F285915

General Info

Members Datasets Scaffolds Average Seq Length
186 134 372 211

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10953514|Ga0114129_109535141
Length 221
Sequence MGGAAYAALMPEPIPLKTADGVTLEAELAIPDAPPRCGLVLCHPHPQYGGTMRSIVISALFDALPPRGVGCLRFNFRGVEGSEGEHDFGNLERVDAETAVGALRERLSPGTPLILMGWSFGADMALSVRDARVDAWMAIAPPVVVVHDVDGLAADPRPKLLALAQHDEFRDPAEVTELAERWANTDVHVVGGASHFFVGRTDRLVELASGYVDRLAPAPRA

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
14 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
35 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
57 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
58 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
73 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
74 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
81 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
88 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
89 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
92 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
93 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
100 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
101 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
102 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
103 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
104 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
111 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
112 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
115 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
116 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
117 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
123 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
124 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
125 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
126 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
127 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
128 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
129 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
130 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 12.9
Rhizosphere 81.18
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10953514 3300009147 Bacteria 1083
2 Ga0070709_10023218 3300005434 Bacteria 3639
3 Ga0070714_100119776 3300005435 Bacteria 2340
4 Ga0070713_100098958 3300005436 Bacteria 2523
5 Ga0070713_100226174 3300005436 Bacteria 1699
6 Ga0070710_10049998 3300005437 Bacteria 2341
7 Ga0070700_100441216 3300005441 Bacteria 988
8 Ga0070708_100027679 3300005445 Bacteria 4867
9 Ga0070708_100422027 3300005445 Bacteria 1258
10 Ga0070681_10241047 3300005458 Bacteria 1722
11 Ga0070706_100019302 3300005467 Bacteria 6287
12 Ga0070707_100294543 3300005468 Bacteria 1577
13 Ga0070707_100399941 3300005468 Bacteria 1334
14 Ga0070698_100006926 3300005471 Bacteria 12281
15 Ga0070698_100271922 3300005471 Bacteria 1626
16 Ga0070697_100245519 3300005536 Bacteria 1530
17 Ga0070695_100160581 3300005545 Bacteria 1577
18 Ga0070704_100200384 3300005549 Bacteria 1611
19 Ga0070704_100554843 3300005549 Unclassified 1004
20 Ga0068856_100368256 3300005614 Bacteria 1456
21 Ga0068852_101039792 3300005616 Bacteria 838
22 Ga0068864_100644728 3300005618 Unclassified 1031
23 Ga0081539_10029138 3300005985 Bacteria 3457
24 Ga0075365_10015342 3300006038 Bacteria 4633
25 Ga0075363_100006627 3300006048 Bacteria 5276
26 Ga0070715_10163081 3300006163 Bacteria 1103
27 Ga0075428_100118812 3300006844 Bacteria 2879
28 Ga0075428_100140529 3300006844 Bacteria 2626
29 Ga0075428_100654201 3300006844 Bacteria 1121
30 Ga0075430_100060824 3300006846 Bacteria 3174
31 Ga0075430_100411395 3300006846 Bacteria 1116
32 Ga0075431_100096954 3300006847 Bacteria 3044
33 Ga0075433_10009666 3300006852 Bacteria 7719
34 Ga0075433_10344134 3300006852 Bacteria 1318
35 Ga0075433_10808376 3300006852 Bacteria 819
36 Ga0075434_100056336 3300006871 Bacteria 3906
37 Ga0075434_100402502 3300006871 Unclassified 1390
38 Ga0075434_100409572 3300006871 Bacteria 1377
39 Ga0075429_100022390 3300006880 Bacteria 5480
40 Ga0075436_100011482 3300006914 Bacteria 6080
41 Ga0075435_100053539 3300007076 Bacteria 3254
42 Ga0075435_100543664 3300007076 Bacteria 1006
43 Ga0111539_10227390 3300009094 Bacteria 2173
44 Ga0111539_10246684 3300009094 Bacteria 2079
45 Ga0111539_10950937 3300009094 Bacteria 999
46 Ga0105245_10126616 3300009098 Bacteria 2392
47 Ga0114129_10215395 3300009147 Bacteria 2594
48 Ga0114129_10294613 3300009147 Bacteria 2164
49 Ga0114129_11329976 3300009147 Bacteria 889
50 Ga0114129_11353541 3300009147 Bacteria 880
51 Ga0105243_10287857 3300009148 Bacteria 1483
52 Ga0105242_10028840 3300009176 Bacteria 4421
53 Ga0105248_10372949 3300009177 Bacteria 1607
54 Ga0157378_10231294 3300013297 Bacteria 1762
55 Ga0163162_10247708 3300013306 Bacteria 1913
56 Ga0157375_10529186 3300013308 Bacteria 1341
57 Ga0163163_10340678 3300014325 Bacteria 1554
58 Ga0157380_10483053 3300014326 Bacteria 1199
59 Ga0213876_10106534 3300021384 Bacteria 1487
60 Ga0213876_10140342 3300021384 Bacteria 1285
61 Ga0207685_10112279 3300025905 Bacteria 1183
62 Ga0207699_10026188 3300025906 Bacteria 3211
63 Ga0207684_10048168 3300025910 Bacteria 3614
64 Ga0207646_10110124 3300025922 Bacteria 2471
65 Ga0207646_10458055 3300025922 Bacteria 1150
66 Ga0207700_10102035 3300025928 Bacteria 2290
67 Ga0207700_10217266 3300025928 Bacteria 1619
68 Ga0207709_10314563 3300025935 Bacteria 1169
69 Ga0207661_10474448 3300025944 Bacteria 1142
70 Ga0207639_10147860 3300026041 Bacteria 1965
71 Ga0207708_10265889 3300026075 Bacteria 1385
72 Ga0207702_10159003 3300026078 Bacteria 2062
73 Ga0207648_10431745 3300026089 Bacteria 1197
74 Ga0207683_10171594 3300026121 Bacteria 1964
75 Ga0207428_10207665 3300027907 Bacteria 1472
76 Ga0268266_10539450 3300028379 Bacteria 1117
77 Ga0265338_10000403 3300028800 Bacteria 77459
78 Ga0265320_10165514 3300031240 Unclassified 995
79 Ga0265325_10001145 3300031241 Bacteria 19045
80 Ga0265339_10000489 3300031249 Bacteria 30979
81 Ga0265331_10309878 3300031250 Bacteria 707
82 Ga0265327_10011319 3300031251 Bacteria 6162
83 Ga0265327_10035705 3300031251 Bacteria 2744
84 Ga0265316_10428454 3300031344 Bacteria 950
85 Ga0265313_10006376 3300031595 Bacteria 8384
86 Ga0265314_10137110 3300031711 Bacteria 1518
87 Ga0307410_10231435 3300031852 Bacteria 1427
88 Ga0373931_0050829 3300035691 Bacteria 2206
89 Ga0373947_0014148 3300035725 Bacteria 4575
90 Ga0373937_0430267 3300036401 Bacteria 1253
91 Ga0373925_0280825 3300037068 Bacteria 1341
92 Ga0436365_0658467 3300039437 Bacteria 3969
93 Ga0436365_1067382 3300039437 Bacteria 1671
94 Ga0436365_1213908 3300039437 Bacteria 830
95 Ga0436361_1115428 3300039447 Bacteria 8540
96 Ga0436362_1123401 3300039453 Bacteria 2502
97 Ga0451807_1852593 3300041486 Bacteria 693
98 Ga0451835_0840010 3300041492 Bacteria 1305
99 Ga0451849_1488584 3300041505 Bacteria 634
100 Ga0466968_0118956 3300044735 Bacteria 1194
101 Ga0466967_0506111 3300045976 Bacteria 1186
102 Ga0495629_0119904 3300046459 Bacteria 1833
103 Ga0495651_0501266 3300046462 Bacteria 777
104 Ga0495653_0269812 3300046463 Bacteria 1121
105 Ga0495580_0273299 3300046472 Bacteria 1154
106 Ga0495582_0140543 3300046473 Bacteria 1368
107 Ga0495628_0212107 3300046516 Bacteria 1456
108 Ga0495628_0258739 3300046516 Bacteria 1298
109 Ga0495628_0291379 3300046516 Bacteria 1210
110 Ga0495630_0181777 3300046517 Bacteria 1604
111 Ga0495630_0283760 3300046517 Bacteria 1265
112 Ga0495645_0576477 3300046543 Unclassified 695
113 Ga0495667_0214758 3300046559 Bacteria 1229
114 Ga0495657_0250987 3300046675 Bacteria 1065
115 Ga0495658_0422698 3300046683 Bacteria 850
116 Ga0495581_0074047 3300047315 Bacteria 1971
117 Ga0495680_0355415 3300047322 Bacteria 1019
118 Ga0495602_0223979 3300048088 Bacteria 1418
119 Ga0496100_0060622 3300048903 Bacteria 2490
120 Ga0496100_0296644 3300048903 Bacteria 1209
121 Ga0496101_0013369 3300048904 Bacteria 5496
122 Ga0496102_0018207 3300048905 Bacteria 6166
123 Ga0496102_0165942 3300048905 Bacteria 2078
124 Ga0496102_0701866 3300048905 Unclassified 935
125 Ga0496104_0024728 3300048907 Bacteria 5529
126 Ga0496104_0116325 3300048907 Bacteria 2566
127 Ga0496104_0365259 3300048907 Bacteria 1356
128 Ga0496105_0018900 3300048908 Bacteria 5550
129 Ga0496107_0164949 3300048910 Bacteria 1642
130 Ga0496108_0676663 3300048911 Bacteria 896
131 Ga0496109_0250553 3300048912 Bacteria 1668
132 Ga0496109_0330672 3300048912 Bacteria 1439
133 Ga0496109_0519156 3300048912 Bacteria 1124
134 Ga0496110_0245962 3300048913 Bacteria 1628
135 Ga0496111_0088965 3300048914 Bacteria 2262
136 Ga0496111_0288982 3300048914 Bacteria 1216
137 Ga0496112_0024148 3300048915 Bacteria 5818
138 Ga0496112_0193519 3300048915 Bacteria 1995
139 Ga0496112_0319151 3300048915 Bacteria 1498
140 Ga0496114_0028236 3300048917 Bacteria 4603
141 Ga0496115_0226371 3300048918 Bacteria 1542
142 Ga0501032_0162288 3300049569 Bacteria 1467
143 Ga0501034_0143273 3300049571 Bacteria 2368
144 Ga0501036_0464024 3300049572 Bacteria 1054
145 Ga0501046_0324814 3300049580 Bacteria 1121
146 Ga0501047_0012705 3300049581 Bacteria 7977
147 Ga0501048_0325661 3300049582 Bacteria 1095
148 Ga0501068_0138197 3300049584 Bacteria 1527
149 Ga0501070_0302214 3300049586 Bacteria 1303
150 Ga0501071_0639073 3300049587 Bacteria 819
151 Ga0501073_0492414 3300049589 Bacteria 848
152 Ga0501076_0704910 3300049592 Bacteria 833
153 Ga0501076_0750625 3300049592 Bacteria 805
154 Ga0501080_0009322 3300049742 Bacteria 8949
155 Ga0501081_0161857 3300049743 Bacteria 1613
156 Ga0501044_0180347 3300049823 Bacteria 2079
157 Ga0501045_0599242 3300049824 Bacteria 816
158 nmdc:mga03n38_1626_c1 3300050490 Bacteria 6569
159 nmdc:mga05p37_1275833_c1 3300050507 Bacteria 751
160 nmdc:mga05p37_154913_c1 3300050507 Bacteria 2801
161 nmdc:mga09592_25420_c1 3300050508 Bacteria 4901
162 nmdc:mga09592_72540_c1 3300050508 Bacteria 2923
163 nmdc:mga0qj67_18881_c1 3300050509 Bacteria 5260
164 nmdc:mga0qj67_478001_c1 3300050509 Bacteria 1003
165 nmdc:mga06r32_120269_c1 3300050510 Bacteria 2590
166 nmdc:mga06r32_147438_c1 3300050510 Bacteria 2331
167 nmdc:mga06r32_84063_c1 3300050510 Bacteria 3102
168 nmdc:mga08y16_167121_c1 3300050511 Bacteria 2285
169 nmdc:mga0n895_303227_c1 3300050512 Bacteria 1619
170 nmdc:mga0n895_375504_c1 3300050512 Bacteria 1439
171 nmdc:mga0n895_40230_c1 3300050512 Bacteria 4541
172 nmdc:mga0rr50_14886_c1 3300050513 Bacteria 5119
173 nmdc:mga0rr50_423826_c1 3300050513 Bacteria 1126
174 nmdc:mga0rr50_46291_c1 3300050513 Bacteria 3202
175 nmdc:mga08x19_135820_c1 3300050514 Bacteria 1658
176 nmdc:mga0a205_31387_c1 3300050515 Bacteria 5090
177 Ga0495601_0166811 3300053077 Bacteria 1439
178 Ga0495601_0245646 3300053077 Bacteria 1169
179 Ga0495612_0028449 3300053078 Bacteria 2251
180 Ga0495612_0101614 3300053078 Bacteria 1225
181 Ga0495619_0040372 3300053085 Bacteria 3051
182 Ga0495619_0170003 3300053085 Bacteria 1507
183 Ga0500616_0029162 3300053153 Bacteria 3038
184 Ga0501082_0137281 3300060353 Bacteria 2122
185 Ga0501082_0749174 3300060353 Bacteria 855
186 Ga0530510_0049603 3300061734 Bacteria 3032
187 Ga0114129_10953514
188 Ga0070709_10023218
189 Ga0070714_100119776
190 Ga0070713_100098958
191 Ga0070713_100226174
192 Ga0070710_10049998
193 Ga0070700_100441216
194 Ga0070708_100027679
195 Ga0070708_100422027
196 Ga0070681_10241047
197 Ga0070706_100019302
198 Ga0070707_100294543
199 Ga0070707_100399941
200 Ga0070698_100006926
201 Ga0070698_100271922
202 Ga0070697_100245519
203 Ga0070695_100160581
204 Ga0070704_100200384
205 Ga0070704_100554843
206 Ga0068856_100368256
207 Ga0068852_101039792
208 Ga0068864_100644728
209 Ga0081539_10029138
210 Ga0075365_10015342
211 Ga0075363_100006627
212 Ga0070715_10163081
213 Ga0075428_100118812
214 Ga0075428_100140529
215 Ga0075428_100654201
216 Ga0075430_100060824
217 Ga0075430_100411395
218 Ga0075431_100096954
219 Ga0075433_10009666
220 Ga0075433_10344134
221 Ga0075433_10808376
222 Ga0075434_100056336
223 Ga0075434_100402502
224 Ga0075434_100409572
225 Ga0075429_100022390
226 Ga0075436_100011482
227 Ga0075435_100053539
228 Ga0075435_100543664
229 Ga0111539_10227390
230 Ga0111539_10246684
231 Ga0111539_10950937
232 Ga0105245_10126616
233 Ga0114129_10215395
234 Ga0114129_10294613
235 Ga0114129_11329976
236 Ga0114129_11353541
237 Ga0105243_10287857
238 Ga0105242_10028840
239 Ga0105248_10372949
240 Ga0157378_10231294
241 Ga0163162_10247708
242 Ga0157375_10529186
243 Ga0163163_10340678
244 Ga0157380_10483053
245 Ga0213876_10106534
246 Ga0213876_10140342
247 Ga0207685_10112279
248 Ga0207699_10026188
249 Ga0207684_10048168
250 Ga0207646_10110124
251 Ga0207646_10458055
252 Ga0207700_10102035
253 Ga0207700_10217266
254 Ga0207709_10314563
255 Ga0207661_10474448
256 Ga0207639_10147860
257 Ga0207708_10265889
258 Ga0207702_10159003
259 Ga0207648_10431745
260 Ga0207683_10171594
261 Ga0207428_10207665
262 Ga0268266_10539450
263 Ga0265338_10000403
264 Ga0265320_10165514
265 Ga0265325_10001145
266 Ga0265339_10000489
267 Ga0265331_10309878
268 Ga0265327_10011319
269 Ga0265327_10035705
270 Ga0265316_10428454
271 Ga0265313_10006376
272 Ga0265314_10137110
273 Ga0307410_10231435
274 Ga0373931_0050829
275 Ga0373947_0014148
276 Ga0373937_0430267
277 Ga0373925_0280825
278 Ga0436365_0658467
279 Ga0436365_1067382
280 Ga0436365_1213908
281 Ga0436361_1115428
282 Ga0436362_1123401
283 Ga0451807_1852593
284 Ga0451835_0840010
285 Ga0451849_1488584
286 Ga0466968_0118956
287 Ga0466967_0506111
288 Ga0495629_0119904
289 Ga0495651_0501266
290 Ga0495653_0269812
291 Ga0495580_0273299
292 Ga0495582_0140543
293 Ga0495628_0212107
294 Ga0495628_0258739
295 Ga0495628_0291379
296 Ga0495630_0181777
297 Ga0495630_0283760
298 Ga0495645_0576477
299 Ga0495667_0214758
300 Ga0495657_0250987
301 Ga0495658_0422698
302 Ga0495581_0074047
303 Ga0495680_0355415
304 Ga0495602_0223979
305 Ga0496100_0060622
306 Ga0496100_0296644
307 Ga0496101_0013369
308 Ga0496102_0018207
309 Ga0496102_0165942
310 Ga0496102_0701866
311 Ga0496104_0024728
312 Ga0496104_0116325
313 Ga0496104_0365259
314 Ga0496105_0018900
315 Ga0496107_0164949
316 Ga0496108_0676663
317 Ga0496109_0250553
318 Ga0496109_0330672
319 Ga0496109_0519156
320 Ga0496110_0245962
321 Ga0496111_0088965
322 Ga0496111_0288982
323 Ga0496112_0024148
324 Ga0496112_0193519
325 Ga0496112_0319151
326 Ga0496114_0028236
327 Ga0496115_0226371
328 Ga0501032_0162288
329 Ga0501034_0143273
330 Ga0501036_0464024
331 Ga0501046_0324814
332 Ga0501047_0012705
333 Ga0501048_0325661
334 Ga0501068_0138197
335 Ga0501070_0302214
336 Ga0501071_0639073
337 Ga0501073_0492414
338 Ga0501076_0704910
339 Ga0501076_0750625
340 Ga0501080_0009322
341 Ga0501081_0161857
342 Ga0501044_0180347
343 Ga0501045_0599242
344 nmdc:mga03n38_1626_c1
345 nmdc:mga05p37_1275833_c1
346 nmdc:mga05p37_154913_c1
347 nmdc:mga09592_25420_c1
348 nmdc:mga09592_72540_c1
349 nmdc:mga0qj67_18881_c1
350 nmdc:mga0qj67_478001_c1
351 nmdc:mga06r32_120269_c1
352 nmdc:mga06r32_147438_c1
353 nmdc:mga06r32_84063_c1
354 nmdc:mga08y16_167121_c1
355 nmdc:mga0n895_303227_c1
356 nmdc:mga0n895_375504_c1
357 nmdc:mga0n895_40230_c1
358 nmdc:mga0rr50_14886_c1
359 nmdc:mga0rr50_423826_c1
360 nmdc:mga0rr50_46291_c1
361 nmdc:mga08x19_135820_c1
362 nmdc:mga0a205_31387_c1
363 Ga0495601_0166811
364 Ga0495601_0245646
365 Ga0495612_0028449
366 Ga0495612_0101614
367 Ga0495619_0040372
368 Ga0495619_0170003
369 Ga0500616_0029162
370 Ga0501082_0137281
371 Ga0501082_0749174
372 Ga0530510_0049603

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.8915 1 206
3pf9-assembly1.cif.gz_A crystal structure of the lactobacillus johnsonii cinnamoyl esterase lj0536 s106a mutant 0.8759 2 204
2fuk-assembly1.cif.gz_A-2 crystal structure of xc6422 from xanthomonas campestris: a member of a/b serine hydrolase without lid at 1.6 resolution 0.8755 1 206
7wwh-assembly2.cif.gz_B crystal structure of the geobacillus thermoglucosidasius feruloyl esterase gthfae 0.8733 4 204
7q4j-assembly1.cif.gz_B a thermostable lipase from thermoanaerobacter thermohydrosulfuricus in complex a monoacylglycerol intermediate 0.8732 2 208
ID Description Score Start End Superfamily
af_A0A0R0GYE0_51_217_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8952 2 119 3.40.50.1820
af_Q6ZGV2_2_204_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8949 4 192 3.40.50.1820
af_Q54TH2_43_268_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8946 14 208 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8915 1 206 3.40.50.1820
2fukA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8755 1 206 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1Q4D7U4-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9924 2 204
AF-A0A1Q4D7U4-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9781 2 204
AF-A0A6J6GFZ5-F1-model_v4 Unannotated protein 0.9722 46 207
AF-A0A381R3S7-F1-model_v4 Serine aminopeptidase S33 domain-containing protein 0.9705 1 208
AF-A0A7K1A379-F1-model_v4 Alpha/beta hydrolase 0.9701 2 206 GO:0016787

Map