F285919

General Info

Members Datasets Scaffolds Average Seq Length
186 117 185 253

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10302621|Ga0105243_103026212
Length 286
Sequence MVGDITALALDADACILVRMHLFSDKTILITGGAGGIGRASAERFLEEGANVVLSGTRHDKLEAVQADLDPSGERTLIVPGQIATREQAQALVAAAVERFGGVDVLVNSTGIFRPVPFEEQTEEHFEEALGSILRPTFWTSQAVVAAMRERGGGAIVNVGSMWAVDAIATTPTSAYSAAQAGRHVLTKNLAIELAADHIRVNTVALAFVETPAYERFMDREQALEVLDAVGPFHPLGRRGQPSDVVEAILFYAGDGAGWITGTTLPIDGGVLAGRSPAVHAEVAAA

Samples

Sample ID Description Type Environment
1 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
21 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
26 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
48 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
49 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
50 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
51 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
54 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
55 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
56 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
59 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
60 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
61 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
62 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
63 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
71 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
72 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
73 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
74 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
75 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
76 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
77 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
78 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
79 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
80 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
81 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
87 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
88 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
95 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
96 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
97 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
98 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
99 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
100 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
101 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
102 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
103 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
104 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
105 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
113 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
114 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
115 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
116 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
117 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.15
Rhizosphere 97.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10033750 3300003373 Bacteria 1321
2 Ga0070658_10188584 3300005327 Bacteria 1737
3 Ga0070680_100009013 3300005336 Bacteria 7650
4 Ga0070682_100087393 3300005337 Bacteria 2032
5 Ga0068868_100073795 3300005338 Bacteria 2724
6 Ga0068868_100103501 3300005338 Bacteria 2306
7 Ga0070687_100015265 3300005343 Bacteria 3468
8 Ga0070659_100019448 3300005366 Bacteria 5147
9 Ga0070659_100360802 3300005366 Bacteria 1221
10 Ga0070700_100138219 3300005441 Bacteria 1652
11 Ga0070700_100145109 3300005441 Bacteria 1617
12 Ga0070681_10060956 3300005458 Bacteria 3749
13 Ga0068867_100130334 3300005459 Bacteria 1953
14 Ga0070679_100070955 3300005530 Bacteria 3474
15 Ga0070684_100400169 3300005535 Bacteria 1266
16 Ga0070672_100216337 3300005543 Bacteria 1606
17 Ga0068854_100086246 3300005578 Bacteria 2327
18 Ga0068854_100362587 3300005578 Bacteria 1189
19 Ga0070702_100061577 3300005615 Bacteria 2185
20 Ga0068859_100093883 3300005617 Bacteria 3051
21 Ga0068859_100232266 3300005617 Bacteria 1933
22 Ga0068864_100163987 3300005618 Bacteria 2022
23 Ga0068861_100129219 3300005719 Bacteria 2049
24 Ga0068851_10112932 3300005834 Bacteria 1452
25 Ga0068851_10116622 3300005834 Bacteria 1431
26 Ga0068870_10157749 3300005840 Bacteria 1343
27 Ga0081455_10071540 3300005937 Bacteria 2875
28 Ga0081538_10001110 3300005981 Bacteria 28504
29 Ga0081538_10001514 3300005981 Bacteria 23833
30 Ga0081538_10008641 3300005981 Bacteria 8612
31 Ga0081538_10010240 3300005981 Bacteria 7705
32 Ga0081538_10022786 3300005981 Bacteria 4524
33 Ga0081538_10023853 3300005981 Bacteria 4380
34 Ga0081538_10029805 3300005981 Bacteria 3719
35 Ga0081539_10002081 3300005985 Bacteria 29921
36 Ga0068871_100486143 3300006358 Bacteria 1111
37 Ga0068865_100069001 3300006881 Bacteria 2500
38 Ga0097620_100093887 3300006931 Bacteria 3051
39 Ga0097620_100232270 3300006931 Bacteria 1933
40 Ga0105244_10204211 3300009036 Bacteria 931
41 Ga0111539_10076116 3300009094 Bacteria 3952
42 Ga0111539_11156649 3300009094 Bacteria 899
43 Ga0114129_10685583 3300009147 Bacteria 1318
44 Ga0105243_10022509 3300009148 Bacteria 4790
45 Ga0105243_10052767 3300009148 Bacteria 3222
46 Ga0105243_10154530 3300009148 Bacteria 1971
47 Ga0105243_10302621 3300009148 Bacteria 1450
48 Ga0105242_10117013 3300009176 Bacteria 2281
49 Ga0163162_10459172 3300013306 Bacteria 1405
50 Ga0207656_10102145 3300025321 Bacteria 1316
51 Ga0207656_10154999 3300025321 Bacteria 1087
52 Ga0207688_10060544 3300025901 Bacteria 2133
53 Ga0207707_10285603 3300025912 Bacteria 1428
54 Ga0207660_10226325 3300025917 Bacteria 1469
55 Ga0207687_10150788 3300025927 Bacteria 1774
56 Ga0207691_10043318 3300025940 Bacteria 4149
57 Ga0207640_10064834 3300025981 Bacteria 2435
58 Ga0207703_10211077 3300026035 Bacteria 1731
59 Ga0207708_10015487 3300026075 Bacteria 5718
60 Ga0207708_10107135 3300026075 Bacteria 2167
61 Ga0207648_10401843 3300026089 Bacteria 1241
62 Ga0207675_100098847 3300026118 Bacteria 2749
63 Ga0207675_100105748 3300026118 Bacteria 2653
64 Ga0207698_10150574 3300026142 Bacteria 2019
65 Ga0207698_10310393 3300026142 Bacteria 1472
66 Ga0268264_10237147 3300028381 Bacteria 1688
67 Ga0307413_10364523 3300031824 Bacteria 1120
68 Ga0307413_10618643 3300031824 Bacteria 889
69 Ga0307410_10134663 3300031852 Bacteria 1820
70 Ga0307406_10205631 3300031901 Bacteria 1453
71 Ga0307406_10432185 3300031901 Bacteria 1052
72 Ga0307407_10382853 3300031903 Bacteria 1005
73 Ga0307409_100126435 3300031995 Bacteria 2175
74 Ga0307409_100207576 3300031995 Bacteria 1758
75 Ga0307409_100243553 3300031995 Bacteria 1639
76 Ga0307416_100049553 3300032002 Bacteria 3340
77 Ga0307416_100289901 3300032002 Bacteria 1620
78 Ga0307415_100000847 3300032126 Bacteria 13979
79 Ga0395899_0070461 3300037312 Bacteria 2559
80 Ga0395900_0031586 3300037418 Bacteria 5443
81 Ga0395900_0040018 3300037418 Bacteria 4830
82 Ga0395900_0128140 3300037418 Bacteria 2602
83 Ga0395900_0237068 3300037418 Bacteria 1832
84 Ga0395900_0278971 3300037418 Bacteria 1664
85 Ga0395898_0095844 3300037466 Bacteria 2850
86 Ga0395898_0165745 3300037466 Bacteria 2113
87 Ga0395905_0079938 3300037471 Bacteria 3064
88 Ga0395905_0185387 3300037471 Bacteria 1953
89 Ga0395901_0021076 3300038443 Bacteria 6676
90 Ga0395901_0041031 3300038443 Bacteria 4795
91 Ga0395901_0091868 3300038443 Bacteria 3177
92 Ga0439448_0065667 3300042005 Bacteria 1204
93 Ga0439455_0063002 3300042012 Bacteria 986
94 Ga0466972_0149286 3300044658 Bacteria 1099
95 Ga0466966_0141607 3300044684 Bacteria 1469
96 Ga0466961_0121327 3300044693 Bacteria 1641
97 Ga0466963_0233455 3300044694 Bacteria 1289
98 Ga0466970_0125804 3300044765 Bacteria 1406
99 Ga0466960_0061788 3300044901 Bacteria 1840
100 Ga0466960_0156261 3300044901 Bacteria 1222
101 Ga0466959_0001940 3300045049 Bacteria 13029
102 Ga0466967_0208112 3300045976 Bacteria 1855
103 Ga0466967_0406164 3300045976 Bacteria 1326
104 Ga0466967_0428355 3300045976 Bacteria 1290
105 Ga0495594_0019003 3300046499 Unclassified 3648
106 Ga0495666_0061617 3300046526 Unclassified 1792
107 Ga0495665_0018083 3300046531 Unclassified 3789
108 Ga0495587_0016159 3300046536 Unclassified 4646
109 Ga0495658_0006346 3300046683 Bacteria 5806
110 Ga0495670_0197918 3300046691 Bacteria 1064
111 Ga0495676_0033193 3300047321 Bacteria 4350
112 Ga0495675_0070244 3300047444 Unclassified 2211
113 Ga0495614_0146797 3300048089 Unclassified 1050
114 Ga0496111_0251501 3300048914 Bacteria 1312
115 Ga0496113_0051941 3300048916 Bacteria 3060
116 Ga0496114_0056829 3300048917 Bacteria 3266
117 Ga0496114_0680732 3300048917 Unclassified 903
118 Ga0501031_0000074 3300049568 Bacteria 52791
119 Ga0501031_0127301 3300049568 Bacteria 1664
120 Ga0501031_0280846 3300049568 Bacteria 1080
121 Ga0501032_0002979 3300049569 Bacteria 13150
122 Ga0501034_0000877 3300049571 Bacteria 44229
123 Ga0501034_0172568 3300049571 Bacteria 2129
124 Ga0501034_0585990 3300049571 Bacteria 1022
125 Ga0501036_0000846 3300049572 Bacteria 22801
126 Ga0501036_0068749 3300049572 Bacteria 2997
127 Ga0501036_0674001 3300049572 Bacteria 855
128 Ga0501037_0000235 3300049573 Bacteria 47804
129 Ga0501038_0000196 3300049574 Bacteria 52394
130 Ga0501038_0073250 3300049574 Bacteria 2901
131 Ga0501039_0000124 3300049575 Bacteria 53373
132 Ga0501039_0029605 3300049575 Bacteria 4217
133 Ga0501040_0016864 3300049576 Bacteria 4842
134 Ga0501040_0151848 3300049576 Bacteria 1634
135 Ga0501042_0128903 3300049578 Bacteria 1823
136 Ga0501042_0333536 3300049578 Bacteria 1096
137 Ga0501043_0011716 3300049579 Bacteria 6865
138 Ga0501046_0000844 3300049580 Bacteria 29854
139 Ga0501046_0364622 3300049580 Bacteria 1047
140 Ga0501047_0000378 3300049581 Bacteria 50236
141 Ga0501048_0000096 3300049582 Bacteria 47896
142 Ga0501048_0035664 3300049582 Bacteria 3580
143 Ga0501048_0182594 3300049582 Bacteria 1487
144 Ga0501067_0008008 3300049583 Bacteria 5869
145 Ga0501067_0071258 3300049583 Bacteria 1925
146 Ga0501068_0058849 3300049584 Bacteria 2332
147 Ga0501068_0107171 3300049584 Bacteria 1735
148 Ga0501069_0000680 3300049585 Bacteria 15814
149 Ga0501070_0000216 3300049586 Bacteria 54638
150 Ga0501071_0202204 3300049587 Bacteria 1492
151 Ga0501072_0021698 3300049588 Bacteria 4981
152 Ga0501073_0005497 3300049589 Bacteria 9494
153 Ga0501074_0002234 3300049590 Bacteria 13434
154 Ga0501075_0070866 3300049591 Bacteria 2634
155 Ga0501076_0006849 3300049592 Bacteria 8274
156 Ga0501076_0021507 3300049592 Bacteria 4949
157 Ga0501076_0072625 3300049592 Bacteria 2754
158 Ga0501076_0222322 3300049592 Bacteria 1543
159 Ga0501077_0051654 3300049593 Bacteria 2612
160 Ga0501079_0047785 3300049741 Bacteria 3302
161 Ga0501079_0088337 3300049741 Bacteria 2400
162 Ga0501080_0000177 3300049742 Bacteria 46889
163 Ga0501080_0242034 3300049742 Bacteria 1647
164 Ga0501080_0526649 3300049742 Bacteria 1054
165 Ga0501081_0496519 3300049743 Bacteria 909
166 Ga0501081_0511778 3300049743 Bacteria 895
167 Ga0501083_0005982 3300049744 Bacteria 8615
168 Ga0501083_0334921 3300049744 Bacteria 984
169 Ga0501035_0000648 3300049822 Bacteria 38367
170 Ga0501035_0553799 3300049822 Bacteria 942
171 Ga0501044_0000585 3300049823 Bacteria 44237
172 Ga0501044_0213927 3300049823 Bacteria 1881
173 Ga0501045_0074094 3300049824 Bacteria 2507
174 nmdc:mga08y16_179229_c1 3300050511 Bacteria 2200
175 nmdc:mga08y16_5073_c1 3300050511 Bacteria 8818
176 nmdc:mga08y16_725630_c1 3300050511 Bacteria 991
177 Ga0495601_0241480 3300053077 Unclassified 1179
178 Ga0501084_0001653 3300054114 Bacteria 17738
179 Ga0501084_0063956 3300054114 Bacteria 3080
180 Ga0501084_0169091 3300054114 Bacteria 1845
181 Ga0590077_004658 3300059426 Bacteria 2807
182 Ga0501082_0024960 3300060353 Bacteria 5150
183 Ga0501082_0262147 3300060353 Bacteria 1503
184 Ga0501082_0608377 3300060353 Bacteria 956
185 Ga0530510_0014507 3300061734 Bacteria 5558

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0406164 Ga0466967_0406164_20_655 210
2 3300049571 Ga0501034_0585990 Ga0501034_0585990_31_846 223
3 3300009094 Ga0111539_11156649 Ga0111539_111566491 230
4 3300037418 Ga0395900_0237068 Ga0395900_0237068_1008_1805 231
5 3300005834 Ga0068851_10112932 Ga0068851_101129322 232
6 3300025321 Ga0207656_10154999 Ga0207656_101549992 232
7 3300025901 Ga0207688_10060544 Ga0207688_100605442 232
8 3300026089 Ga0207648_10401843 Ga0207648_104018432 232
9 3300005366 Ga0070659_100019448 Ga0070659_1000194485 233
10 3300046499 Ga0495594_0019003 Ga0495594_0019003_1336_2142 233
11 3300046526 Ga0495666_0061617 Ga0495666_0061617_630_1436 233
12 3300046531 Ga0495665_0018083 Ga0495665_0018083_289_1095 233
13 3300046536 Ga0495587_0016159 Ga0495587_0016159_1453_2259 233
14 3300046683 Ga0495658_0006346 Ga0495658_0006346_332_1138 233
15 3300047321 Ga0495676_0033193 Ga0495676_0033193_2346_3152 233
16 3300048089 Ga0495614_0146797 Ga0495614_0146797_61_867 233
17 3300053077 Ga0495601_0241480 Ga0495601_0241480_225_1031 233
18 3300009148 Ga0105243_10154530 Ga0105243_101545302 234
19 3300037418 Ga0395900_0128140 Ga0395900_0128140_1276_2085 235
20 3300047444 Ga0495675_0070244 Ga0495675_0070244_351_1157 235
21 3300048917 Ga0496114_0680732 Ga0496114_0680732_65_871 235
22 3300005327 Ga0070658_10188584 Ga0070658_101885842 237
23 3300005338 Ga0068868_100073795 Ga0068868_1000737952 237
24 3300044693 Ga0466961_0121327 Ga0466961_0121327_30_749 238
25 3300005441 Ga0070700_100138219 Ga0070700_1001382192 239
26 3300025940 Ga0207691_10043318 Ga0207691_100433182 239
27 3300026075 Ga0207708_10107135 Ga0207708_101071353 239
28 3300042005 Ga0439448_0065667 Ga0439448_0065667_99_845 239
29 3300009036 Ga0105244_10204211 Ga0105244_102042111 241
30 3300031995 Ga0307409_100243553 Ga0307409_1002435531 241
31 3300049568 Ga0501031_0000074 Ga0501031_0000074_31587_32342 241
32 3300049569 Ga0501032_0002979 Ga0501032_0002979_7601_8356 241
33 3300049571 Ga0501034_0000877 Ga0501034_0000877_26889_27644 241
34 3300049572 Ga0501036_0000846 Ga0501036_0000846_21267_22022 241
35 3300049573 Ga0501037_0000235 Ga0501037_0000235_32956_33711 241
36 3300049574 Ga0501038_0000196 Ga0501038_0000196_33342_34097 241
37 3300049575 Ga0501039_0000124 Ga0501039_0000124_20658_21413 241
38 3300049576 Ga0501040_0151848 Ga0501040_0151848_122_877 241
39 3300049578 Ga0501042_0128903 Ga0501042_0128903_544_1299 241
40 3300049579 Ga0501043_0011716 Ga0501043_0011716_2993_3748 241
41 3300049580 Ga0501046_0000844 Ga0501046_0000844_18709_19464 241
42 3300049581 Ga0501047_0000378 Ga0501047_0000378_32768_33523 241
43 3300049582 Ga0501048_0000096 Ga0501048_0000096_14474_15229 241
44 3300049583 Ga0501067_0008008 Ga0501067_0008008_88_843 241
45 3300049584 Ga0501068_0058849 Ga0501068_0058849_48_803 241
46 3300049585 Ga0501069_0000680 Ga0501069_0000680_13354_14109 241
47 3300049586 Ga0501070_0000216 Ga0501070_0000216_21240_21995 241
48 3300049589 Ga0501073_0005497 Ga0501073_0005497_3807_4562 241
49 3300049590 Ga0501074_0002234 Ga0501074_0002234_175_930 241
50 3300049742 Ga0501080_0000177 Ga0501080_0000177_32151_32906 241
51 3300049743 Ga0501081_0496519 Ga0501081_0496519_20_778 241
52 3300049744 Ga0501083_0005982 Ga0501083_0005982_875_1630 241
53 3300049822 Ga0501035_0000648 Ga0501035_0000648_6412_7167 241
54 3300049823 Ga0501044_0000585 Ga0501044_0000585_30384_31139 241
55 3300049823 Ga0501044_0213927 Ga0501044_0213927_401_1156 241
56 3300054114 Ga0501084_0001653 Ga0501084_0001653_9555_10310 241
57 3300059426 Ga0590077_004658 Ga0590077_004658_1382_2140 241
58 3300060353 Ga0501082_0608377 Ga0501082_0608377_58_813 241
59 3300005459 Ga0068867_100130334 Ga0068867_1001303342 242
60 3300005535 Ga0070684_100400169 Ga0070684_1004001691 242
61 3300005578 Ga0068854_100086246 Ga0068854_1000862462 242
62 3300009148 Ga0105243_10052767 Ga0105243_100527672 242
63 3300026118 Ga0207675_100105748 Ga0207675_1001057483 242
64 3300048914 Ga0496111_0251501 Ga0496111_0251501_467_1282 242
65 3300005981 Ga0081538_10008641 Ga0081538_100086415 243
66 3300050511 nmdc:mga08y16_725630_c1 nmdc:mga08y16_725630_c1_73_900 244
67 3300044658 Ga0466972_0149286 Ga0466972_0149286_315_1082 245
68 3300044901 Ga0466960_0061788 Ga0466960_0061788_1062_1829 245
69 3300037312 Ga0395899_0070461 Ga0395899_0070461_643_1485 246
70 3300037418 Ga0395900_0040018 Ga0395900_0040018_3085_3927 246
71 3300037466 Ga0395898_0095844 Ga0395898_0095844_1215_2057 246
72 3300037471 Ga0395905_0079938 Ga0395905_0079938_474_1316 246
73 3300038443 Ga0395901_0021076 Ga0395901_0021076_3082_3924 246
74 3300044901 Ga0466960_0156261 Ga0466960_0156261_16_876 246
75 3300048917 Ga0496114_0056829 Ga0496114_0056829_2401_3195 246
76 3300049571 Ga0501034_0172568 Ga0501034_0172568_996_1769 246
77 iso_pu_bacteria 2919446982 2919448524 246
78 3300038443 Ga0395901_0041031 Ga0395901_0041031_3188_4003 247
79 3300049568 Ga0501031_0127301 Ga0501031_0127301_160_933 247
80 3300049572 Ga0501036_0674001 Ga0501036_0674001_40_813 247
81 3300049575 Ga0501039_0029605 Ga0501039_0029605_2339_3112 247
82 3300049582 Ga0501048_0182594 Ga0501048_0182594_599_1372 247
83 3300049592 Ga0501076_0072625 Ga0501076_0072625_378_1151 247
84 3300049742 Ga0501080_0242034 Ga0501080_0242034_634_1407 247
85 3300060353 Ga0501082_0024960 Ga0501082_0024960_4174_4947 247
86 3300009147 Ga0114129_10685583 Ga0114129_106855831 249
87 3300031995 Ga0307409_100207576 Ga0307409_1002075762 249
88 3300005578 Ga0068854_100362587 Ga0068854_1003625871 251
89 3300031824 Ga0307413_10364523 Ga0307413_103645232 251
90 3300031824 Ga0307413_10618643 Ga0307413_106186431 251
91 3300031901 Ga0307406_10205631 Ga0307406_102056312 251
92 3300031903 Ga0307407_10382853 Ga0307407_103828531 251
93 3300032002 Ga0307416_100049553 Ga0307416_1000495533 251
94 3300032126 Ga0307415_100000847 Ga0307415_10000084714 251
95 3300044694 Ga0466963_0233455 Ga0466963_0233455_455_1264 251
96 3300045976 Ga0466967_0428355 Ga0466967_0428355_137_946 251
97 3300048916 Ga0496113_0051941 Ga0496113_0051941_1236_2042 251
98 3300049822 Ga0501035_0553799 Ga0501035_0553799_128_928 251
99 3300005336 Ga0070680_100009013 Ga0070680_1000090133 252
100 3300005337 Ga0070682_100087393 Ga0070682_1000873933 252
101 3300005458 Ga0070681_10060956 Ga0070681_100609563 252
102 3300005530 Ga0070679_100070955 Ga0070679_1000709553 252
103 3300025912 Ga0207707_10285603 Ga0207707_102856031 252
104 3300025917 Ga0207660_10226325 Ga0207660_102263252 252
105 3300049568 Ga0501031_0280846 Ga0501031_0280846_148_933 252
106 3300049578 Ga0501042_0333536 Ga0501042_0333536_147_932 252
107 3300049584 Ga0501068_0107171 Ga0501068_0107171_795_1580 252
108 3300049587 Ga0501071_0202204 Ga0501071_0202204_651_1436 252
109 3300049588 Ga0501072_0021698 Ga0501072_0021698_1832_2617 252
110 3300049591 Ga0501075_0070866 Ga0501075_0070866_1643_2428 252
111 3300049592 Ga0501076_0021507 Ga0501076_0021507_4118_4903 252
112 3300049593 Ga0501077_0051654 Ga0501077_0051654_1706_2491 252
113 3300049741 Ga0501079_0047785 Ga0501079_0047785_88_873 252
114 3300049744 Ga0501083_0334921 Ga0501083_0334921_175_960 252
115 3300049824 Ga0501045_0074094 Ga0501045_0074094_1311_2096 252
116 3300054114 Ga0501084_0063956 Ga0501084_0063956_2217_3002 252
117 3300060353 Ga0501082_0262147 Ga0501082_0262147_652_1437 252
118 3300061734 Ga0530510_0014507 Ga0530510_0014507_3966_4751 252
119 3300005617 Ga0068859_100232266 Ga0068859_1002322662 253
120 3300005834 Ga0068851_10116622 Ga0068851_101166222 253
121 3300006931 Ga0097620_100232270 Ga0097620_1002322702 253
122 3300025321 Ga0207656_10102145 Ga0207656_101021452 253
123 3300026035 Ga0207703_10211077 Ga0207703_102110772 253
124 3300026142 Ga0207698_10150574 Ga0207698_101505742 253
125 3300005981 Ga0081538_10010240 Ga0081538_100102404 254
126 3300005985 Ga0081539_10002081 Ga0081539_1000208126 254
127 3300049583 Ga0501067_0071258 Ga0501067_0071258_64_879 254
128 3300031852 Ga0307410_10134663 Ga0307410_101346633 255
129 3300049572 Ga0501036_0068749 Ga0501036_0068749_1999_2799 255
130 3300049574 Ga0501038_0073250 Ga0501038_0073250_2087_2887 255
131 3300049576 Ga0501040_0016864 Ga0501040_0016864_676_1476 255
132 3300049580 Ga0501046_0364622 Ga0501046_0364622_81_881 255
133 3300049582 Ga0501048_0035664 Ga0501048_0035664_2039_2839 255
134 3300049592 Ga0501076_0006849 Ga0501076_0006849_7382_8182 255
135 3300049741 Ga0501079_0088337 Ga0501079_0088337_215_1015 255
136 3300049742 Ga0501080_0526649 Ga0501080_0526649_45_845 255
137 3300054114 Ga0501084_0169091 Ga0501084_0169091_137_937 255
138 3300005937 Ga0081455_10071540 Ga0081455_100715403 256
139 3300026118 Ga0207675_100098847 Ga0207675_1000988473 256
140 3300045976 Ga0466967_0208112 Ga0466967_0208112_86_907 256
141 3300046691 Ga0495670_0197918 Ga0495670_0197918_124_924 256
142 3300049592 Ga0501076_0222322 Ga0501076_0222322_497_1297 256
143 3300049743 Ga0501081_0511778 Ga0501081_0511778_41_841 256
144 3300050511 nmdc:mga08y16_5073_c1 nmdc:mga08y16_5073_c1_4648_5445 256
145 3300031901 Ga0307406_10432185 Ga0307406_104321852 257
146 3300042012 Ga0439455_0063002 Ga0439455_0063002_165_965 257
147 3300005366 Ga0070659_100360802 Ga0070659_1003608021 258
148 3300005543 Ga0070672_100216337 Ga0070672_1002163372 258
149 3300005981 Ga0081538_10029805 Ga0081538_100298051 258
150 3300026142 Ga0207698_10310393 Ga0207698_103103932 258
151 3300044684 Ga0466966_0141607 Ga0466966_0141607_507_1337 258
152 3300044765 Ga0466970_0125804 Ga0466970_0125804_235_1065 258
153 3300045049 Ga0466959_0001940 Ga0466959_0001940_7577_8407 258
154 3300005338 Ga0068868_100103501 Ga0068868_1001035013 259
155 3300005343 Ga0070687_100015265 Ga0070687_1000152653 259
156 3300005441 Ga0070700_100145109 Ga0070700_1001451092 259
157 3300005615 Ga0070702_100061577 Ga0070702_1000615772 259
158 3300005617 Ga0068859_100093883 Ga0068859_1000938832 259
159 3300005618 Ga0068864_100163987 Ga0068864_1001639872 259
160 3300005719 Ga0068861_100129219 Ga0068861_1001292191 259
161 3300005840 Ga0068870_10157749 Ga0068870_101577492 259
162 3300005981 Ga0081538_10001514 Ga0081538_1000151422 259
163 3300006881 Ga0068865_100069001 Ga0068865_1000690012 259
164 3300006931 Ga0097620_100093887 Ga0097620_1000938874 259
165 3300009094 Ga0111539_10076116 Ga0111539_100761164 259
166 3300009148 Ga0105243_10022509 Ga0105243_100225095 259
167 3300009148 Ga0105243_10302621 Ga0105243_103026212 259
168 3300013306 Ga0163162_10459172 Ga0163162_104591722 259
169 3300025927 Ga0207687_10150788 Ga0207687_101507882 259
170 3300025981 Ga0207640_10064834 Ga0207640_100648342 259
171 3300026075 Ga0207708_10015487 Ga0207708_100154873 259
172 3300028381 Ga0268264_10237147 Ga0268264_102371472 259
173 3300031995 Ga0307409_100126435 Ga0307409_1001264353 259
174 3300037418 Ga0395900_0278971 Ga0395900_0278971_651_1460 259
175 3300050511 nmdc:mga08y16_179229_c1 nmdc:mga08y16_179229_c1_55_864 259
176 3300006358 Ga0068871_100486143 Ga0068871_1004861432 260
177 3300009176 Ga0105242_10117013 Ga0105242_101170133 260
178 3300032002 Ga0307416_100289901 Ga0307416_1002899012 260
179 3300037418 Ga0395900_0031586 Ga0395900_0031586_478_1299 260
180 3300037466 Ga0395898_0165745 Ga0395898_0165745_784_1623 260
181 3300037471 Ga0395905_0185387 Ga0395905_0185387_244_1083 260
182 3300038443 Ga0395901_0091868 Ga0395901_0091868_1761_2582 260
183 3300003373 JGI25407J50210_10033750 JGI25407J50210_100337502 261
184 3300005981 Ga0081538_10001110 Ga0081538_1000111017 261
185 3300005981 Ga0081538_10022786 Ga0081538_100227865 261
186 3300005981 Ga0081538_10023853 Ga0081538_100238534 261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

26

222

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

32

272

0.92

PF08659

KR

KR domain

26

204

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5itv-assembly3.cif.gz_D crystal structure of bacillus subtilis bacc dihydroanticapsin 7-dehydrogenase in complex with nadh 0.9196 10 238
4bmn-assembly1.cif.gz_B apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9192 8 238
4bmn-assembly1.cif.gz_A apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9148 7 238
5cdy-assembly1.cif.gz_B the crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from yersinia pestis at 2.85a resolution 0.9146 8 240
4bmn-assembly1.cif.gz_C apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9145 8 238
ID Description Score Start End Superfamily
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9216 8 180 3.40.50.720
5itvD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9196 10 238 3.40.50.720
4bmnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9148 7 238 3.40.50.720
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9132 8 239 3.40.50.720
4y98A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9102 8 180 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1H7EJX0-F1-model_v4 Short chain dehydrogenase 0.9654 8 155
AF-A0A447J550-F1-model_v4 deleted 0.9478 8 180
AF-A0A4R5LC60-F1-model_v4 SDR family oxidoreductase 0.9442 8 185
AF-A0A0P7TI44-F1-model_v4 Uncharacterized protein 0.9433 8 178 GO:0006633
GO:0008171
GO:0016616
GO:0032259
AF-A0A0B8PSZ8-F1-model_v4 deleted 0.9384 8 157

Feature Viewer

pLDDT pTM Quality
85.15 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map