F285695

General Info

Members Datasets Scaffolds Average Seq Length
186 119 187 159

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100094030|Ga0068857_1000940302
Length 187
Sequence VRAISEAIGAQFSAANAPSTVGPPKKGYKMDCGQCGNQDTKVIESRDVEAEHAVRRRRACVVCGHRFTTYERVERPQLIVVKKDGTRQLFSRSKLLAGLYRACEKTPVTSLQLEQLVSSVEQQLYACAETEVPSDKIGELVMERLPALNEVAYVRFASVYRRFKDIASFEKELSHMRERKTTDAVGV

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
53 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
104 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
107 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
108 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
112 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
113 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
114 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
115 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
118 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.85
Metatranscriptomes 2.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.6
Nodule 0
Rhizoplane 1.61
Rhizosphere 86.02
Stem 0
Stem Tuber 0
Unclassified 3.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001267 3300001915 Bacteria 7419
2 JGI24737J22298_10000055 3300001990 Bacteria 33719
3 JGI24735J21928_10000047 3300002067 Bacteria 51438
4 rootH2_10000244 3300003320 Bacteria 697651
5 rootH2_10162212 3300003320 Bacteria 4900
6 rootH2_10222909 3300003320 Bacteria 1635
7 rootL2_10133310 3300003322 Bacteria 1483
8 rootL2_10256027 3300003322 Bacteria 1856
9 rootH1_10070884 3300003316 Bacteria 1406
10 rootH1_10070884 3300003323 Bacteria 9256
11 Ga0058862_12868944 3300004803 Bacteria 1685
12 Ga0070658_10001513 3300005327 Bacteria 19733
13 Ga0070658_10003146 3300005327 Bacteria 13617
14 Ga0070658_10028048 3300005327 Bacteria 4519
15 Ga0070658_10406261 3300005327 Unclassified 1170
16 Ga0070658_10430043 3300005327 Unclassified 1136
17 Ga0070676_10072595 3300005328 Unclassified 2069
18 Ga0070683_100000092 3300005329 Bacteria 59204
19 Ga0070690_100002309 3300005330 Bacteria 10234
20 Ga0070680_100021177 3300005336 Bacteria 5166
21 Ga0070680_100163441 3300005336 Unclassified 1871
22 Ga0070682_100150709 3300005337 Bacteria 1595
23 Ga0070682_100351862 3300005337 Bacteria 1098
24 Ga0070660_100000750 3300005339 Bacteria 21559
25 Ga0070660_100006766 3300005339 Bacteria 7957
26 Ga0070675_101005780 3300005354 Unclassified 765
27 Ga0070671_100139115 3300005355 Bacteria 2048
28 Ga0070674_100090297 3300005356 Bacteria 2209
29 Ga0070674_100155437 3300005356 Unclassified 1730
30 Ga0070673_100001417 3300005364 Bacteria 14012
31 Ga0070688_100382025 3300005365 Bacteria 1038
32 Ga0070659_100096490 3300005366 Bacteria 2375
33 Ga0070678_100001832 3300005456 Bacteria 11468
34 Ga0070678_100412968 3300005456 Unclassified 1175
35 Ga0070681_10089483 3300005458 Unclassified 3030
36 Ga0068867_100455125 3300005459 Bacteria 1091
37 Ga0070685_10000578 3300005466 Bacteria 20468
38 Ga0070685_10022060 3300005466 Bacteria 3466
39 Ga0070679_100012727 3300005530 Bacteria 8045
40 Ga0070684_100016013 3300005535 Bacteria 6125
41 Ga0070684_100641594 3300005535 Bacteria 988
42 Ga0070672_100164891 3300005543 Unclassified 1840
43 Ga0070686_100027648 3300005544 Bacteria 3434
44 Ga0070665_100118542 3300005548 Bacteria 2649
45 Ga0070665_101074391 3300005548 Bacteria 816
46 Ga0068855_100001067 3300005563 Bacteria 34001
47 Ga0068855_100106079 3300005563 Bacteria 3230
48 Ga0068855_100272163 3300005563 Bacteria 1883
49 Ga0068857_100094030 3300005577 Unclassified 2684
50 Ga0068857_100515467 3300005577 Bacteria 1123
51 Ga0068856_100001111 3300005614 Bacteria 28419
52 Ga0068856_100005421 3300005614 Bacteria 12569
53 Ga0068856_101365143 3300005614 Unclassified 723
54 Ga0068863_100092670 3300005841 Bacteria 2867
55 Ga0068858_100012467 3300005842 Bacteria 8017
56 Ga0075364_10000124 3300006051 Bacteria 31984
57 Ga0075364_10075947 3300006051 Bacteria 2217
58 Ga0075362_10000051 3300006177 Bacteria 38655
59 Ga0075369_10000021 3300006186 Bacteria 44895
60 Ga0075369_10282772 3300006186 Unclassified 773
61 Ga0075366_10000001 3300006195 Bacteria 569172
62 Ga0075366_10002330 3300006195 Bacteria 9713
63 Ga0075370_10066782 3300006353 Bacteria 2052
64 Ga0068871_100000980 3300006358 Bacteria 19120
65 Ga0075428_100035375 3300006844 Bacteria 5506
66 Ga0068865_100165145 3300006881 Bacteria 1692
67 Ga0105240_10000003 3300009093 Bacteria 1183681
68 Ga0111539_10672715 3300009094 Bacteria 1205
69 Ga0105245_10000001 3300009098 Bacteria 939270
70 Ga0105245_10000002 3300009098 Bacteria 634374
71 Ga0105245_10000093 3300009098 Bacteria 86866
72 Ga0105245_10007677 3300009098 Bacteria 9448
73 Ga0105245_10253663 3300009098 Bacteria 1710
74 Ga0105243_10000001 3300009148 Bacteria 1156578
75 Ga0105241_10000007 3300009174 Bacteria 343524
76 Ga0105242_10000002 3300009176 Bacteria 262559
77 Ga0105242_10019960 3300009176 Bacteria 5250
78 Ga0105242_10226751 3300009176 Unclassified 1672
79 Ga0105248_10047776 3300009177 Bacteria 4799
80 Ga0105237_10291303 3300009545 Bacteria 1635
81 Ga0105237_10329790 3300009545 Bacteria 1530
82 Ga0105238_10123219 3300009551 Bacteria 2572
83 Ga0105033_100655 3300009986 Bacteria 2686
84 Ga0105028_100541 3300009993 Bacteria 4021
85 Ga0105239_10100028 3300010375 Bacteria 3207
86 Ga0105239_11073802 3300010375 Bacteria 926
87 Ga0157371_10001301 3300013102 Bacteria 26246
88 Ga0157369_10002190 3300013105 Bacteria 23540
89 Ga0157369_10059021 3300013105 Bacteria 4138
90 Ga0157374_10000018 3300013296 Bacteria 286683
91 Ga0157374_10001055 3300013296 Bacteria 23950
92 Ga0157374_10001830 3300013296 Bacteria 17918
93 Ga0157374_10185650 3300013296 Bacteria 2033
94 Ga0157374_10479130 3300013296 Unclassified 1247
95 Ga0157378_10026756 3300013297 Bacteria 5086
96 Ga0163162_10657865 3300013306 Bacteria 1171
97 Ga0157372_10033832 3300013307 Bacteria 5616
98 Ga0157375_12214869 3300013308 Unclassified 655
99 Ga0157379_10706252 3300014968 Unclassified 947
100 Ga0224712_10487514 3300022467 Unclassified 595
101 Ga0207647_10075042 3300025904 Bacteria 2036
102 Ga0207705_10000011 3300025909 Bacteria 517768
103 Ga0207705_10000104 3300025909 Bacteria 96668
104 Ga0207705_10000136 3300025909 Bacteria 79294
105 Ga0207705_10016844 3300025909 Bacteria 5234
106 Ga0207705_10025254 3300025909 Bacteria 4242
107 Ga0207705_10031091 3300025909 Bacteria 3809
108 Ga0207654_10000002 3300025911 Bacteria 1460142
109 Ga0207654_10000905 3300025911 Bacteria 16385
110 Ga0207707_10069484 3300025912 Bacteria 3069
111 Ga0207695_10000005 3300025913 Bacteria 1196715
112 Ga0207660_10005812 3300025917 Bacteria 8007
113 Ga0207660_10423043 3300025917 Unclassified 1075
114 Ga0207657_10006322 3300025919 Bacteria 12308
115 Ga0207657_10017074 3300025919 Bacteria 6981
116 Ga0207652_10029419 3300025921 Unclassified 4593
117 Ga0207694_10233082 3300025924 Bacteria 1504
118 Ga0207694_10290373 3300025924 Bacteria 1345
119 Ga0207687_10000001 3300025927 Bacteria 1130810
120 Ga0207687_10000004 3300025927 Bacteria 841177
121 Ga0207687_10000008 3300025927 Bacteria 497738
122 Ga0207687_10000127 3300025927 Bacteria 51055
123 Ga0207687_10019620 3300025927 Unclassified 4480
124 Ga0207687_10330649 3300025927 Bacteria 1236
125 Ga0207687_10567019 3300025927 Bacteria 954
126 Ga0207644_10138672 3300025931 Bacteria 1870
127 Ga0207686_10000001 3300025934 Bacteria 1169580
128 Ga0207686_10043439 3300025934 Bacteria 2754
129 Ga0207709_10000002 3300025935 Bacteria 1171536
130 Ga0207709_10001962 3300025935 Bacteria 13437
131 Ga0207669_10095408 3300025937 Bacteria 1949
132 Ga0207669_10129600 3300025937 Unclassified 1730
133 Ga0207704_10131582 3300025938 Bacteria 1734
134 Ga0207711_10171791 3300025941 Unclassified 1967
135 Ga0207711_10887589 3300025941 Bacteria 829
136 Ga0207667_10000008 3300025949 Bacteria 625138
137 Ga0207667_10972115 3300025949 Bacteria 838
138 Ga0207667_11676898 3300025949 Unclassified 603
139 Ga0207651_10000735 3300025960 Bacteria 14041
140 Ga0207712_10000982 3300025961 Bacteria 20433
141 Ga0207668_10656857 3300025972 Bacteria 918
142 Ga0207703_10001658 3300026035 Bacteria 20007
143 Ga0207678_10122613 3300026067 Bacteria 2218
144 Ga0207702_10005986 3300026078 Bacteria 10561
145 Ga0207641_10033222 3300026088 Bacteria 4287
146 Ga0207648_11089044 3300026089 Unclassified 749
147 Ga0207674_10128935 3300026116 Unclassified 2494
148 Ga0207674_11197161 3300026116 Bacteria 729
149 Ga0207683_10011823 3300026121 Bacteria 7447
150 Ga0207698_12168977 3300026142 Bacteria 569
151 Ga0268266_10000652 3300028379 Bacteria 46990
152 Ga0265319_1121387 3300028563 Unclassified 814
153 Ga0265338_10075349 3300028800 Bacteria 2863
154 Ga0265331_10100759 3300031250 Unclassified 1329
155 Ga0265327_10461638 3300031251 Unclassified 548
156 Ga0395899_0001513 3300037312 Bacteria 19701
157 Ga0395900_0066397 3300037418 Bacteria 3706
158 Ga0395900_0399439 3300037418 Unclassified 1339
159 Ga0395898_0001854 3300037466 Bacteria 27100
160 Ga0395898_0079557 3300037466 Bacteria 3162
161 Ga0395905_0000682 3300037471 Bacteria 45023
162 Ga0395905_0003559 3300037471 Bacteria 16594
163 Ga0395905_0150857 3300037471 Bacteria 2187
164 Ga0395905_0907028 3300037471 Bacteria 784
165 Ga0395901_0001034 3300038443 Bacteria 30150
166 Ga0395901_0002934 3300038443 Bacteria 17207
167 Ga0395901_0003747 3300038443 Bacteria 15315
168 Ga0436365_1380480 3300039437 Unclassified 917
169 Ga0495649_0000057 3300046694 Bacteria 99739
170 Ga0495672_0056981 3300047320 Unclassified 2271
171 Ga0496104_0645687 3300048907 Unclassified 967
172 Ga0496112_0014476 3300048915 Bacteria 7322
173 Ga0496115_0259222 3300048918 Unclassified 1430
174 Ga0501297_085646 3300049520 Bacteria 517
175 Ga0501069_0553795 3300049585 Bacteria 688
176 Ga0501070_0112704 3300049586 Bacteria 2248
177 Ga0501276_012272 3300049773 Bacteria 739
178 nmdc:mga03683_50_c1 3300050489 Bacteria 42495
179 nmdc:mga00v17_1415_c1 3300050491 Bacteria 12599
180 nmdc:mga0k408_419_c2 3300050493 Bacteria 20202
181 nmdc:mga06z11_805890_c1 3300050494 Bacteria 572
182 nmdc:mga07m45_14669_c1 3300050496 Bacteria 4179
183 nmdc:mga07m45_50204_c1 3300050496 Unclassified 2350
184 nmdc:mga0sz30_245335_c1 3300050516 Unclassified 797
185 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
186 Ga0587069_033821 3300059642 Bacteria 841
187 Ga0587110_001726 3300059654 Bacteria 1634

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006177 Ga0075362_10000051 Ga0075362_1000005123 151
2 3300050489 nmdc:mga03683_50_c1 nmdc:mga03683_50_c1_35775_36230 151
3 3300006844 Ga0075428_100035375 Ga0075428_1000353754 152
4 3300003322 rootL2_10133310 rootL2_101333102 153
5 3300003323 rootH1_10070884 rootH1_100708845 153
6 3300005577 Ga0068857_100515467 Ga0068857_1005154671 153
7 3300026116 Ga0207674_11197161 Ga0207674_111971611 153
8 3300031250 Ga0265331_10100759 Ga0265331_101007592 153
9 3300049586 Ga0501070_0112704 Ga0501070_0112704_364_825 153
10 3300005327 Ga0070658_10028048 Ga0070658_100280482 154
11 3300022467 Ga0224712_10487514 Ga0224712_104875141 154
12 3300025909 Ga0207705_10025254 Ga0207705_100252542 154
13 3300025924 Ga0207694_10233082 Ga0207694_102330822 154
14 3300028563 Ga0265319_1121387 Ga0265319_11213872 154
15 3300028800 Ga0265338_10075349 Ga0265338_100753493 154
16 3300003320 rootH2_10162212 rootH2_101622122 155
17 3300006195 Ga0075366_10002330 Ga0075366_100023304 155
18 3300009986 Ga0105033_100655 Ga0105033_1006552 155
19 3300037312 Ga0395899_0001513 Ga0395899_0001513_7709_8176 155
20 3300037418 Ga0395900_0066397 Ga0395900_0066397_502_969 155
21 3300037466 Ga0395898_0001854 Ga0395898_0001854_11352_11819 155
22 3300037471 Ga0395905_0000682 Ga0395905_0000682_34126_34593 155
23 3300038443 Ga0395901_0001034 Ga0395901_0001034_11655_12122 155
24 3300038443 Ga0395901_0003747 Ga0395901_0003747_4418_4885 155
25 3300039437 Ga0436365_1380480 Ga0436365_1380480_40_507 155
26 3300049773 Ga0501276_012272 Ga0501276_012272_72_572 155
27 3300050493 nmdc:mga0k408_419_c2 nmdc:mga0k408_419_c2_4195_4662 155
28 3300050494 nmdc:mga06z11_805890_c1 nmdc:mga06z11_805890_c1_15_482 155
29 3300001915 JGI24741J21665_1001267 JGI24741J21665_10012672 156
30 3300001990 JGI24737J22298_10000055 JGI24737J22298_1000005521 156
31 3300002067 JGI24735J21928_10000047 JGI24735J21928_1000004724 156
32 3300003320 rootH2_10000244 rootH2_1000024419 156
33 3300003320 rootH2_10222909 rootH2_102229092 156
34 3300003322 rootL2_10256027 rootL2_102560272 156
35 3300004803 Ga0058862_12868944 Ga0058862_128689442 156
36 3300005327 Ga0070658_10001513 Ga0070658_1000151326 156
37 3300005327 Ga0070658_10003146 Ga0070658_100031463 156
38 3300005327 Ga0070658_10406261 Ga0070658_104062611 156
39 3300005327 Ga0070658_10430043 Ga0070658_104300432 156
40 3300005328 Ga0070676_10072595 Ga0070676_100725952 156
41 3300005329 Ga0070683_100000092 Ga0070683_10000009228 156
42 3300005330 Ga0070690_100002309 Ga0070690_1000023095 156
43 3300005336 Ga0070680_100021177 Ga0070680_1000211772 156
44 3300005336 Ga0070680_100163441 Ga0070680_1001634412 156
45 3300005337 Ga0070682_100150709 Ga0070682_1001507091 156
46 3300005337 Ga0070682_100351862 Ga0070682_1003518621 156
47 3300005339 Ga0070660_100000750 Ga0070660_1000007503 156
48 3300005339 Ga0070660_100006766 Ga0070660_1000067665 156
49 3300005354 Ga0070675_101005780 Ga0070675_1010057801 156
50 3300005355 Ga0070671_100139115 Ga0070671_1001391152 156
51 3300005356 Ga0070674_100090297 Ga0070674_1000902972 156
52 3300005356 Ga0070674_100155437 Ga0070674_1001554372 156
53 3300005364 Ga0070673_100001417 Ga0070673_1000014174 156
54 3300005365 Ga0070688_100382025 Ga0070688_1003820251 156
55 3300005366 Ga0070659_100096490 Ga0070659_1000964902 156
56 3300005456 Ga0070678_100001832 Ga0070678_1000018326 156
57 3300005456 Ga0070678_100412968 Ga0070678_1004129681 156
58 3300005458 Ga0070681_10089483 Ga0070681_100894832 156
59 3300005459 Ga0068867_100455125 Ga0068867_1004551252 156
60 3300005466 Ga0070685_10000578 Ga0070685_1000057824 156
61 3300005466 Ga0070685_10022060 Ga0070685_100220602 156
62 3300005530 Ga0070679_100012727 Ga0070679_1000127273 156
63 3300005535 Ga0070684_100016013 Ga0070684_1000160132 156
64 3300005535 Ga0070684_100641594 Ga0070684_1006415942 156
65 3300005543 Ga0070672_100164891 Ga0070672_1001648912 156
66 3300005544 Ga0070686_100027648 Ga0070686_1000276482 156
67 3300005548 Ga0070665_100118542 Ga0070665_1001185422 156
68 3300005548 Ga0070665_101074391 Ga0070665_1010743911 156
69 3300005563 Ga0068855_100001067 Ga0068855_10000106710 156
70 3300005563 Ga0068855_100106079 Ga0068855_1001060794 156
71 3300005563 Ga0068855_100272163 Ga0068855_1002721632 156
72 3300005577 Ga0068857_100094030 Ga0068857_1000940302 156
73 3300005614 Ga0068856_100001111 Ga0068856_1000011113 156
74 3300005614 Ga0068856_100005421 Ga0068856_1000054217 156
75 3300005614 Ga0068856_101365143 Ga0068856_1013651432 156
76 3300005841 Ga0068863_100092670 Ga0068863_1000926702 156
77 3300005842 Ga0068858_100012467 Ga0068858_10001246712 156
78 3300006051 Ga0075364_10000124 Ga0075364_100001248 156
79 3300006051 Ga0075364_10075947 Ga0075364_100759472 156
80 3300006186 Ga0075369_10000021 Ga0075369_1000002122 156
81 3300006186 Ga0075369_10282772 Ga0075369_102827722 156
82 3300006195 Ga0075366_10000001 Ga0075366_1000000119 156
83 3300006353 Ga0075370_10066782 Ga0075370_100667822 156
84 3300006358 Ga0068871_100000980 Ga0068871_1000009802 156
85 3300006881 Ga0068865_100165145 Ga0068865_1001651452 156
86 3300009093 Ga0105240_10000003 Ga0105240_100000031259 156
87 3300009094 Ga0111539_10672715 Ga0111539_106727152 156
88 3300009098 Ga0105245_10000001 Ga0105245_1000000125 156
89 3300009098 Ga0105245_10000002 Ga0105245_10000002647 156
90 3300009098 Ga0105245_10000093 Ga0105245_1000009314 156
91 3300009098 Ga0105245_10007677 Ga0105245_100076774 156
92 3300009098 Ga0105245_10253663 Ga0105245_102536632 156
93 3300009148 Ga0105243_10000001 Ga0105243_1000000120 156
94 3300009174 Ga0105241_10000007 Ga0105241_1000000720 156
95 3300009176 Ga0105242_10000002 Ga0105242_10000002262 156
96 3300009176 Ga0105242_10019960 Ga0105242_100199604 156
97 3300009176 Ga0105242_10226751 Ga0105242_102267512 156
98 3300009177 Ga0105248_10047776 Ga0105248_100477763 156
99 3300009545 Ga0105237_10291303 Ga0105237_102913032 156
100 3300009545 Ga0105237_10329790 Ga0105237_103297902 156
101 3300009551 Ga0105238_10123219 Ga0105238_101232191 156
102 3300009993 Ga0105028_100541 Ga0105028_1005411 156
103 3300010375 Ga0105239_10100028 Ga0105239_101000282 156
104 3300010375 Ga0105239_11073802 Ga0105239_110738021 156
105 3300013102 Ga0157371_10001301 Ga0157371_100013017 156
106 3300013105 Ga0157369_10002190 Ga0157369_1000219020 156
107 3300013105 Ga0157369_10059021 Ga0157369_100590212 156
108 3300013296 Ga0157374_10000018 Ga0157374_1000001819 156
109 3300013296 Ga0157374_10001055 Ga0157374_100010552 156
110 3300013296 Ga0157374_10001830 Ga0157374_100018302 156
111 3300013296 Ga0157374_10185650 Ga0157374_101856502 156
112 3300013296 Ga0157374_10479130 Ga0157374_104791302 156
113 3300013297 Ga0157378_10026756 Ga0157378_100267564 156
114 3300013306 Ga0163162_10657865 Ga0163162_106578652 156
115 3300013307 Ga0157372_10033832 Ga0157372_100338322 156
116 3300013308 Ga0157375_12214869 Ga0157375_122148691 156
117 3300014968 Ga0157379_10706252 Ga0157379_107062522 156
118 3300025904 Ga0207647_10075042 Ga0207647_100750422 156
119 3300025909 Ga0207705_10000011 Ga0207705_10000011573 156
120 3300025909 Ga0207705_10000104 Ga0207705_100001047 156
121 3300025909 Ga0207705_10000136 Ga0207705_1000013678 156
122 3300025909 Ga0207705_10016844 Ga0207705_100168443 156
123 3300025909 Ga0207705_10031091 Ga0207705_100310912 156
124 3300025911 Ga0207654_10000002 Ga0207654_100000021527 156
125 3300025911 Ga0207654_10000905 Ga0207654_100009055 156
126 3300025912 Ga0207707_10069484 Ga0207707_100694842 156
127 3300025913 Ga0207695_10000005 Ga0207695_100000051270 156
128 3300025917 Ga0207660_10005812 Ga0207660_100058124 156
129 3300025917 Ga0207660_10423043 Ga0207660_104230432 156
130 3300025919 Ga0207657_10006322 Ga0207657_100063222 156
131 3300025919 Ga0207657_10017074 Ga0207657_100170742 156
132 3300025921 Ga0207652_10029419 Ga0207652_100294192 156
133 3300025924 Ga0207694_10290373 Ga0207694_102903731 156
134 3300025927 Ga0207687_10000001 Ga0207687_10000001564 156
135 3300025927 Ga0207687_10000004 Ga0207687_10000004242 156
136 3300025927 Ga0207687_10000008 Ga0207687_10000008454 156
137 3300025927 Ga0207687_10000127 Ga0207687_1000012714 156
138 3300025927 Ga0207687_10019620 Ga0207687_100196203 156
139 3300025927 Ga0207687_10330649 Ga0207687_103306492 156
140 3300025927 Ga0207687_10567019 Ga0207687_105670192 156
141 3300025931 Ga0207644_10138672 Ga0207644_101386722 156
142 3300025934 Ga0207686_10000001 Ga0207686_100000011124 156
143 3300025934 Ga0207686_10043439 Ga0207686_100434392 156
144 3300025935 Ga0207709_10000002 Ga0207709_100000021241 156
145 3300025935 Ga0207709_10001962 Ga0207709_1000196210 156
146 3300025937 Ga0207669_10095408 Ga0207669_100954082 156
147 3300025937 Ga0207669_10129600 Ga0207669_101296002 156
148 3300025938 Ga0207704_10131582 Ga0207704_101315822 156
149 3300025941 Ga0207711_10171791 Ga0207711_101717911 156
150 3300025941 Ga0207711_10887589 Ga0207711_108875891 156
151 3300025949 Ga0207667_10000008 Ga0207667_10000008637 156
152 3300025949 Ga0207667_10972115 Ga0207667_109721151 156
153 3300025949 Ga0207667_11676898 Ga0207667_116768981 156
154 3300025960 Ga0207651_10000735 Ga0207651_1000073510 156
155 3300025961 Ga0207712_10000982 Ga0207712_100009826 156
156 3300025972 Ga0207668_10656857 Ga0207668_106568572 156
157 3300026035 Ga0207703_10001658 Ga0207703_1000165818 156
158 3300026067 Ga0207678_10122613 Ga0207678_101226132 156
159 3300026078 Ga0207702_10005986 Ga0207702_100059862 156
160 3300026088 Ga0207641_10033222 Ga0207641_100332222 156
161 3300026089 Ga0207648_11089044 Ga0207648_110890441 156
162 3300026116 Ga0207674_10128935 Ga0207674_101289353 156
163 3300026121 Ga0207683_10011823 Ga0207683_100118232 156
164 3300026142 Ga0207698_12168977 Ga0207698_121689771 156
165 3300028379 Ga0268266_10000652 Ga0268266_100006529 156
166 3300031251 Ga0265327_10461638 Ga0265327_104616381 156
167 3300037418 Ga0395900_0399439 Ga0395900_0399439_81_557 156
168 3300037466 Ga0395898_0079557 Ga0395898_0079557_2307_2792 156
169 3300037471 Ga0395905_0003559 Ga0395905_0003559_10800_11276 156
170 3300037471 Ga0395905_0150857 Ga0395905_0150857_1601_2086 156
171 3300037471 Ga0395905_0907028 Ga0395905_0907028_263_739 156
172 3300038443 Ga0395901_0002934 Ga0395901_0002934_1138_1623 156
173 3300046694 Ga0495649_0000057 Ga0495649_0000057_50352_50822 156
174 3300047320 Ga0495672_0056981 Ga0495672_0056981_1106_1582 156
175 3300048907 Ga0496104_0645687 Ga0496104_0645687_64_543 156
176 3300048915 Ga0496112_0014476 Ga0496112_0014476_41_520 156
177 3300048918 Ga0496115_0259222 Ga0496115_0259222_107_592 156
178 3300049520 Ga0501297_085646 Ga0501297_085646_30_500 156
179 3300049585 Ga0501069_0553795 Ga0501069_0553795_148_627 156
180 3300050491 nmdc:mga00v17_1415_c1 nmdc:mga00v17_1415_c1_4446_4916 156
181 3300050496 nmdc:mga07m45_14669_c1 nmdc:mga07m45_14669_c1_1427_1900 156
182 3300050496 nmdc:mga07m45_50204_c1 nmdc:mga07m45_50204_c1_987_1463 156
183 3300050516 nmdc:mga0sz30_245335_c1 nmdc:mga0sz30_245335_c1_83_553 156
184 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_37025_37498 156
185 3300059642 Ga0587069_033821 Ga0587069_033821_32_562 156
186 3300059654 Ga0587110_001726 Ga0587110_001726_496_1026 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22811

NrdR-like_N

Transcriptional repressor NrdR-like, N-terminal domain

30

71

0.99

PF03477

ATP-cone

ATP cone domain

78

166

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o8p-assembly1.cif.gz_B the crystal structure of dfoa bound to fad, the desferrioxamine biosynthetic pathway cadaverine monooxygenase from the fire blight disease pathogen erwinia amylovora 0.8376 8 41
7us3-assembly1.cif.gz_B structure of putrescine n-hydroxylase involved complexed with nadp+ 0.816 11 44
3er0-assembly1.cif.gz_A crystal structure of the full length eif5a from saccharomyces cerevisiae 0.8138 11 43
1v59-assembly1.cif.gz_A crystal structure of yeast lipoamide dehydrogenase complexed with nad+ 0.8017 11 41
3bg5-assembly3.cif.gz_B crystal structure of staphylococcus aureus pyruvate carboxylase 0.7976 11 45
ID Description Score Start End Superfamily
af_Q2FXP3_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9696 49 137 1.10.10.10
af_Q2FXP3_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9591 49 137 1.10.10.10
af_P0A8D0_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.938 50 137 1.10.10.10
af_P0A8D0_49_137_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9182 50 137 1.10.10.10
af_I1JVU1_64_124_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8684 11 43 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A7J5W8H9-F1-model_v4 Transcriptional repressor NrdR 0.9486 48 147 GO:0003677
GO:0005524
GO:0008270
GO:0045892
AF-A0A350TXW9-F1-model_v4 deleted 0.9437 41 135
AF-U1W5Y1-F1-model_v4 deleted 0.9354 48 148
AF-A0A350TXW9-F1-model_v4 deleted 0.9341 41 135
AF-U5NAA6-F1-model_v4 Transcriptional repressor NrdR 0.9334 51 147 GO:0003677
GO:0005524
GO:0008270
GO:0045892

Feature Viewer

pLDDT pTM Quality
86.94 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map