F286041

General Info

Members Datasets Scaffolds Average Seq Length
186 119 372 190

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10005014|Ga0182008_100050142
Length 206
Sequence MKKNLITAILMTVATTILLGIIYPLLVTGLAQSIFPKQANGQLIQKDGKIIGSSIIAQGFTSPGYFHPRPSFAGAGYDPMNSNGSQLGPTNQKLIDRVKDDVTKAQNDDRRALVPIDLVSASASGLDPHITPAAAEFQLARVAKERGTTTDQLRALVQAHTEGRQLGFLGEPRVNVLELNLELDERFPKKQQPSLNTNLAQMYGGN

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
47 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
78 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
79 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
84 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
89 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
98 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
99 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
103 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
104 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
108 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
109 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
114 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
115 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.39
Metatranscriptomes 1.61
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 2.69
Rhizosphere 95.16
Stem 0
Stem Tuber 0
Unclassified 13.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10005014 3300014497 Bacteria 7618
2 Ga0065715_10255126 3300005293 Bacteria 1155
3 Ga0070680_100368513 3300005336 Bacteria 1222
4 Ga0070680_100458000 3300005336 Bacteria 1090
5 Ga0068868_100324237 3300005338 Bacteria 1313
6 Ga0070661_100086821 3300005344 Bacteria 2313
7 Ga0070671_100912507 3300005355 Unclassified 768
8 Ga0070714_100410057 3300005435 Bacteria 1282
9 Ga0070714_100520585 3300005435 Bacteria 1136
10 Ga0070714_100663509 3300005435 Unclassified 1004
11 Ga0070714_100789326 3300005435 Unclassified 919
12 Ga0070714_101529940 3300005435 Unclassified 652
13 Ga0070713_100362028 3300005436 Bacteria 1348
14 Ga0070713_100478673 3300005436 Bacteria 1172
15 Ga0070713_101056530 3300005436 Bacteria 784
16 Ga0070713_101359434 3300005436 Unclassified 688
17 Ga0070711_100075156 3300005439 Bacteria 2392
18 Ga0070711_100966263 3300005439 Bacteria 730
19 Ga0070708_100016018 3300005445 Bacteria 6209
20 Ga0070708_100296494 3300005445 Bacteria 1522
21 Ga0070708_100370694 3300005445 Bacteria 1350
22 Ga0070708_101337884 3300005445 Unclassified 669
23 Ga0070681_10193795 3300005458 Bacteria 1951
24 Ga0070681_10391175 3300005458 Bacteria 1301
25 Ga0070706_100007511 3300005467 Bacteria 10218
26 Ga0070706_100165051 3300005467 Bacteria 2068
27 Ga0070706_101059401 3300005467 Bacteria 747
28 Ga0070706_101376679 3300005467 Bacteria 646
29 Ga0070707_100006661 3300005468 Bacteria 10701
30 Ga0070707_100664442 3300005468 Bacteria 1005
31 Ga0070698_100005177 3300005471 Bacteria 14261
32 Ga0070698_101029859 3300005471 Bacteria 771
33 Ga0070699_100001183 3300005518 Bacteria 24159
34 Ga0070699_100107380 3300005518 Bacteria 2449
35 Ga0070699_100163309 3300005518 Bacteria 1972
36 Ga0070699_100541894 3300005518 Bacteria 1059
37 Ga0070699_100951187 3300005518 Unclassified 787
38 Ga0070679_100002243 3300005530 Bacteria 17462
39 Ga0070679_100332641 3300005530 Unclassified 1467
40 Ga0070679_100461509 3300005530 Bacteria 1215
41 Ga0070697_100004353 3300005536 Bacteria 10861
42 Ga0070697_100707126 3300005536 Bacteria 889
43 Ga0068853_100138735 3300005539 Bacteria 2182
44 Ga0070695_100669159 3300005545 Bacteria 821
45 Ga0070696_100000050 3300005546 Bacteria 54623
46 Ga0068857_100223691 3300005577 Bacteria 1720
47 Ga0068857_100722333 3300005577 Unclassified 947
48 Ga0068856_100859322 3300005614 Bacteria 926
49 Ga0081539_10064071 3300005985 Bacteria 2002
50 Ga0070717_10001016 3300006028 Bacteria 18810
51 Ga0070717_10026871 3300006028 Bacteria 4596
52 Ga0070717_10070368 3300006028 Bacteria 2916
53 Ga0070717_10220674 3300006028 Bacteria 1666
54 Ga0070717_10749384 3300006028 Bacteria 888
55 Ga0070712_100939893 3300006175 Unclassified 746
56 Ga0068871_100115395 3300006358 Bacteria 2264
57 Ga0075430_100518735 3300006846 Unclassified 983
58 Ga0075431_100005887 3300006847 Bacteria 12132
59 Ga0075433_10010107 3300006852 Bacteria 7565
60 Ga0075433_10137487 3300006852 Bacteria 2172
61 Ga0075434_100001389 3300006871 Bacteria 20316
62 Ga0075434_100001629 3300006871 Bacteria 19106
63 Ga0075436_100029278 3300006914 Bacteria 3787
64 Ga0075436_100051483 3300006914 Bacteria 2842
65 Ga0075436_100078350 3300006914 Bacteria 2289
66 Ga0075436_100206259 3300006914 Bacteria 1393
67 Ga0097620_100122389 3300006931 Bacteria 2669
68 Ga0075435_100000266 3300007076 Bacteria 32549
69 Ga0099795_10017699 3300007788 Bacteria 2277
70 Ga0105240_10000002 3300009093 Bacteria 1924170
71 Ga0105240_10147868 3300009093 Bacteria 2801
72 Ga0111539_10041471 3300009094 Bacteria 5534
73 Ga0114129_11194001 3300009147 Bacteria 948
74 Ga0105243_10821977 3300009148 Bacteria 918
75 Ga0105241_10001564 3300009174 Bacteria 17507
76 Ga0105248_10536738 3300009177 Bacteria 1319
77 Ga0105237_10069076 3300009545 Bacteria 3528
78 Ga0105237_10193442 3300009545 Bacteria 2034
79 Ga0105238_10555089 3300009551 Bacteria 1153
80 Ga0105238_11175734 3300009551 Bacteria 791
81 Ga0157373_10009903 3300013100 Bacteria 7026
82 Ga0157370_10570911 3300013104 Bacteria 1036
83 Ga0157369_10038917 3300013105 Bacteria 5198
84 Ga0157369_10203754 3300013105 Bacteria 2076
85 Ga0157374_10084980 3300013296 Bacteria 3008
86 Ga0157378_10130631 3300013297 Bacteria 2325
87 Ga0157378_10137303 3300013297 Bacteria 2268
88 Ga0163162_10524830 3300013306 Bacteria 1313
89 Ga0157372_10001066 3300013307 Bacteria 29985
90 Ga0157372_10137898 3300013307 Bacteria 2810
91 Ga0157376_11147421 3300014969 Unclassified 804
92 Ga0182007_10011081 3300015262 Bacteria 3524
93 Ga0182005_1154709 3300015265 Unclassified 669
94 Ga0213876_10007669 3300021384 Bacteria 5860
95 Ga0209233_1038338 3300025261 Bacteria 1058
96 Ga0207699_10545122 3300025906 Bacteria 841
97 Ga0207643_10045307 3300025908 Bacteria 2484
98 Ga0207684_10007645 3300025910 Bacteria 9695
99 Ga0207684_10424157 3300025910 Bacteria 1143
100 Ga0207684_10758318 3300025910 Bacteria 822
101 Ga0207707_10002870 3300025912 Bacteria 15399
102 Ga0207707_10545811 3300025912 Unclassified 985
103 Ga0207695_10000002 3300025913 Bacteria 2188391
104 Ga0207695_10190046 3300025913 Bacteria 1971
105 Ga0207671_10327430 3300025914 Bacteria 1213
106 Ga0207660_10174699 3300025917 Bacteria 1665
107 Ga0207660_10467990 3300025917 Unclassified 1021
108 Ga0207657_10019930 3300025919 Bacteria 6354
109 Ga0207652_10004773 3300025921 Bacteria 10989
110 Ga0207652_10316267 3300025921 Bacteria 1409
111 Ga0207652_10930108 3300025921 Bacteria 767
112 Ga0207646_10000415 3300025922 Bacteria 57158
113 Ga0207646_10327405 3300025922 Bacteria 1384
114 Ga0207646_10330369 3300025922 Bacteria 1377
115 Ga0207694_10265422 3300025924 Unclassified 1407
116 Ga0207659_10021861 3300025926 Bacteria 4254
117 Ga0207700_10176460 3300025928 Bacteria 1786
118 Ga0207700_10203791 3300025928 Bacteria 1668
119 Ga0207664_10090005 3300025929 Bacteria 2514
120 Ga0207664_10554316 3300025929 Unclassified 1031
121 Ga0207706_10197855 3300025933 Bacteria 1762
122 Ga0207665_10205242 3300025939 Bacteria 1437
123 Ga0207711_10980607 3300025941 Bacteria 784
124 Ga0207679_10389760 3300025945 Bacteria 1223
125 Ga0207667_10365034 3300025949 Bacteria 1472
126 Ga0207698_10319842 3300026142 Bacteria 1453
127 Ga0209179_1015660 3300027512 Bacteria 1412
128 Ga0207428_10135012 3300027907 Bacteria 1886
129 Ga0265356_1000350 3300028017 Bacteria 8423
130 Ga0265338_10036142 3300028800 Bacteria 4734
131 Ga0265338_10138417 3300028800 Bacteria 1910
132 Ga0265762_1013786 3300030760 Bacteria 1456
133 Ga0265760_10000739 3300031090 Bacteria 9335
134 Ga0265760_10046487 3300031090 Bacteria 1302
135 Ga0307408_100090009 3300031548 Bacteria 2315
136 Ga0373926_0008221 3300035083 Bacteria 3473
137 Ga0373934_0004481 3300035086 Bacteria 5160
138 Ga0373953_0026707 3300035117 Bacteria 2213
139 Ga0373956_0003518 3300035119 Bacteria 6306
140 Ga0373955_0003108 3300035172 Bacteria 7266
141 Ga0373935_0388612 3300035692 Bacteria 1000
142 Ga0373927_0313800 3300035695 Bacteria 1032
143 Ga0373933_0001618 3300035724 Bacteria 13142
144 Ga0373937_0000669 3300036401 Bacteria 29860
145 Ga0373937_0199256 3300036401 Bacteria 1882
146 Ga0395905_0254007 3300037471 Bacteria 1642
147 Ga0436365_0885092 3300039437 Bacteria 4078
148 Ga0436363_0305738 3300039450 Bacteria 10027
149 Ga0466966_0624678 3300044684 Bacteria 649
150 Ga0453684_1109894 3300044712 Unclassified 835
151 Ga0466967_0184305 3300045976 Bacteria 1970
152 Ga0466967_1044331 3300045976 Unclassified 814
153 Ga0495580_0007278 3300046472 Bacteria 8899
154 Ga0495580_0007434 3300046472 Bacteria 8806
155 Ga0495580_0357047 3300046472 Bacteria 989
156 Ga0495582_0554635 3300046473 Unclassified 665
157 Ga0495606_0015776 3300046507 Bacteria 5798
158 Ga0495630_0501007 3300046517 Unclassified 931
159 Ga0495635_0275147 3300046663 Unclassified 1132
160 Ga0495599_0153397 3300046678 Bacteria 1426
161 Ga0495674_0247685 3300047319 Bacteria 1467
162 Ga0495674_0952965 3300047319 Unclassified 660
163 Ga0495680_0376897 3300047322 Bacteria 983
164 Ga0495686_0000547 3300047472 Bacteria 53728
165 Ga0496107_0102346 3300048910 Bacteria 2100
166 Ga0496110_0391965 3300048913 Bacteria 1266
167 Ga0496111_0079250 3300048914 Bacteria 2396
168 Ga0496112_0547132 3300048915 Unclassified 1091
169 Ga0496113_0197525 3300048916 Bacteria 1598
170 Ga0501083_0314832 3300049744 Bacteria 1018
171 nmdc:mga05p37_1012153_c1 3300050507 Bacteria 881
172 nmdc:mga0qj67_495141_c1 3300050509 Unclassified 983
173 nmdc:mga06r32_58476_c1 3300050510 Bacteria 3705
174 nmdc:mga08y16_8336_c1 3300050511 Bacteria 10846
175 nmdc:mga0n895_11905_c1 3300050512 Bacteria 7784
176 nmdc:mga0n895_1620_c1 3300050512 Bacteria 16965
177 nmdc:mga0n895_753518_c1 3300050512 Unclassified 967
178 nmdc:mga0rr50_343_c1 3300050513 Bacteria 17452
179 nmdc:mga0rr50_49221_c1 3300050513 Bacteria 3119
180 nmdc:mga08x19_10727_c1 3300050514 Bacteria 5505
181 nmdc:mga08x19_122038_c1 3300050514 Bacteria 1748
182 nmdc:mga08x19_195521_c1 3300050514 Bacteria 1385
183 nmdc:mga08x19_50132_c1 3300050514 Bacteria 1943
184 nmdc:mga0a205_36974_c1 3300050515 Bacteria 4694
185 nmdc:mga0a205_49629_c1 3300050515 Bacteria 4051
186 nmdc:mga0a205_5195_c1 3300050515 Bacteria 5354
187 Ga0182008_10005014
188 Ga0065715_10255126
189 Ga0070680_100368513
190 Ga0070680_100458000
191 Ga0068868_100324237
192 Ga0070661_100086821
193 Ga0070671_100912507
194 Ga0070714_100410057
195 Ga0070714_100520585
196 Ga0070714_100663509
197 Ga0070714_100789326
198 Ga0070714_101529940
199 Ga0070713_100362028
200 Ga0070713_100478673
201 Ga0070713_101056530
202 Ga0070713_101359434
203 Ga0070711_100075156
204 Ga0070711_100966263
205 Ga0070708_100016018
206 Ga0070708_100296494
207 Ga0070708_100370694
208 Ga0070708_101337884
209 Ga0070681_10193795
210 Ga0070681_10391175
211 Ga0070706_100007511
212 Ga0070706_100165051
213 Ga0070706_101059401
214 Ga0070706_101376679
215 Ga0070707_100006661
216 Ga0070707_100664442
217 Ga0070698_100005177
218 Ga0070698_101029859
219 Ga0070699_100001183
220 Ga0070699_100107380
221 Ga0070699_100163309
222 Ga0070699_100541894
223 Ga0070699_100951187
224 Ga0070679_100002243
225 Ga0070679_100332641
226 Ga0070679_100461509
227 Ga0070697_100004353
228 Ga0070697_100707126
229 Ga0068853_100138735
230 Ga0070695_100669159
231 Ga0070696_100000050
232 Ga0068857_100223691
233 Ga0068857_100722333
234 Ga0068856_100859322
235 Ga0081539_10064071
236 Ga0070717_10001016
237 Ga0070717_10026871
238 Ga0070717_10070368
239 Ga0070717_10220674
240 Ga0070717_10749384
241 Ga0070712_100939893
242 Ga0068871_100115395
243 Ga0075430_100518735
244 Ga0075431_100005887
245 Ga0075433_10010107
246 Ga0075433_10137487
247 Ga0075434_100001389
248 Ga0075434_100001629
249 Ga0075436_100029278
250 Ga0075436_100051483
251 Ga0075436_100078350
252 Ga0075436_100206259
253 Ga0097620_100122389
254 Ga0075435_100000266
255 Ga0099795_10017699
256 Ga0105240_10000002
257 Ga0105240_10147868
258 Ga0111539_10041471
259 Ga0114129_11194001
260 Ga0105243_10821977
261 Ga0105241_10001564
262 Ga0105248_10536738
263 Ga0105237_10069076
264 Ga0105237_10193442
265 Ga0105238_10555089
266 Ga0105238_11175734
267 Ga0157373_10009903
268 Ga0157370_10570911
269 Ga0157369_10038917
270 Ga0157369_10203754
271 Ga0157374_10084980
272 Ga0157378_10130631
273 Ga0157378_10137303
274 Ga0163162_10524830
275 Ga0157372_10001066
276 Ga0157372_10137898
277 Ga0157376_11147421
278 Ga0182007_10011081
279 Ga0182005_1154709
280 Ga0213876_10007669
281 Ga0209233_1038338
282 Ga0207699_10545122
283 Ga0207643_10045307
284 Ga0207684_10007645
285 Ga0207684_10424157
286 Ga0207684_10758318
287 Ga0207707_10002870
288 Ga0207707_10545811
289 Ga0207695_10000002
290 Ga0207695_10190046
291 Ga0207671_10327430
292 Ga0207660_10174699
293 Ga0207660_10467990
294 Ga0207657_10019930
295 Ga0207652_10004773
296 Ga0207652_10316267
297 Ga0207652_10930108
298 Ga0207646_10000415
299 Ga0207646_10327405
300 Ga0207646_10330369
301 Ga0207694_10265422
302 Ga0207659_10021861
303 Ga0207700_10176460
304 Ga0207700_10203791
305 Ga0207664_10090005
306 Ga0207664_10554316
307 Ga0207706_10197855
308 Ga0207665_10205242
309 Ga0207711_10980607
310 Ga0207679_10389760
311 Ga0207667_10365034
312 Ga0207698_10319842
313 Ga0209179_1015660
314 Ga0207428_10135012
315 Ga0265356_1000350
316 Ga0265338_10036142
317 Ga0265338_10138417
318 Ga0265762_1013786
319 Ga0265760_10000739
320 Ga0265760_10046487
321 Ga0307408_100090009
322 Ga0373926_0008221
323 Ga0373934_0004481
324 Ga0373953_0026707
325 Ga0373956_0003518
326 Ga0373955_0003108
327 Ga0373935_0388612
328 Ga0373927_0313800
329 Ga0373933_0001618
330 Ga0373937_0000669
331 Ga0373937_0199256
332 Ga0395905_0254007
333 Ga0436365_0885092
334 Ga0436363_0305738
335 Ga0466966_0624678
336 Ga0453684_1109894
337 Ga0466967_0184305
338 Ga0466967_1044331
339 Ga0495580_0007278
340 Ga0495580_0007434
341 Ga0495580_0357047
342 Ga0495582_0554635
343 Ga0495606_0015776
344 Ga0495630_0501007
345 Ga0495635_0275147
346 Ga0495599_0153397
347 Ga0495674_0247685
348 Ga0495674_0952965
349 Ga0495680_0376897
350 Ga0495686_0000547
351 Ga0496107_0102346
352 Ga0496110_0391965
353 Ga0496111_0079250
354 Ga0496112_0547132
355 Ga0496113_0197525
356 Ga0501083_0314832
357 nmdc:mga05p37_1012153_c1
358 nmdc:mga0qj67_495141_c1
359 nmdc:mga06r32_58476_c1
360 nmdc:mga08y16_8336_c1
361 nmdc:mga0n895_11905_c1
362 nmdc:mga0n895_1620_c1
363 nmdc:mga0n895_753518_c1
364 nmdc:mga0rr50_343_c1
365 nmdc:mga0rr50_49221_c1
366 nmdc:mga08x19_10727_c1
367 nmdc:mga08x19_122038_c1
368 nmdc:mga08x19_195521_c1
369 nmdc:mga08x19_50132_c1
370 nmdc:mga0a205_36974_c1
371 nmdc:mga0a205_49629_c1
372 nmdc:mga0a205_5195_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

5

185

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.779 8 188
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7717 8 188
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7497 8 188
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7471 8 188
6t1t-assembly1.cif.gz_A cytochrome p450 reductase in complex with nadph from candida tropicalis 0.6685 134 159
ID Description Score Start End Superfamily
1hf0B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8823 136 159 1.10.10.60
1hf0A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.8738 136 159 1.10.10.60
af_A0A1D8PLR7_520_680_3.40.50.80 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 0.6663 134 159 3.40.50.80
af_Q9W4L4_2_67_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6172 130 158 1.10.10.10
af_B0G147_169_273_1.10.238.200 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain 0.5863 122 187 1.10.238.200
ID Description Score Start End GO Terms
AF-A0A833KLW5-F1-model_v4 deleted 0.9476 127 187
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.944 114 186 GO:0005524
GO:0005886
GO:0008556
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.9398 120 186 GO:0005524
GO:0005886
GO:0008556
AF-A0A6D0IM01-F1-model_v4 Potassium-transporting ATPase subunit C 0.9369 130 188 GO:0005524
GO:0005886
GO:0008556
AF-Q8VTB5-F1-model_v4 FrrA 0.936 127 187 GO:0005524
GO:0005886
GO:0008556

Map