 3300014969 Bacteria 2554
84 Ga0197907_10495725 3300020069 Bacteria 1194
85 Ga0206355_1137002 3300020076 Bacteria 1038
86 Ga0206353_11048079 3300020082 Unclassified 1291
87 Ga0213876_10000022 3300021384 Bacteria 259520
88 Ga0213876_10000153 3300021384 Bacteria 73076
89 Ga0207647_10096368 3300025904 Bacteria 1761
90 Ga0207643_10275194 3300025908 Unclassified 1043
91 Ga0207705_10019124 3300025909 Bacteria 4899
92 Ga0207684_10000729 3300025910 Bacteria 38558
93 Ga0207684_10005955 3300025910 Bacteria 11162
94 Ga0207657_10040971 3300025919 Bacteria 4099
95 Ga0207646_10006242 3300025922 Bacteria 12377
96 Ga0207650_10142022 3300025925 Bacteria 1888
97 Ga0207650_10193931 3300025925 Bacteria 1624
98 Ga0207650_10246630 3300025925 Bacteria 1445
99 Ga0207687_10070882 3300025927 Bacteria 2489
100 Ga0207670_10383420 3300025936 Bacteria 1120
101 Ga0207711_10008204 3300025941 Bacteria 8742
102 Ga0207711_10086069 3300025941 Unclassified 2755
103 Ga0207661_10004008 3300025944 Bacteria 10293
104 Ga0207679_10201415 3300025945 Bacteria 1663
105 Ga0207667_10009994 3300025949 Bacteria 11129
106 Ga0207712_10018961 3300025961 Bacteria 4488
107 Ga0207703_10215040 3300026035 Bacteria 1716
108 Ga0207702_10183374 3300026078 Bacteria 1929
109 Ga0207641_10337473 3300026088 Bacteria 1433
110 Ga0207676_10042726 3300026095 Bacteria 3486
111 Ga0207676_10050185 3300026095 Bacteria 3251
112 Ga0207676_10116708 3300026095 Bacteria 2243
113 Ga0207676_10270654 3300026095 Bacteria 1538
114 Ga0207674_10002488 3300026116 Bacteria 23230
115 Ga0207674_10436361 3300026116 Bacteria 1266
116 Ga0207675_100141968 3300026118 Bacteria 2282
117 Ga0207698_10081250 3300026142 Bacteria 2615
118 Ga0207428_10225496 3300027907 Bacteria 1403
119 Ga0268266_10277324 3300028379 Unclassified 1558
120 Ga0268264_10019433 3300028381 Bacteria 5552
121 Ga0268264_10334640 3300028381 Bacteria 1436
122 Ga0265338_10037405 3300028800 Bacteria 4620
123 Ga0316576_10283719 3300031727 Bacteria 1240
124 Ga0307405_10015879 3300031731 Bacteria 4091
125 Ga0307410_10206357 3300031852 Bacteria 1503
126 Ga0307406_10045951 3300031901 Bacteria 2744
127 Ga0307412_10004451 3300031911 Bacteria 7806
128 Ga0307409_100308004 3300031995 Bacteria 1477
129 Ga0307411_10415502 3300032005 Bacteria 1116
130 Ga0373937_0015335 3300036401 Bacteria 6777
131 Ga0373937_0258179 3300036401 Bacteria 1643
132 Ga0316584_0513317 3300036712 Unclassified 841
133 Ga0395899_0282319 3300037312 Unclassified 1129
134 Ga0395898_0241096 3300037466 Unclassified 1724
135 Ga0395901_0850723 3300038443 Unclassified 897
136 Ga0436365_0407503 3300039437 Bacteria 219857
137 Ga0436365_1438887 3300039437 Bacteria 84801
138 Ga0439453_0014737 3300041408 Bacteria 1344
139 Ga0439451_016236 3300042009 Bacteria 1501
140 Ga0439434_0009519 3300042435 Bacteria 2858
141 Ga0495664_0265813 3300046477 Bacteria 1037
142 Ga0495608_0030566 3300046511 Bacteria 3646
143 Ga0495608_0291968 3300046511 Unclassified 1010
144 Ga0495630_0102073 3300046517 Bacteria 2170
145 Ga0495586_0130894 3300046535 Bacteria 1405
146 Ga0495621_0142423 3300046539 Unclassified 939
147 Ga0495667_0123913 3300046559 Unclassified 1668
148 Ga0495667_0253595 3300046559 Bacteria 1119
149 Ga0495668_0000629 3300046616 Bacteria 42412
150 Ga0495613_0051593 3300046689 Bacteria 3031
151 Ga0495613_0086274 3300046689 Bacteria 2276
152 Ga0495581_0135643 3300047315 Bacteria 1435
153 Ga0495674_0094193 3300047319 Bacteria 2555
154 Ga0495675_0038087 3300047444 Bacteria 3063
155 Ga0495684_0240153 3300047471 Bacteria 1322
156 Ga0496102_0413490 3300048905 Bacteria 1267
157 Ga0496104_0168915 3300048907 Bacteria 2098
158 Ga0496104_0589122 3300048907 Bacteria 1022
159 Ga0501311_006697 3300049527 Unclassified 1306
160 Ga0501040_0184002 3300049576 Unclassified 1481
161 Ga0501042_0015712 3300049578 Bacteria 5187
162 Ga0501046_0254867 3300049580 Unclassified 1291
163 Ga0501072_0009510 3300049588 Bacteria 7393
164 Ga0501072_0292753 3300049588 Unclassified 1294
165 Ga0501075_0015361 3300049591 Bacteria 5494
166 Ga0501076_0054619 3300049592 Bacteria 3166
167 Ga0501202_002266 3300049652 Bacteria 3216
168 Ga0501216_000287 3300049660 Bacteria 5643
169 Ga0501217_000107 3300049661 Bacteria 10712
170 Ga0501223_003577 3300049663 Bacteria 3362
171 Ga0501224_010879 3300049664 Bacteria 1336
172 Ga0501227_001101 3300049665 Bacteria 6008
173 Ga0501233_017175 3300049668 Bacteria 1508
174 Ga0501235_003008 3300049669 Bacteria 3636
175 Ga0501257_009941 3300049686 Bacteria 2153
176 Ga0501225_0004040 3300049705 Bacteria 4389
177 Ga0501080_0010299 3300049742 Bacteria 8548
178 nmdc:mga05p37_33516_c1 3300050507 Bacteria 6290
179 nmdc:mga05p37_869550_c1 3300050507 Unclassified 976
180 nmdc:mga06r32_47442_c1 3300050510 Bacteria 4103
181 nmdc:mga08y16_368531_c1 3300050511 Bacteria 1474
182 nmdc:mga0n895_276209_c1 3300050512 Bacteria 1704
183 nmdc:mga0n895_841048_c1 3300050512 Bacteria 906
184 nmdc:mga0a205_196373_c1 3300050515 Unclassified 1909
185 nmdc:mga0a205_198831_c1 3300050515 Bacteria 1895
186 Ga0500616_0005093 3300053153 Bacteria 9067
187 Ga0500616_0030963 3300053153 Bacteria 2935
188 Ga0070706_100127644
189 Ga0070658_10009797
190 Ga0070683_100003554
191 Ga0070670_100090213
192 Ga0070670_100166249
193 Ga0070670_100176541
194 Ga0070689_100038070
195 Ga0070687_100209495
196 Ga0070692_10294525
197 Ga0070671_100110936
198 Ga0070667_100385917
199 Ga0070667_100658745
200 Ga0070694_100482292
201 Ga0070708_100132198
202 Ga0070708_100523519
203 Ga0068867_100308606
204 Ga0070706_100000721
205 Ga0070707_100007848
206 Ga0070698_100000285
207 Ga0070698_100002513
208 Ga0070698_100022075
209 Ga0070699_100127859
210 Ga0070684_100026874
211 Ga0070672_100192781
212 Ga0070686_100028297
213 Ga0070686_100310627
214 Ga0070665_100357627
215 Ga0070704_100136286
216 Ga0068855_100023889
217 Ga0068855_100324417
218 Ga0070664_100354485
219 Ga0068857_100005004
220 Ga0068856_100005326
221 Ga0070702_100338532
222 Ga0068859_100031508
223 Ga0068859_100187481
224 Ga0068864_100182852
225 Ga0068861_100117332
226 Ga0068863_100441371
227 Ga0068860_100012691
228 Ga0068860_100080248
229 Ga0068860_100470570
230 Ga0068862_100146524
231 Ga0081455_10004384
232 Ga0070717_10024536
233 Ga0070712_100139828
234 Ga0097621_100381855
235 Ga0068871_100090292
236 Ga0075428_100069498
237 Ga0075431_100112598
238 Ga0075433_10062228
239 Ga0075434_100982592
240 Ga0097620_100031508
241 Ga0097620_100187462
242 Ga0111539_10431284
243 Ga0111539_10477546
244 Ga0105245_10085363
245 Ga0114129_10096267
246 Ga0105248_10109104
247 Ga0105248_10128387
248 Ga0105249_10015730
249 Ga0105249_10032775
250 Ga0105249_10728755
251 Ga0105239_10508193
252 Ga0157369_10226530
253 Ga0157374_10391106
254 Ga0157378_10129401
255 Ga0157378_10440258
256 Ga0163162_10137944
257 Ga0163162_10162392
258 Ga0163162_10184408
259 Ga0163162_10448732
260 Ga0157372_10316999
261 Ga0157372_10398068
262 Ga0157375_10069204
263 Ga0163163_10005967
264 Ga0163163_10033307
265 Ga0163163_10249307
266 Ga0163163_10696823
267 Ga0157377_10068487
268 Ga0157377_10074445
269 Ga0157379_10075324
270 Ga0157376_10098082
271 Ga0197907_10495725
272 Ga0206355_1137002
273 Ga0206353_11048079
274 Ga0213876_10000022
275 Ga0213876_10000153
276 Ga0207647_10096368
277 Ga0207643_10275194
278 Ga0207705_10019124
279 Ga0207684_10000729
280 Ga0207684_10005955
281 Ga0207657_10040971
282 Ga0207646_10006242
283 Ga0207650_10142022
284 Ga0207650_10193931
285 Ga0207650_10246630
286 Ga0207687_10070882
287 Ga0207670_10383420
288 Ga0207711_10008204
289 Ga0207711_10086069
290 Ga0207661_10004008
291 Ga0207679_10201415
292 Ga0207667_10009994
293 Ga0207712_10018961
294 Ga0207703_10215040
295 Ga0207702_10183374
296 Ga0207641_10337473
297 Ga0207676_10042726
298 Ga0207676_10050185
299 Ga0207676_10116708
300 Ga0207676_10270654
301 Ga0207674_10002488
302 Ga0207674_10436361
303 Ga0207675_100141968
304 Ga0207698_10081250
305 Ga0207428_10225496
306 Ga0268266_10277324
307 Ga0268264_10019433
308 Ga0268264_10334640
309 Ga0265338_10037405
310 Ga0316576_10283719
311 Ga0307405_10015879
312 Ga0307410_10206357
313 Ga0307406_10045951
314 Ga0307412_10004451
315 Ga0307409_100308004
316 Ga0307411_10415502
317 Ga0373937_0015335
318 Ga0373937_0258179
319 Ga0316584_0513317
320 Ga0395899_0282319
321 Ga0395898_0241096
322 Ga0395901_0850723
323 Ga0436365_0407503
324 Ga0436365_1438887
325 Ga0439453_0014737
326 Ga0439451_016236
327 Ga0439434_0009519
328 Ga0495664_0265813
329 Ga0495608_0030566
330 Ga0495608_0291968
331 Ga0495630_0102073
332 Ga0495586_0130894
333 Ga0495621_0142423
334 Ga0495667_0123913
335 Ga0495667_0253595
336 Ga0495668_0000629
337 Ga0495613_0051593
338 Ga0495613_0086274
339 Ga0495581_0135643
340 Ga0495674_0094193
341 Ga0495675_0038087
342 Ga0495684_0240153
343 Ga0496102_0413490
344 Ga0496104_0168915
345 Ga0496104_0589122
346 Ga0501311_006697
347 Ga0501040_0184002
348 Ga0501042_0015712
349 Ga0501046_0254867
350 Ga0501072_0009510
351 Ga0501072_0292753
352 Ga0501075_0015361
353 Ga0501076_0054619
354 Ga0501202_002266
355 Ga0501216_000287
356 Ga0501217_000107
357 Ga0501223_003577
358 Ga0501224_010879
359 Ga0501227_001101
360 Ga0501233_017175
361 Ga0501235_003008
362 Ga0501257_009941
363 Ga0501225_0004040
364 Ga0501080_0010299
365 nmdc:mga05p37_33516_c1
366 nmdc:mga05p37_869550_c1
367 nmdc:mga06r32_47442_c1
368 nmdc:mga08y16_368531_c1
369 nmdc:mga0n895_276209_c1
370 nmdc:mga0n895_841048_c1
371 nmdc:mga0a205_196373_c1
372 nmdc:mga0a205_198831_c1
373 Ga0500616_0005093
374 Ga0500616_0030963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fu5-assembly2.cif.gz_C structure of rab8 in complex with mss4 0.7084 17 52
1vg0-assembly1.cif.gz_B the crystal structures of the rep-1 protein in complex with monoprenylated rab7 protein 0.7075 17 52
5ksp-assembly2.cif.gz_B hmiro1 c-domain gdp complex c2221 crystal form 0.7049 16 52
5ksp-assembly1.cif.gz_A hmiro1 c-domain gdp complex c2221 crystal form 0.7033 16 52
2fu5-assembly1.cif.gz_D structure of rab8 in complex with mss4 0.7024 17 52
ID Description Score Start End Superfamily
af_Q8IL66_279_371_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.7881 193 226 3.30.160.60
af_O62361_1_101_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7455 59 103 3.40.1000.30
af_Q564Q9_2_94_3.40.1000.30 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A; 0.7102 58 103 3.40.1000.30
2fu5C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7084 17 52 3.40.50.300
5kspB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7049 16 52 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A496VDZ6-F1-model_v4 Uncharacterized protein 0.9268 1 270
AF-A0A496VDZ6-F1-model_v4 Uncharacterized protein 0.9234 1 270
AF-A0A7Y5BXJ6-F1-model_v4 Uncharacterized protein 0.9165 1 270
AF-A0A7Y5BXJ6-F1-model_v4 Uncharacterized protein 0.9132 1 270
AF-A0A7C1NJX2-F1-model_v4 Site-specific DNA-methyltransferase 0.9068 1 270

Map