F285752

General Info

Members Datasets Scaffolds Average Seq Length
186 135 372 481

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1000356|Ga0081540_100035628
Length 528
Sequence VEHGTGRGAEPGVEICCGMFIFGWPGKGVRALPDGSKGVPRMAQPAVNGRSSILTKLDERKPTAFYWQLTLLATLGGFLFGYDTSNIGSALNFVPYHLKGLALGYLVSGASLGAAAGAILAGPLADRFGRKTLLIIDAGIYAAGSILSAVTWHTSVLLIARTLIGVAIGADSAIATAYIAEYAPKDRRGALTMLQQWMITVGILVAYIVALIIFALWPGSAASSGWRLVLGLGAVPALIGLVMRSRMPESPRWLLRHGKYDEVRKAMATLGVEDVSDDDVQRAAQVVEQVEGGSREKRRRAWTPGVRRALVVVSVFFIFQQITGINVPLYYGPTLLGPYFAGGHASLVDTTVAGVEVTLIMTAVNVAATYLGFRWIDKFGRKPLAIGGYTGMIVSALIAALGLAALSGTLRLVVIMIGLDFFIASFAVGVGGTGWTLQGEVFPTAVRGQAAAFCAMIDWLANFLIIEIFPVSQNALSLGGVMVIFAGLCGLAIVFVWKFLPETKELPVEEIVRVFEKQQEQSALHKVA

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
79 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
80 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
88 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
89 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
101 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
102 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
103 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
104 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
105 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
106 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
110 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
111 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
112 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
113 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
114 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
115 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
116 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
117 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
118 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
129 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
134 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
135 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.24
Metatranscriptomes 3.23
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.45
Rhizosphere 87.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1000356 3300005983 Bacteria 46150
2 Ga0070658_10230583 3300005327 Bacteria 1568
3 Ga0070690_100011106 3300005330 Bacteria 5259
4 Ga0068869_100023878 3300005334 Bacteria 4231
5 Ga0070680_100014034 3300005336 Bacteria 6254
6 Ga0070689_100030478 3300005340 Bacteria 4095
7 Ga0070668_100123409 3300005347 Bacteria 2073
8 Ga0070669_100048558 3300005353 Bacteria 3098
9 Ga0070675_100046272 3300005354 Bacteria 3562
10 Ga0070659_100106287 3300005366 Bacteria 2262
11 Ga0070714_100000248 3300005435 Bacteria 42012
12 Ga0070714_100014819 3300005435 Bacteria 6266
13 Ga0070714_100082217 3300005435 Bacteria 2805
14 Ga0070714_100173093 3300005435 Bacteria 1960
15 Ga0070713_100008176 3300005436 Bacteria 7410
16 Ga0070713_100042550 3300005436 Bacteria 3708
17 Ga0070713_100100163 3300005436 Bacteria 2508
18 Ga0070710_10018402 3300005437 Bacteria 3593
19 Ga0070694_100031726 3300005444 Bacteria 3465
20 Ga0070708_100101360 3300005445 Bacteria 2636
21 Ga0070706_100032961 3300005467 Bacteria 4779
22 Ga0070707_100065566 3300005468 Bacteria 3489
23 Ga0070672_100115882 3300005543 Bacteria 2189
24 Ga0070686_100059104 3300005544 Bacteria 2469
25 Ga0070695_100099231 3300005545 Bacteria 1958
26 Ga0070696_100051142 3300005546 Bacteria 2873
27 Ga0068855_100009285 3300005563 Bacteria 11879
28 Ga0068855_100019845 3300005563 Bacteria 8075
29 Ga0068855_100207551 3300005563 Bacteria 2203
30 Ga0070664_100074912 3300005564 Bacteria 2905
31 Ga0068854_100024951 3300005578 Bacteria 4100
32 Ga0070702_100021906 3300005615 Bacteria 3370
33 Ga0068866_10015752 3300005718 Bacteria 3365
34 Ga0068861_100161720 3300005719 Bacteria 1847
35 Ga0068851_10031664 3300005834 Bacteria 2628
36 Ga0068870_10017357 3300005840 Bacteria 3455
37 Ga0081455_10113796 3300005937 Bacteria 2145
38 Ga0081540_1000101 3300005983 Bacteria 91600
39 Ga0070717_10087149 3300006028 Bacteria 2629
40 Ga0070715_10002408 3300006163 Bacteria 5737
41 Ga0070716_100024996 3300006173 Bacteria 3181
42 Ga0075433_10047365 3300006852 Bacteria 3739
43 Ga0075435_100041577 3300007076 Bacteria 3675
44 Ga0105240_10081637 3300009093 Bacteria 3972
45 Ga0111539_10074882 3300009094 Bacteria 3989
46 Ga0105245_10067036 3300009098 Bacteria 3250
47 Ga0105247_10083251 3300009101 Bacteria 2020
48 Ga0114129_10010151 3300009147 Bacteria 13426
49 Ga0105243_10067057 3300009148 Bacteria 2888
50 Ga0105241_10044336 3300009174 Bacteria 3369
51 Ga0105237_10079597 3300009545 Bacteria 3267
52 Ga0105237_10087995 3300009545 Bacteria 3095
53 Ga0105249_10153094 3300009553 Bacteria 2222
54 Ga0105239_10164585 3300010375 Bacteria 2480
55 Ga0105246_10039251 3300011119 Bacteria 3188
56 Ga0157371_10020729 3300013102 Bacteria 4835
57 Ga0157369_10018166 3300013105 Bacteria 7887
58 Ga0157369_10024971 3300013105 Bacteria 6638
59 Ga0157378_10059909 3300013297 Bacteria 3397
60 Ga0163162_10027329 3300013306 Bacteria 5642
61 Ga0163162_10059231 3300013306 Bacteria 3861
62 Ga0157372_10098029 3300013307 Bacteria 3344
63 Ga0163161_10031472 3300017792 Bacteria 3780
64 Ga0206350_10867540 3300020080 Bacteria 1821
65 Ga0206353_10656523 3300020082 Bacteria 3572
66 Ga0213875_10000799 3300021388 Bacteria 23538
67 Ga0213875_10000842 3300021388 Bacteria 22676
68 Ga0213875_10001030 3300021388 Bacteria 19784
69 Ga0213875_10055109 3300021388 Bacteria 1862
70 Ga0224712_10001423 3300022467 Bacteria 5503
71 Ga0224712_10004333 3300022467 Bacteria 3815
72 Ga0224712_10006012 3300022467 Bacteria 3430
73 Ga0224712_10044466 3300022467 Bacteria 1694
74 Ga0207688_10011335 3300025901 Bacteria 4854
75 Ga0207647_10030449 3300025904 Bacteria 3481
76 Ga0207699_10055198 3300025906 Bacteria 2363
77 Ga0207671_10190818 3300025914 Bacteria 1598
78 Ga0207693_10014006 3300025915 Bacteria 6457
79 Ga0207662_10032570 3300025918 Bacteria 3035
80 Ga0207657_10018900 3300025919 Bacteria 6560
81 Ga0207646_10042351 3300025922 Bacteria 4090
82 Ga0207646_10080832 3300025922 Bacteria 2906
83 Ga0207700_10041497 3300025928 Bacteria 3367
84 Ga0207664_10001429 3300025929 Bacteria 15697
85 Ga0207664_10038390 3300025929 Bacteria 3713
86 Ga0207664_10039052 3300025929 Bacteria 3683
87 Ga0207664_10129571 3300025929 Bacteria 2122
88 Ga0207709_10099449 3300025935 Bacteria 1920
89 Ga0207665_10014909 3300025939 Bacteria 5107
90 Ga0207691_10093473 3300025940 Bacteria 2692
91 Ga0207689_10014310 3300025942 Bacteria 6752
92 Ga0207667_10017456 3300025949 Bacteria 8075
93 Ga0207667_10187586 3300025949 Bacteria 2122
94 Ga0207658_10148318 3300025986 Bacteria 1908
95 Ga0207678_10001063 3300026067 Bacteria 25137
96 Ga0207674_10018234 3300026116 Bacteria 7636
97 Ga0207675_100003304 3300026118 Bacteria 15781
98 Ga0207698_10181611 3300026142 Bacteria 1864
99 Ga0268266_10082777 3300028379 Bacteria 2800
100 Ga0373930_0002316 3300034816 Bacteria 2940
101 Ga0373951_0018535 3300035091 Bacteria 1582
102 Ga0373956_0060195 3300035119 Bacteria 1719
103 Ga0373935_0063539 3300035692 Bacteria 2366
104 Ga0373937_0226882 3300036401 Bacteria 1758
105 Ga0395900_0015622 3300037418 Bacteria 7739
106 Ga0395900_0038614 3300037418 Bacteria 4922
107 Ga0395900_0132216 3300037418 Bacteria 2557
108 Ga0395898_0098456 3300037466 Bacteria 2808
109 Ga0436364_0303129 3300037853 Bacteria 102080
110 Ga0436364_0439843 3300037853 Bacteria 8300
111 Ga0436364_0445737 3300037853 Bacteria 4508
112 Ga0436364_0473486 3300037853 Bacteria 7718
113 Ga0436364_1232097 3300037853 Bacteria 76315
114 Ga0466969_0028284 3300044656 Bacteria 2866
115 Ga0466972_0030217 3300044658 Bacteria 2667
116 Ga0466966_0019127 3300044684 Bacteria 4508
117 Ga0466961_0001722 3300044693 Bacteria 13609
118 Ga0466961_0001971 3300044693 Bacteria 12768
119 Ga0466961_0009077 3300044693 Bacteria 6341
120 Ga0466963_0002643 3300044694 Bacteria 10071
121 Ga0466963_0004921 3300044694 Bacteria 7790
122 Ga0466963_0057159 3300044694 Bacteria 2598
123 Ga0466964_0037970 3300044706 Bacteria 1935
124 Ga0466971_0006228 3300044719 Bacteria 5186
125 Ga0466970_0002139 3300044765 Bacteria 9536
126 Ga0466970_0012908 3300044765 Bacteria 4278
127 Ga0466970_0016630 3300044765 Bacteria 3796
128 Ga0466957_0009318 3300044842 Bacteria 5601
129 Ga0466960_0014357 3300044901 Bacteria 3389
130 Ga0466959_0050049 3300045049 Bacteria 3069
131 Ga0466958_0002147 3300045836 Bacteria 9812
132 Ga0466958_0008252 3300045836 Bacteria 5767
133 Ga0466958_0022775 3300045836 Bacteria 3672
134 Ga0466958_0032189 3300045836 Bacteria 3119
135 Ga0466967_0001088 3300045976 Bacteria 15045
136 Ga0466967_0005674 3300045976 Bacteria 8697
137 Ga0466967_0005723 3300045976 Bacteria 8670
138 Ga0466967_0005868 3300045976 Bacteria 8595
139 Ga0466967_0009345 3300045976 Bacteria 7268
140 Ga0466967_0084273 3300045976 Bacteria 2876
141 Ga0495651_0108708 3300046462 Bacteria 2053
142 Ga0495587_0071098 3300046536 Bacteria 2024
143 Ga0495645_0004566 3300046543 Bacteria 9446
144 Ga0495634_0030407 3300046642 Bacteria 3729
145 Ga0495635_0065675 3300046663 Bacteria 2489
146 Ga0495657_0014979 3300046675 Bacteria 5688
147 Ga0495674_0003430 3300047319 Bacteria 15406
148 Ga0495680_0043461 3300047322 Bacteria 3557
149 Ga0496101_0004461 3300048904 Bacteria 8821
150 Ga0496107_0010390 3300048910 Bacteria 6466
151 Ga0496108_0113247 3300048911 Bacteria 2321
152 Ga0496109_0014507 3300048912 Bacteria 6854
153 Ga0496110_0011699 3300048913 Bacteria 7197
154 Ga0496110_0069026 3300048913 Bacteria 3129
155 Ga0496111_0028858 3300048914 Bacteria 3934
156 Ga0496113_0028034 3300048916 Bacteria 4045
157 Ga0496113_0146123 3300048916 Bacteria 1863
158 Ga0496114_0025381 3300048917 Bacteria 4843
159 Ga0496114_0107000 3300048917 Bacteria 2393
160 Ga0496114_0207582 3300048917 Bacteria 1717
161 Ga0496119_0052332 3300048922 Bacteria 2501
162 Ga0496120_0086729 3300048923 Bacteria 1682
163 Ga0496126_0117403 3300048929 Bacteria 2311
164 Ga0501032_0068312 3300049569 Bacteria 2373
165 Ga0501033_0025455 3300049570 Bacteria 4459
166 Ga0501037_0104649 3300049573 Bacteria 2040
167 Ga0501038_0005888 3300049574 Bacteria 11330
168 Ga0501043_0005057 3300049579 Bacteria 10665
169 Ga0501046_0065394 3300049580 Bacteria 2837
170 Ga0501047_0017213 3300049581 Bacteria 6919
171 Ga0501047_0018180 3300049581 Bacteria 6736
172 Ga0501047_0039248 3300049581 Bacteria 4580
173 Ga0501048_0000301 3300049582 Bacteria 33510
174 Ga0501070_0098174 3300049586 Bacteria 2423
175 Ga0501070_0219206 3300049586 Bacteria 1561
176 Ga0501080_0103313 3300049742 Bacteria 2643
177 Ga0501081_0164007 3300049743 Bacteria 1602
178 Ga0501035_0018567 3300049822 Bacteria 6405
179 Ga0501044_0004507 3300049823 Bacteria 15574
180 nmdc:mga08y16_27164_c1 3300050511 Bacteria 6031
181 nmdc:mga0a205_5708_c1 3300050515 Bacteria 11213
182 Ga0495595_0004322 3300053084 Bacteria 5718
183 Ga0466962_0011139 3300061719 Bacteria 4328
184 Ga0466962_0021851 3300061719 Bacteria 3072
185 Ga0466962_0063507 3300061719 Bacteria 1763
186 2883822770 2883821847 Bacteria 5121194
187 Ga0081540_1000356
188 Ga0070658_10230583
189 Ga0070690_100011106
190 Ga0068869_100023878
191 Ga0070680_100014034
192 Ga0070689_100030478
193 Ga0070668_100123409
194 Ga0070669_100048558
195 Ga0070675_100046272
196 Ga0070659_100106287
197 Ga0070714_100000248
198 Ga0070714_100014819
199 Ga0070714_100082217
200 Ga0070714_100173093
201 Ga0070713_100008176
202 Ga0070713_100042550
203 Ga0070713_100100163
204 Ga0070710_10018402
205 Ga0070694_100031726
206 Ga0070708_100101360
207 Ga0070706_100032961
208 Ga0070707_100065566
209 Ga0070672_100115882
210 Ga0070686_100059104
211 Ga0070695_100099231
212 Ga0070696_100051142
213 Ga0068855_100009285
214 Ga0068855_100019845
215 Ga0068855_100207551
216 Ga0070664_100074912
217 Ga0068854_100024951
218 Ga0070702_100021906
219 Ga0068866_10015752
220 Ga0068861_100161720
221 Ga0068851_10031664
222 Ga0068870_10017357
223 Ga0081455_10113796
224 Ga0081540_1000101
225 Ga0070717_10087149
226 Ga0070715_10002408
227 Ga0070716_100024996
228 Ga0075433_10047365
229 Ga0075435_100041577
230 Ga0105240_10081637
231 Ga0111539_10074882
232 Ga0105245_10067036
233 Ga0105247_10083251
234 Ga0114129_10010151
235 Ga0105243_10067057
236 Ga0105241_10044336
237 Ga0105237_10079597
238 Ga0105237_10087995
239 Ga0105249_10153094
240 Ga0105239_10164585
241 Ga0105246_10039251
242 Ga0157371_10020729
243 Ga0157369_10018166
244 Ga0157369_10024971
245 Ga0157378_10059909
246 Ga0163162_10027329
247 Ga0163162_10059231
248 Ga0157372_10098029
249 Ga0163161_10031472
250 Ga0206350_10867540
251 Ga0206353_10656523
252 Ga0213875_10000799
253 Ga0213875_10000842
254 Ga0213875_10001030
255 Ga0213875_10055109
256 Ga0224712_10001423
257 Ga0224712_10004333
258 Ga0224712_10006012
259 Ga0224712_10044466
260 Ga0207688_10011335
261 Ga0207647_10030449
262 Ga0207699_10055198
263 Ga0207671_10190818
264 Ga0207693_10014006
265 Ga0207662_10032570
266 Ga0207657_10018900
267 Ga0207646_10042351
268 Ga0207646_10080832
269 Ga0207700_10041497
270 Ga0207664_10001429
271 Ga0207664_10038390
272 Ga0207664_10039052
273 Ga0207664_10129571
274 Ga0207709_10099449
275 Ga0207665_10014909
276 Ga0207691_10093473
277 Ga0207689_10014310
278 Ga0207667_10017456
279 Ga0207667_10187586
280 Ga0207658_10148318
281 Ga0207678_10001063
282 Ga0207674_10018234
283 Ga0207675_100003304
284 Ga0207698_10181611
285 Ga0268266_10082777
286 Ga0373930_0002316
287 Ga0373951_0018535
288 Ga0373956_0060195
289 Ga0373935_0063539
290 Ga0373937_0226882
291 Ga0395900_0015622
292 Ga0395900_0038614
293 Ga0395900_0132216
294 Ga0395898_0098456
295 Ga0436364_0303129
296 Ga0436364_0439843
297 Ga0436364_0445737
298 Ga0436364_0473486
299 Ga0436364_1232097
300 Ga0466969_0028284
301 Ga0466972_0030217
302 Ga0466966_0019127
303 Ga0466961_0001722
304 Ga0466961_0001971
305 Ga0466961_0009077
306 Ga0466963_0002643
307 Ga0466963_0004921
308 Ga0466963_0057159
309 Ga0466964_0037970
310 Ga0466971_0006228
311 Ga0466970_0002139
312 Ga0466970_0012908
313 Ga0466970_0016630
314 Ga0466957_0009318
315 Ga0466960_0014357
316 Ga0466959_0050049
317 Ga0466958_0002147
318 Ga0466958_0008252
319 Ga0466958_0022775
320 Ga0466958_0032189
321 Ga0466967_0001088
322 Ga0466967_0005674
323 Ga0466967_0005723
324 Ga0466967_0005868
325 Ga0466967_0009345
326 Ga0466967_0084273
327 Ga0495651_0108708
328 Ga0495587_0071098
329 Ga0495645_0004566
330 Ga0495634_0030407
331 Ga0495635_0065675
332 Ga0495657_0014979
333 Ga0495674_0003430
334 Ga0495680_0043461
335 Ga0496101_0004461
336 Ga0496107_0010390
337 Ga0496108_0113247
338 Ga0496109_0014507
339 Ga0496110_0011699
340 Ga0496110_0069026
341 Ga0496111_0028858
342 Ga0496113_0028034
343 Ga0496113_0146123
344 Ga0496114_0025381
345 Ga0496114_0107000
346 Ga0496114_0207582
347 Ga0496119_0052332
348 Ga0496120_0086729
349 Ga0496126_0117403
350 Ga0501032_0068312
351 Ga0501033_0025455
352 Ga0501037_0104649
353 Ga0501038_0005888
354 Ga0501043_0005057
355 Ga0501046_0065394
356 Ga0501047_0017213
357 Ga0501047_0018180
358 Ga0501047_0039248
359 Ga0501048_0000301
360 Ga0501070_0098174
361 Ga0501070_0219206
362 Ga0501080_0103313
363 Ga0501081_0164007
364 Ga0501035_0018567
365 Ga0501044_0004507
366 nmdc:mga08y16_27164_c1
367 nmdc:mga0a205_5708_c1
368 Ga0495595_0004322
369 Ga0466962_0011139
370 Ga0466962_0021851
371 Ga0466962_0063507
372 2883822770

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

69

515

0.89

PF07690

MFS_1

Major Facilitator Superfamily

73

466

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lds-assembly1.cif.gz_A the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8614 31 462
6rw3-assembly1.cif.gz_A the molecular basis for sugar import in malaria parasites. 0.8544 21 466
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.8532 28 462
6rw3-assembly1.cif.gz_A the molecular basis for sugar import in malaria parasites. 0.8508 21 466
6rw3-assembly4.cif.gz_D the molecular basis for sugar import in malaria parasites. 0.8505 21 463
ID Description Score Start End Superfamily
af_Q04162_301_544_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9456 262 474 1.20.1250.20
4ja3A03 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.917 269 461 1.20.1250.20
af_A0A1D6LG74_1_148_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9113 69 220 1.20.1250.20
af_Q54UC8_260_478_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9041 258 460 1.20.1250.20
af_C0PE06_523_755_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9039 258 481 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A850CWE1-F1-model_v4 deleted 0.9745 261 481
AF-A0A2T2WTX3-F1-model_v4 MFS transporter 0.9697 32 481 GO:0005886
GO:0022857
AF-A0A2T2WTX3-F1-model_v4 MFS transporter 0.9612 32 481 GO:0005886
GO:0022857
AF-A0A2U9ILR7-F1-model_v4 MFS transporter 0.9504 7 475 GO:0016020
GO:0022857
AF-A0A358SPD5-F1-model_v4 MFS transporter 0.9502 206 480 GO:0016020
GO:0022857

Map