F285821

General Info

Members Datasets Scaffolds Average Seq Length
186 144 372 154

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100515115|Ga0075430_1005151152
Length 179
Sequence LERPANRSVATNGSPELLVIVQGNELTMAYTLNVNGRTHTVDVDPDTPLLWAIRDSVGLTGTKFGCGVAQCGACTVLVDGAPRRSCVLPVSAVKGRVITIEGLSGRVAAAVKAAWIAADVPQCGYCQSGQIVSAVALLSEVRKLTDNDIDLAMNGNVCRCATYHRIRGAIHDAARRLRA

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
10 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
11 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
31 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
35 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
49 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
52 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
53 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
54 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
55 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
56 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
59 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
60 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
61 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
62 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
63 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
64 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
65 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
66 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
67 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
68 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
69 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
70 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
71 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
72 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
73 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
74 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
75 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
76 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
77 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
78 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
79 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
82 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
83 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
84 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
85 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
86 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
87 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
88 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
91 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
104 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
108 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
109 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
110 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
111 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
114 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
115 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
125 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
126 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
127 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
128 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
129 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
130 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
131 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
132 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
135 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
138 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
139 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
142 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
143 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
144 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.03
Nodule 0
Rhizoplane 3.76
Rhizosphere 59.14
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100515115 3300006846 Bacteria 987
2 JGI25153J46596_10045081 3300003215 Bacteria 1319
3 Ga0055526_1000417 3300003771 Bacteria 34324
4 Ga0070670_100306517 3300005331 Bacteria 1390
5 Ga0070661_100181648 3300005344 Bacteria 1601
6 Ga0070668_101316906 3300005347 Bacteria 657
7 Ga0070675_100332151 3300005354 Bacteria 1345
8 Ga0070713_100053688 3300005436 Bacteria 3340
9 Ga0070663_100865606 3300005455 Bacteria 779
10 Ga0070678_101361418 3300005456 Bacteria 662
11 Ga0070662_101075193 3300005457 Bacteria 690
12 Ga0070706_100037257 3300005467 Bacteria 4491
13 Ga0070706_100359851 3300005467 Bacteria 1356
14 Ga0070698_100135778 3300005471 Bacteria 2414
15 Ga0070699_100347170 3300005518 Bacteria 1336
16 Ga0070699_100353479 3300005518 Bacteria 1324
17 Ga0070684_101246091 3300005535 Bacteria 700
18 Ga0070696_100000781 3300005546 Bacteria 20461
19 Ga0070704_100252258 3300005549 Bacteria 1450
20 Ga0070664_100047268 3300005564 Bacteria 3635
21 Ga0068854_100335843 3300005578 Bacteria 1233
22 Ga0075365_10129673 3300006038 Bacteria 1745
23 Ga0075367_10177187 3300006178 Bacteria 1329
24 Ga0075369_10058656 3300006186 Bacteria 1676
25 Ga0075366_10223875 3300006195 Bacteria 1146
26 Ga0075370_10155205 3300006353 Bacteria 1342
27 Ga0075370_10260065 3300006353 Bacteria 1029
28 Ga0075428_100252587 3300006844 Bacteria 1900
29 Ga0075430_100149810 3300006846 Bacteria 1943
30 Ga0075431_100222360 3300006847 Bacteria 1926
31 Ga0068865_100585829 3300006881 Bacteria 941
32 Ga0099794_10009066 3300007265 Bacteria 4158
33 Ga0099795_10010325 3300007788 Bacteria 2746
34 Ga0099795_10011349 3300007788 Bacteria 2661
35 Ga0099795_10035837 3300007788 Bacteria 1737
36 Ga0099796_10001532 3300010159 Bacteria 4702
37 Ga0099796_10018765 3300010159 Bacteria 2084
38 Ga0157373_10174348 3300013100 Bacteria 1513
39 Ga0163162_11976491 3300013306 Bacteria 668
40 Ga0209564_1000031 3300025295 Bacteria 494703
41 Ga0209758_1008841 3300025297 Bacteria 6410
42 Ga0209050_1047990 3300025298 Bacteria 1108
43 Ga0209257_1014652 3300025304 Bacteria 3344
44 Ga0207684_10291836 3300025910 Bacteria 1406
45 Ga0207657_11062399 3300025919 Bacteria 620
46 Ga0207700_11496733 3300025928 Bacteria 599
47 Ga0207704_10349732 3300025938 Bacteria 1150
48 Ga0207691_10125118 3300025940 Bacteria 2275
49 Ga0207651_10397387 3300025960 Bacteria 1172
50 Ga0207677_10321669 3300026023 Bacteria 1286
51 Ga0207678_10243549 3300026067 Bacteria 1540
52 Ga0207698_10045976 3300026142 Bacteria 3293
53 Ga0209179_1013263 3300027512 Bacteria 1494
54 Ga0209179_1019736 3300027512 Bacteria 1301
55 Ga0209179_1098834 3300027512 Bacteria 649
56 Ga0268266_10701225 3300028379 Bacteria 976
57 Ga0373940_0264337 3300035088 Bacteria 583
58 Ga0373943_0475698 3300035170 Bacteria 728
59 Ga0395905_0904975 3300037471 Bacteria 785
60 Ga0439439_0096084 3300041406 Bacteria 813
61 Ga0451797_0263536 3300041453 Bacteria 735
62 Ga0451800_0364692 3300041459 Bacteria 673
63 Ga0451802_1246971 3300041460 Bacteria 1447
64 Ga0439433_0084607 3300041999 Bacteria 774
65 Ga0439449_0039956 3300042007 Bacteria 1744
66 Ga0439457_151550 3300042014 Bacteria 558
67 Ga0439462_0164538 3300042015 Bacteria 626
68 Ga0453683_0144627 3300044673 Bacteria 1501
69 Ga0495638_0134307 3300046460 Bacteria 1451
70 Ga0495638_0653724 3300046460 Bacteria 511
71 Ga0495583_0000038 3300046506 Bacteria 243395
72 Ga0495606_0001950 3300046507 Bacteria 25500
73 Ga0495637_0014511 3300046520 Bacteria 3717
74 Ga0495643_0032875 3300046522 Bacteria 2875
75 Ga0495648_0105537 3300046524 Bacteria 1545
76 Ga0495654_0110045 3300046530 Bacteria 1258
77 Ga0495654_0286526 3300046530 Bacteria 676
78 Ga0495633_0048299 3300046558 Bacteria 2010
79 Ga0495611_0084341 3300046648 Bacteria 1464
80 Ga0495625_0015551 3300046660 Bacteria 6022
81 Ga0495625_0259411 3300046660 Bacteria 1125
82 Ga0495661_0117298 3300046665 Bacteria 1475
83 Ga0495624_0321627 3300046690 Bacteria 932
84 Ga0495670_0663481 3300046691 Bacteria 568
85 Ga0495671_0006993 3300046692 Bacteria 6467
86 Ga0495672_0020249 3300047320 Unclassified 4365
87 Ga0495672_0420381 3300047320 Bacteria 608
88 Ga0495675_0433863 3300047444 Bacteria 762
89 Ga0495673_0009184 3300047469 Bacteria 5488
90 Ga0495673_0111700 3300047469 Bacteria 1092
91 Ga0495686_0000383 3300047472 Bacteria 70528
92 Ga0496100_0661162 3300048903 Bacteria 814
93 Ga0496102_0000116 3300048905 Bacteria 114127
94 Ga0496103_0000375 3300048906 Bacteria 40141
95 Ga0496105_0408520 3300048908 Bacteria 1077
96 Ga0496116_0028334 3300048919 Bacteria 4059
97 Ga0496117_0000193 3300048920 Bacteria 123780
98 Ga0496117_0041241 3300048920 Bacteria 3385
99 Ga0496118_0000812 3300048921 Bacteria 49836
100 Ga0496118_0062508 3300048921 Bacteria 2748
101 Ga0496121_0270564 3300048924 Bacteria 1168
102 Ga0496122_0000507 3300048925 Bacteria 80433
103 Ga0496123_0000484 3300048926 Bacteria 69108
104 Ga0496123_0307668 3300048926 Bacteria 753
105 Ga0496124_0000848 3300048927 Bacteria 49859
106 Ga0496124_0140340 3300048927 Bacteria 1908
107 Ga0496125_0004466 3300048928 Bacteria 16122
108 Ga0496125_0013793 3300048928 Bacteria 7916
109 Ga0495682_0045261 3300049460 Bacteria 1608
110 Ga0501033_0148758 3300049570 Bacteria 1690
111 Ga0501036_0302129 3300049572 Bacteria 1338
112 Ga0501037_0044797 3300049573 Bacteria 3248
113 Ga0501038_0131398 3300049574 Bacteria 2055
114 Ga0501038_0680373 3300049574 Bacteria 772
115 Ga0501039_0385760 3300049575 Bacteria 1100
116 Ga0501039_0648557 3300049575 Bacteria 827
117 Ga0501042_0748868 3300049578 Bacteria 711
118 Ga0501043_0227457 3300049579 Bacteria 1441
119 Ga0501046_1012483 3300049580 Bacteria 576
120 Ga0501047_0534516 3300049581 Bacteria 997
121 Ga0501067_0287175 3300049583 Bacteria 916
122 Ga0501071_0037965 3300049587 Bacteria 3441
123 Ga0501072_0100969 3300049588 Bacteria 2293
124 Ga0501073_0398396 3300049589 Bacteria 951
125 Ga0501073_0401851 3300049589 Bacteria 946
126 Ga0501074_0226976 3300049590 Bacteria 1329
127 Ga0501076_0046864 3300049592 Bacteria 3416
128 Ga0501077_0040892 3300049593 Bacteria 2952
129 Ga0501206_020482 3300049653 Unclassified 941
130 Ga0501257_055035 3300049686 Bacteria 997
131 Ga0501079_0069426 3300049741 Bacteria 2720
132 Ga0501079_0249413 3300049741 Bacteria 1387
133 Ga0501080_0178963 3300049742 Bacteria 1952
134 Ga0501241_064460 3300049758 Bacteria 740
135 Ga0501035_0775615 3300049822 Bacteria 767
136 Ga0501044_0121256 3300049823 Bacteria 2615
137 nmdc:mga0yw44_412322_c1 3300050492 Bacteria 914
138 nmdc:mga07m45_242201_c1 3300050496 Bacteria 1049
139 nmdc:mga09592_490282_c1 3300050508 Bacteria 1058
140 nmdc:mga0qj67_289738_c1 3300050509 Unclassified 1327
141 nmdc:mga06r32_222576_c1 3300050510 Unclassified 1875
142 nmdc:mga06r32_250665_c1 3300050510 Bacteria 1758
143 nmdc:mga0sz30_14544_c1 3300050516 Bacteria 3099
144 Ga0495601_0483350 3300053077 Bacteria 800
145 Ga0495619_0365194 3300053085 Bacteria 998
146 Ga0500643_000242 3300053087 Bacteria 50505
147 Ga0500643_001522 3300053087 Bacteria 13208
148 Ga0500643_011159 3300053087 Bacteria 3296
149 Ga0500643_028113 3300053087 Bacteria 1741
150 Ga0500643_095052 3300053087 Bacteria 811
151 Ga0500644_0001855 3300053088 Bacteria 5447
152 Ga0500583_0000184 3300053092 Bacteria 25372
153 Ga0500651_0011095 3300053093 Bacteria 5424
154 Ga0500651_0115165 3300053093 Bacteria 1637
155 Ga0500641_0004019 3300053096 Bacteria 5197
156 Ga0500650_0075880 3300053098 Bacteria 1571
157 Ga0500555_000071 3300053103 Bacteria 50369
158 Ga0500555_090152 3300053103 Bacteria 788
159 Ga0500556_0000040 3300053104 Bacteria 137489
160 Ga0500594_0001915 3300053118 Bacteria 4504
161 Ga0500594_0037903 3300053118 Bacteria 1304
162 Ga0500594_0132337 3300053118 Bacteria 791
163 Ga0500608_197308 3300053122 Bacteria 835
164 Ga0500608_227672 3300053122 Bacteria 747
165 Ga0500617_181772 3300053124 Bacteria 794
166 Ga0500618_090031 3300053125 Bacteria 689
167 Ga0500642_0000003 3300053130 Bacteria 544899
168 Ga0500652_001462 3300053131 Bacteria 7310
169 Ga0500559_0014750 3300053136 Bacteria 3301
170 Ga0500559_0050362 3300053136 Bacteria 1837
171 Ga0500573_0218614 3300053140 Bacteria 1001
172 Ga0500577_0014304 3300053142 Bacteria 2450
173 Ga0500577_0014990 3300053142 Bacteria 2411
174 Ga0500616_0000006 3300053153 Bacteria 944738
175 Ga0500616_0008118 3300053153 Bacteria 6565
176 Ga0500616_0033417 3300053153 Bacteria 2807
177 Ga0500616_0033774 3300053153 Bacteria 2789
178 Ga0500616_0189235 3300053153 Bacteria 920
179 Ga0500622_0005216 3300053156 Bacteria 7858
180 Ga0500622_0018466 3300053156 Bacteria 3708
181 Ga0500622_0101926 3300053156 Bacteria 1412
182 Ga0500645_001322 3300053730 Bacteria 12859
183 Ga0500645_002078 3300053730 Bacteria 9275
184 Ga0500661_001155 3300055283 Bacteria 4934
185 2644039935 2643221605 Bacteria 4772303
186 2857528537 2857524615 Bacteria 6615449
187 Ga0075430_100515115
188 JGI25153J46596_10045081
189 Ga0055526_1000417
190 Ga0070670_100306517
191 Ga0070661_100181648
192 Ga0070668_101316906
193 Ga0070675_100332151
194 Ga0070713_100053688
195 Ga0070663_100865606
196 Ga0070678_101361418
197 Ga0070662_101075193
198 Ga0070706_100037257
199 Ga0070706_100359851
200 Ga0070698_100135778
201 Ga0070699_100347170
202 Ga0070699_100353479
203 Ga0070684_101246091
204 Ga0070696_100000781
205 Ga0070704_100252258
206 Ga0070664_100047268
207 Ga0068854_100335843
208 Ga0075365_10129673
209 Ga0075367_10177187
210 Ga0075369_10058656
211 Ga0075366_10223875
212 Ga0075370_10155205
213 Ga0075370_10260065
214 Ga0075428_100252587
215 Ga0075430_100149810
216 Ga0075431_100222360
217 Ga0068865_100585829
218 Ga0099794_10009066
219 Ga0099795_10010325
220 Ga0099795_10011349
221 Ga0099795_10035837
222 Ga0099796_10001532
223 Ga0099796_10018765
224 Ga0157373_10174348
225 Ga0163162_11976491
226 Ga0209564_1000031
227 Ga0209758_1008841
228 Ga0209050_1047990
229 Ga0209257_1014652
230 Ga0207684_10291836
231 Ga0207657_11062399
232 Ga0207700_11496733
233 Ga0207704_10349732
234 Ga0207691_10125118
235 Ga0207651_10397387
236 Ga0207677_10321669
237 Ga0207678_10243549
238 Ga0207698_10045976
239 Ga0209179_1013263
240 Ga0209179_1019736
241 Ga0209179_1098834
242 Ga0268266_10701225
243 Ga0373940_0264337
244 Ga0373943_0475698
245 Ga0395905_0904975
246 Ga0439439_0096084
247 Ga0451797_0263536
248 Ga0451800_0364692
249 Ga0451802_1246971
250 Ga0439433_0084607
251 Ga0439449_0039956
252 Ga0439457_151550
253 Ga0439462_0164538
254 Ga0453683_0144627
255 Ga0495638_0134307
256 Ga0495638_0653724
257 Ga0495583_0000038
258 Ga0495606_0001950
259 Ga0495637_0014511
260 Ga0495643_0032875
261 Ga0495648_0105537
262 Ga0495654_0110045
263 Ga0495654_0286526
264 Ga0495633_0048299
265 Ga0495611_0084341
266 Ga0495625_0015551
267 Ga0495625_0259411
268 Ga0495661_0117298
269 Ga0495624_0321627
270 Ga0495670_0663481
271 Ga0495671_0006993
272 Ga0495672_0020249
273 Ga0495672_0420381
274 Ga0495675_0433863
275 Ga0495673_0009184
276 Ga0495673_0111700
277 Ga0495686_0000383
278 Ga0496100_0661162
279 Ga0496102_0000116
280 Ga0496103_0000375
281 Ga0496105_0408520
282 Ga0496116_0028334
283 Ga0496117_0000193
284 Ga0496117_0041241
285 Ga0496118_0000812
286 Ga0496118_0062508
287 Ga0496121_0270564
288 Ga0496122_0000507
289 Ga0496123_0000484
290 Ga0496123_0307668
291 Ga0496124_0000848
292 Ga0496124_0140340
293 Ga0496125_0004466
294 Ga0496125_0013793
295 Ga0495682_0045261
296 Ga0501033_0148758
297 Ga0501036_0302129
298 Ga0501037_0044797
299 Ga0501038_0131398
300 Ga0501038_0680373
301 Ga0501039_0385760
302 Ga0501039_0648557
303 Ga0501042_0748868
304 Ga0501043_0227457
305 Ga0501046_1012483
306 Ga0501047_0534516
307 Ga0501067_0287175
308 Ga0501071_0037965
309 Ga0501072_0100969
310 Ga0501073_0398396
311 Ga0501073_0401851
312 Ga0501074_0226976
313 Ga0501076_0046864
314 Ga0501077_0040892
315 Ga0501206_020482
316 Ga0501257_055035
317 Ga0501079_0069426
318 Ga0501079_0249413
319 Ga0501080_0178963
320 Ga0501241_064460
321 Ga0501035_0775615
322 Ga0501044_0121256
323 nmdc:mga0yw44_412322_c1
324 nmdc:mga07m45_242201_c1
325 nmdc:mga09592_490282_c1
326 nmdc:mga0qj67_289738_c1
327 nmdc:mga06r32_222576_c1
328 nmdc:mga06r32_250665_c1
329 nmdc:mga0sz30_14544_c1
330 Ga0495601_0483350
331 Ga0495619_0365194
332 Ga0500643_000242
333 Ga0500643_001522
334 Ga0500643_011159
335 Ga0500643_028113
336 Ga0500643_095052
337 Ga0500644_0001855
338 Ga0500583_0000184
339 Ga0500651_0011095
340 Ga0500651_0115165
341 Ga0500641_0004019
342 Ga0500650_0075880
343 Ga0500555_000071
344 Ga0500555_090152
345 Ga0500556_0000040
346 Ga0500594_0001915
347 Ga0500594_0037903
348 Ga0500594_0132337
349 Ga0500608_197308
350 Ga0500608_227672
351 Ga0500617_181772
352 Ga0500618_090031
353 Ga0500642_0000003
354 Ga0500652_001462
355 Ga0500559_0014750
356 Ga0500559_0050362
357 Ga0500573_0218614
358 Ga0500577_0014304
359 Ga0500577_0014990
360 Ga0500616_0000006
361 Ga0500616_0008118
362 Ga0500616_0033417
363 Ga0500616_0033774
364 Ga0500616_0189235
365 Ga0500622_0005216
366 Ga0500622_0018466
367 Ga0500622_0101926
368 Ga0500645_001322
369 Ga0500645_002078
370 Ga0500661_001155
371 2644039935
372 2857528537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

99

171

0.93

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

32

97

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9218 2 154
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9113 1 154
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9093 3 152
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9057 1 154
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9033 1 154
ID Description Score Start End Superfamily
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9408 85 152 1.10.150.120
1n60A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9265 85 154 1.10.150.120
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9254 85 152 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9206 85 154 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9153 85 154 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A0F8XF39-F1-model_v4 [2Fe-2S]-binding domain-containing protein 0.9863 50 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A0F8XF39-F1-model_v4 [2Fe-2S]-binding domain-containing protein 0.9771 50 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A258UCT0-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9726 4 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A6N7GQY8-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.972 2 154 GO:0016491
GO:0046872
GO:0051537
AF-A0A5C7JP39-F1-model_v4 deleted 0.9706 43 154

Map