F285695
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 186 | 119 | 187 | 159 |
Family's Representative Sequence
| Representative Sequence | 3300005577|Ga0068857_100094030|Ga0068857_1000940302 |
| Length | 187 |
| Sequence | VRAISEAIGAQFSAANAPSTVGPPKKGYKMDCGQCGNQDTKVIESRDVEAEHAVRRRRACVVCGHRFTTYERVERPQLIVVKKDGTRQLFSRSKLLAGLYRACEKTPVTSLQLEQLVSSVEQQLYACAETEVPSDKIGELVMERLPALNEVAYVRFASVYRRFKDIASFEKELSHMRERKTTDAVGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 34 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 38 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 39 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 53 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 95 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 96 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 97 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 98 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 99 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 100 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 103 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 106 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 107 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 108 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 109 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 112 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 113 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 114 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 115 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 116 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 117 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 118 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 119 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.85 |
| Metatranscriptomes | 2.15 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.6 |
| Nodule | 0 |
| Rhizoplane | 1.61 |
| Rhizosphere | 86.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1001267 | 3300001915 | Bacteria | 7419 |
| 2 | JGI24737J22298_10000055 | 3300001990 | Bacteria | 33719 |
| 3 | JGI24735J21928_10000047 | 3300002067 | Bacteria | 51438 |
| 4 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 5 | rootH2_10162212 | 3300003320 | Bacteria | 4900 |
| 6 | rootH2_10222909 | 3300003320 | Bacteria | 1635 |
| 7 | rootL2_10133310 | 3300003322 | Bacteria | 1483 |
| 8 | rootL2_10256027 | 3300003322 | Bacteria | 1856 |
| 9 | rootH1_10070884 | 3300003316 | Bacteria | 1406 |
| 10 | rootH1_10070884 | 3300003323 | Bacteria | 9256 |
| 11 | Ga0058862_12868944 | 3300004803 | Bacteria | 1685 |
| 12 | Ga0070658_10001513 | 3300005327 | Bacteria | 19733 |
| 13 | Ga0070658_10003146 | 3300005327 | Bacteria | 13617 |
| 14 | Ga0070658_10028048 | 3300005327 | Bacteria | 4519 |
| 15 | Ga0070658_10406261 | 3300005327 | Unclassified | 1170 |
| 16 | Ga0070658_10430043 | 3300005327 | Unclassified | 1136 |
| 17 | Ga0070676_10072595 | 3300005328 | Unclassified | 2069 |
| 18 | Ga0070683_100000092 | 3300005329 | Bacteria | 59204 |
| 19 | Ga0070690_100002309 | 3300005330 | Bacteria | 10234 |
| 20 | Ga0070680_100021177 | 3300005336 | Bacteria | 5166 |
| 21 | Ga0070680_100163441 | 3300005336 | Unclassified | 1871 |
| 22 | Ga0070682_100150709 | 3300005337 | Bacteria | 1595 |
| 23 | Ga0070682_100351862 | 3300005337 | Bacteria | 1098 |
| 24 | Ga0070660_100000750 | 3300005339 | Bacteria | 21559 |
| 25 | Ga0070660_100006766 | 3300005339 | Bacteria | 7957 |
| 26 | Ga0070675_101005780 | 3300005354 | Unclassified | 765 |
| 27 | Ga0070671_100139115 | 3300005355 | Bacteria | 2048 |
| 28 | Ga0070674_100090297 | 3300005356 | Bacteria | 2209 |
| 29 | Ga0070674_100155437 | 3300005356 | Unclassified | 1730 |
| 30 | Ga0070673_100001417 | 3300005364 | Bacteria | 14012 |
| 31 | Ga0070688_100382025 | 3300005365 | Bacteria | 1038 |
| 32 | Ga0070659_100096490 | 3300005366 | Bacteria | 2375 |
| 33 | Ga0070678_100001832 | 3300005456 | Bacteria | 11468 |
| 34 | Ga0070678_100412968 | 3300005456 | Unclassified | 1175 |
| 35 | Ga0070681_10089483 | 3300005458 | Unclassified | 3030 |
| 36 | Ga0068867_100455125 | 3300005459 | Bacteria | 1091 |
| 37 | Ga0070685_10000578 | 3300005466 | Bacteria | 20468 |
| 38 | Ga0070685_10022060 | 3300005466 | Bacteria | 3466 |
| 39 | Ga0070679_100012727 | 3300005530 | Bacteria | 8045 |
| 40 | Ga0070684_100016013 | 3300005535 | Bacteria | 6125 |
| 41 | Ga0070684_100641594 | 3300005535 | Bacteria | 988 |
| 42 | Ga0070672_100164891 | 3300005543 | Unclassified | 1840 |
| 43 | Ga0070686_100027648 | 3300005544 | Bacteria | 3434 |
| 44 | Ga0070665_100118542 | 3300005548 | Bacteria | 2649 |
| 45 | Ga0070665_101074391 | 3300005548 | Bacteria | 816 |
| 46 | Ga0068855_100001067 | 3300005563 | Bacteria | 34001 |
| 47 | Ga0068855_100106079 | 3300005563 | Bacteria | 3230 |
| 48 | Ga0068855_100272163 | 3300005563 | Bacteria | 1883 |
| 49 | Ga0068857_100094030 | 3300005577 | Unclassified | 2684 |
| 50 | Ga0068857_100515467 | 3300005577 | Bacteria | 1123 |
| 51 | Ga0068856_100001111 | 3300005614 | Bacteria | 28419 |
| 52 | Ga0068856_100005421 | 3300005614 | Bacteria | 12569 |
| 53 | Ga0068856_101365143 | 3300005614 | Unclassified | 723 |
| 54 | Ga0068863_100092670 | 3300005841 | Bacteria | 2867 |
| 55 | Ga0068858_100012467 | 3300005842 | Bacteria | 8017 |
| 56 | Ga0075364_10000124 | 3300006051 | Bacteria | 31984 |
| 57 | Ga0075364_10075947 | 3300006051 | Bacteria | 2217 |
| 58 | Ga0075362_10000051 | 3300006177 | Bacteria | 38655 |
| 59 | Ga0075369_10000021 | 3300006186 | Bacteria | 44895 |
| 60 | Ga0075369_10282772 | 3300006186 | Unclassified | 773 |
| 61 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 62 | Ga0075366_10002330 | 3300006195 | Bacteria | 9713 |
| 63 | Ga0075370_10066782 | 3300006353 | Bacteria | 2052 |
| 64 | Ga0068871_100000980 | 3300006358 | Bacteria | 19120 |
| 65 | Ga0075428_100035375 | 3300006844 | Bacteria | 5506 |
| 66 | Ga0068865_100165145 | 3300006881 | Bacteria | 1692 |
| 67 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 68 | Ga0111539_10672715 | 3300009094 | Bacteria | 1205 |
| 69 | Ga0105245_10000001 | 3300009098 | Bacteria | 939270 |
| 70 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 71 | Ga0105245_10000093 | 3300009098 | Bacteria | 86866 |
| 72 | Ga0105245_10007677 | 3300009098 | Bacteria | 9448 |
| 73 | Ga0105245_10253663 | 3300009098 | Bacteria | 1710 |
| 74 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 75 | Ga0105241_10000007 | 3300009174 | Bacteria | 343524 |
| 76 | Ga0105242_10000002 | 3300009176 | Bacteria | 262559 |
| 77 | Ga0105242_10019960 | 3300009176 | Bacteria | 5250 |
| 78 | Ga0105242_10226751 | 3300009176 | Unclassified | 1672 |
| 79 | Ga0105248_10047776 | 3300009177 | Bacteria | 4799 |
| 80 | Ga0105237_10291303 | 3300009545 | Bacteria | 1635 |
| 81 | Ga0105237_10329790 | 3300009545 | Bacteria | 1530 |
| 82 | Ga0105238_10123219 | 3300009551 | Bacteria | 2572 |
| 83 | Ga0105033_100655 | 3300009986 | Bacteria | 2686 |
| 84 | Ga0105028_100541 | 3300009993 | Bacteria | 4021 |
| 85 | Ga0105239_10100028 | 3300010375 | Bacteria | 3207 |
| 86 | Ga0105239_11073802 | 3300010375 | Bacteria | 926 |
| 87 | Ga0157371_10001301 | 3300013102 | Bacteria | 26246 |
| 88 | Ga0157369_10002190 | 3300013105 | Bacteria | 23540 |
| 89 | Ga0157369_10059021 | 3300013105 | Bacteria | 4138 |
| 90 | Ga0157374_10000018 | 3300013296 | Bacteria | 286683 |
| 91 | Ga0157374_10001055 | 3300013296 | Bacteria | 23950 |
| 92 | Ga0157374_10001830 | 3300013296 | Bacteria | 17918 |
| 93 | Ga0157374_10185650 | 3300013296 | Bacteria | 2033 |
| 94 | Ga0157374_10479130 | 3300013296 | Unclassified | 1247 |
| 95 | Ga0157378_10026756 | 3300013297 | Bacteria | 5086 |
| 96 | Ga0163162_10657865 | 3300013306 | Bacteria | 1171 |
| 97 | Ga0157372_10033832 | 3300013307 | Bacteria | 5616 |
| 98 | Ga0157375_12214869 | 3300013308 | Unclassified | 655 |
| 99 | Ga0157379_10706252 | 3300014968 | Unclassified | 947 |
| 100 | Ga0224712_10487514 | 3300022467 | Unclassified | 595 |
| 101 | Ga0207647_10075042 | 3300025904 | Bacteria | 2036 |
| 102 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 103 | Ga0207705_10000104 | 3300025909 | Bacteria | 96668 |
| 104 | Ga0207705_10000136 | 3300025909 | Bacteria | 79294 |
| 105 | Ga0207705_10016844 | 3300025909 | Bacteria | 5234 |
| 106 | Ga0207705_10025254 | 3300025909 | Bacteria | 4242 |
| 107 | Ga0207705_10031091 | 3300025909 | Bacteria | 3809 |
| 108 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 109 | Ga0207654_10000905 | 3300025911 | Bacteria | 16385 |
| 110 | Ga0207707_10069484 | 3300025912 | Bacteria | 3069 |
| 111 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 112 | Ga0207660_10005812 | 3300025917 | Bacteria | 8007 |
| 113 | Ga0207660_10423043 | 3300025917 | Unclassified | 1075 |
| 114 | Ga0207657_10006322 | 3300025919 | Bacteria | 12308 |
| 115 | Ga0207657_10017074 | 3300025919 | Bacteria | 6981 |
| 116 | Ga0207652_10029419 | 3300025921 | Unclassified | 4593 |
| 117 | Ga0207694_10233082 | 3300025924 | Bacteria | 1504 |
| 118 | Ga0207694_10290373 | 3300025924 | Bacteria | 1345 |
| 119 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 120 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 121 | Ga0207687_10000008 | 3300025927 | Bacteria | 497738 |
| 122 | Ga0207687_10000127 | 3300025927 | Bacteria | 51055 |
| 123 | Ga0207687_10019620 | 3300025927 | Unclassified | 4480 |
| 124 | Ga0207687_10330649 | 3300025927 | Bacteria | 1236 |
| 125 | Ga0207687_10567019 | 3300025927 | Bacteria | 954 |
| 126 | Ga0207644_10138672 | 3300025931 | Bacteria | 1870 |
| 127 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 128 | Ga0207686_10043439 | 3300025934 | Bacteria | 2754 |
| 129 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 130 | Ga0207709_10001962 | 3300025935 | Bacteria | 13437 |
| 131 | Ga0207669_10095408 | 3300025937 | Bacteria | 1949 |
| 132 | Ga0207669_10129600 | 3300025937 | Unclassified | 1730 |
| 133 | Ga0207704_10131582 | 3300025938 | Bacteria | 1734 |
| 134 | Ga0207711_10171791 | 3300025941 | Unclassified | 1967 |
| 135 | Ga0207711_10887589 | 3300025941 | Bacteria | 829 |
| 136 | Ga0207667_10000008 | 3300025949 | Bacteria | 625138 |
| 137 | Ga0207667_10972115 | 3300025949 | Bacteria | 838 |
| 138 | Ga0207667_11676898 | 3300025949 | Unclassified | 603 |
| 139 | Ga0207651_10000735 | 3300025960 | Bacteria | 14041 |
| 140 | Ga0207712_10000982 | 3300025961 | Bacteria | 20433 |
| 141 | Ga0207668_10656857 | 3300025972 | Bacteria | 918 |
| 142 | Ga0207703_10001658 | 3300026035 | Bacteria | 20007 |
| 143 | Ga0207678_10122613 | 3300026067 | Bacteria | 2218 |
| 144 | Ga0207702_10005986 | 3300026078 | Bacteria | 10561 |
| 145 | Ga0207641_10033222 | 3300026088 | Bacteria | 4287 |
| 146 | Ga0207648_11089044 | 3300026089 | Unclassified | 749 |
| 147 | Ga0207674_10128935 | 3300026116 | Unclassified | 2494 |
| 148 | Ga0207674_11197161 | 3300026116 | Bacteria | 729 |
| 149 | Ga0207683_10011823 | 3300026121 | Bacteria | 7447 |
| 150 | Ga0207698_12168977 | 3300026142 | Bacteria | 569 |
| 151 | Ga0268266_10000652 | 3300028379 | Bacteria | 46990 |
| 152 | Ga0265319_1121387 | 3300028563 | Unclassified | 814 |
| 153 | Ga0265338_10075349 | 3300028800 | Bacteria | 2863 |
| 154 | Ga0265331_10100759 | 3300031250 | Unclassified | 1329 |
| 155 | Ga0265327_10461638 | 3300031251 | Unclassified | 548 |
| 156 | Ga0395899_0001513 | 3300037312 | Bacteria | 19701 |
| 157 | Ga0395900_0066397 | 3300037418 | Bacteria | 3706 |
| 158 | Ga0395900_0399439 | 3300037418 | Unclassified | 1339 |
| 159 | Ga0395898_0001854 | 3300037466 | Bacteria | 27100 |
| 160 | Ga0395898_0079557 | 3300037466 | Bacteria | 3162 |
| 161 | Ga0395905_0000682 | 3300037471 | Bacteria | 45023 |
| 162 | Ga0395905_0003559 | 3300037471 | Bacteria | 16594 |
| 163 | Ga0395905_0150857 | 3300037471 | Bacteria | 2187 |
| 164 | Ga0395905_0907028 | 3300037471 | Bacteria | 784 |
| 165 | Ga0395901_0001034 | 3300038443 | Bacteria | 30150 |
| 166 | Ga0395901_0002934 | 3300038443 | Bacteria | 17207 |
| 167 | Ga0395901_0003747 | 3300038443 | Bacteria | 15315 |
| 168 | Ga0436365_1380480 | 3300039437 | Unclassified | 917 |
| 169 | Ga0495649_0000057 | 3300046694 | Bacteria | 99739 |
| 170 | Ga0495672_0056981 | 3300047320 | Unclassified | 2271 |
| 171 | Ga0496104_0645687 | 3300048907 | Unclassified | 967 |
| 172 | Ga0496112_0014476 | 3300048915 | Bacteria | 7322 |
| 173 | Ga0496115_0259222 | 3300048918 | Unclassified | 1430 |
| 174 | Ga0501297_085646 | 3300049520 | Bacteria | 517 |
| 175 | Ga0501069_0553795 | 3300049585 | Bacteria | 688 |
| 176 | Ga0501070_0112704 | 3300049586 | Bacteria | 2248 |
| 177 | Ga0501276_012272 | 3300049773 | Bacteria | 739 |
| 178 | nmdc:mga03683_50_c1 | 3300050489 | Bacteria | 42495 |
| 179 | nmdc:mga00v17_1415_c1 | 3300050491 | Bacteria | 12599 |
| 180 | nmdc:mga0k408_419_c2 | 3300050493 | Bacteria | 20202 |
| 181 | nmdc:mga06z11_805890_c1 | 3300050494 | Bacteria | 572 |
| 182 | nmdc:mga07m45_14669_c1 | 3300050496 | Bacteria | 4179 |
| 183 | nmdc:mga07m45_50204_c1 | 3300050496 | Unclassified | 2350 |
| 184 | nmdc:mga0sz30_245335_c1 | 3300050516 | Unclassified | 797 |
| 185 | nmdc:mga0sz30_2_c1 | 3300050516 | Bacteria | 626403 |
| 186 | Ga0587069_033821 | 3300059642 | Bacteria | 841 |
| 187 | Ga0587110_001726 | 3300059654 | Bacteria | 1634 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006177 | Ga0075362_10000051 | Ga0075362_1000005123 | 151 |
| 2 | 3300050489 | nmdc:mga03683_50_c1 | nmdc:mga03683_50_c1_35775_36230 | 151 |
| 3 | 3300006844 | Ga0075428_100035375 | Ga0075428_1000353754 | 152 |
| 4 | 3300003322 | rootL2_10133310 | rootL2_101333102 | 153 |
| 5 | 3300003323 | rootH1_10070884 | rootH1_100708845 | 153 |
| 6 | 3300005577 | Ga0068857_100515467 | Ga0068857_1005154671 | 153 |
| 7 | 3300026116 | Ga0207674_11197161 | Ga0207674_111971611 | 153 |
| 8 | 3300031250 | Ga0265331_10100759 | Ga0265331_101007592 | 153 |
| 9 | 3300049586 | Ga0501070_0112704 | Ga0501070_0112704_364_825 | 153 |
| 10 | 3300005327 | Ga0070658_10028048 | Ga0070658_100280482 | 154 |
| 11 | 3300022467 | Ga0224712_10487514 | Ga0224712_104875141 | 154 |
| 12 | 3300025909 | Ga0207705_10025254 | Ga0207705_100252542 | 154 |
| 13 | 3300025924 | Ga0207694_10233082 | Ga0207694_102330822 | 154 |
| 14 | 3300028563 | Ga0265319_1121387 | Ga0265319_11213872 | 154 |
| 15 | 3300028800 | Ga0265338_10075349 | Ga0265338_100753493 | 154 |
| 16 | 3300003320 | rootH2_10162212 | rootH2_101622122 | 155 |
| 17 | 3300006195 | Ga0075366_10002330 | Ga0075366_100023304 | 155 |
| 18 | 3300009986 | Ga0105033_100655 | Ga0105033_1006552 | 155 |
| 19 | 3300037312 | Ga0395899_0001513 | Ga0395899_0001513_7709_8176 | 155 |
| 20 | 3300037418 | Ga0395900_0066397 | Ga0395900_0066397_502_969 | 155 |
| 21 | 3300037466 | Ga0395898_0001854 | Ga0395898_0001854_11352_11819 | 155 |
| 22 | 3300037471 | Ga0395905_0000682 | Ga0395905_0000682_34126_34593 | 155 |
| 23 | 3300038443 | Ga0395901_0001034 | Ga0395901_0001034_11655_12122 | 155 |
| 24 | 3300038443 | Ga0395901_0003747 | Ga0395901_0003747_4418_4885 | 155 |
| 25 | 3300039437 | Ga0436365_1380480 | Ga0436365_1380480_40_507 | 155 |
| 26 | 3300049773 | Ga0501276_012272 | Ga0501276_012272_72_572 | 155 |
| 27 | 3300050493 | nmdc:mga0k408_419_c2 | nmdc:mga0k408_419_c2_4195_4662 | 155 |
| 28 | 3300050494 | nmdc:mga06z11_805890_c1 | nmdc:mga06z11_805890_c1_15_482 | 155 |
| 29 | 3300001915 | JGI24741J21665_1001267 | JGI24741J21665_10012672 | 156 |
| 30 | 3300001990 | JGI24737J22298_10000055 | JGI24737J22298_1000005521 | 156 |
| 31 | 3300002067 | JGI24735J21928_10000047 | JGI24735J21928_1000004724 | 156 |
| 32 | 3300003320 | rootH2_10000244 | rootH2_1000024419 | 156 |
| 33 | 3300003320 | rootH2_10222909 | rootH2_102229092 | 156 |
| 34 | 3300003322 | rootL2_10256027 | rootL2_102560272 | 156 |
| 35 | 3300004803 | Ga0058862_12868944 | Ga0058862_128689442 | 156 |
| 36 | 3300005327 | Ga0070658_10001513 | Ga0070658_1000151326 | 156 |
| 37 | 3300005327 | Ga0070658_10003146 | Ga0070658_100031463 | 156 |
| 38 | 3300005327 | Ga0070658_10406261 | Ga0070658_104062611 | 156 |
| 39 | 3300005327 | Ga0070658_10430043 | Ga0070658_104300432 | 156 |
| 40 | 3300005328 | Ga0070676_10072595 | Ga0070676_100725952 | 156 |
| 41 | 3300005329 | Ga0070683_100000092 | Ga0070683_10000009228 | 156 |
| 42 | 3300005330 | Ga0070690_100002309 | Ga0070690_1000023095 | 156 |
| 43 | 3300005336 | Ga0070680_100021177 | Ga0070680_1000211772 | 156 |
| 44 | 3300005336 | Ga0070680_100163441 | Ga0070680_1001634412 | 156 |
| 45 | 3300005337 | Ga0070682_100150709 | Ga0070682_1001507091 | 156 |
| 46 | 3300005337 | Ga0070682_100351862 | Ga0070682_1003518621 | 156 |
| 47 | 3300005339 | Ga0070660_100000750 | Ga0070660_1000007503 | 156 |
| 48 | 3300005339 | Ga0070660_100006766 | Ga0070660_1000067665 | 156 |
| 49 | 3300005354 | Ga0070675_101005780 | Ga0070675_1010057801 | 156 |
| 50 | 3300005355 | Ga0070671_100139115 | Ga0070671_1001391152 | 156 |
| 51 | 3300005356 | Ga0070674_100090297 | Ga0070674_1000902972 | 156 |
| 52 | 3300005356 | Ga0070674_100155437 | Ga0070674_1001554372 | 156 |
| 53 | 3300005364 | Ga0070673_100001417 | Ga0070673_1000014174 | 156 |
| 54 | 3300005365 | Ga0070688_100382025 | Ga0070688_1003820251 | 156 |
| 55 | 3300005366 | Ga0070659_100096490 | Ga0070659_1000964902 | 156 |
| 56 | 3300005456 | Ga0070678_100001832 | Ga0070678_1000018326 | 156 |
| 57 | 3300005456 | Ga0070678_100412968 | Ga0070678_1004129681 | 156 |
| 58 | 3300005458 | Ga0070681_10089483 | Ga0070681_100894832 | 156 |
| 59 | 3300005459 | Ga0068867_100455125 | Ga0068867_1004551252 | 156 |
| 60 | 3300005466 | Ga0070685_10000578 | Ga0070685_1000057824 | 156 |
| 61 | 3300005466 | Ga0070685_10022060 | Ga0070685_100220602 | 156 |
| 62 | 3300005530 | Ga0070679_100012727 | Ga0070679_1000127273 | 156 |
| 63 | 3300005535 | Ga0070684_100016013 | Ga0070684_1000160132 | 156 |
| 64 | 3300005535 | Ga0070684_100641594 | Ga0070684_1006415942 | 156 |
| 65 | 3300005543 | Ga0070672_100164891 | Ga0070672_1001648912 | 156 |
| 66 | 3300005544 | Ga0070686_100027648 | Ga0070686_1000276482 | 156 |
| 67 | 3300005548 | Ga0070665_100118542 | Ga0070665_1001185422 | 156 |
| 68 | 3300005548 | Ga0070665_101074391 | Ga0070665_1010743911 | 156 |
| 69 | 3300005563 | Ga0068855_100001067 | Ga0068855_10000106710 | 156 |
| 70 | 3300005563 | Ga0068855_100106079 | Ga0068855_1001060794 | 156 |
| 71 | 3300005563 | Ga0068855_100272163 | Ga0068855_1002721632 | 156 |
| 72 | 3300005577 | Ga0068857_100094030 | Ga0068857_1000940302 | 156 |
| 73 | 3300005614 | Ga0068856_100001111 | Ga0068856_1000011113 | 156 |
| 74 | 3300005614 | Ga0068856_100005421 | Ga0068856_1000054217 | 156 |
| 75 | 3300005614 | Ga0068856_101365143 | Ga0068856_1013651432 | 156 |
| 76 | 3300005841 | Ga0068863_100092670 | Ga0068863_1000926702 | 156 |
| 77 | 3300005842 | Ga0068858_100012467 | Ga0068858_10001246712 | 156 |
| 78 | 3300006051 | Ga0075364_10000124 | Ga0075364_100001248 | 156 |
| 79 | 3300006051 | Ga0075364_10075947 | Ga0075364_100759472 | 156 |
| 80 | 3300006186 | Ga0075369_10000021 | Ga0075369_1000002122 | 156 |
| 81 | 3300006186 | Ga0075369_10282772 | Ga0075369_102827722 | 156 |
| 82 | 3300006195 | Ga0075366_10000001 | Ga0075366_1000000119 | 156 |
| 83 | 3300006353 | Ga0075370_10066782 | Ga0075370_100667822 | 156 |
| 84 | 3300006358 | Ga0068871_100000980 | Ga0068871_1000009802 | 156 |
| 85 | 3300006881 | Ga0068865_100165145 | Ga0068865_1001651452 | 156 |
| 86 | 3300009093 | Ga0105240_10000003 | Ga0105240_100000031259 | 156 |
| 87 | 3300009094 | Ga0111539_10672715 | Ga0111539_106727152 | 156 |
| 88 | 3300009098 | Ga0105245_10000001 | Ga0105245_1000000125 | 156 |
| 89 | 3300009098 | Ga0105245_10000002 | Ga0105245_10000002647 | 156 |
| 90 | 3300009098 | Ga0105245_10000093 | Ga0105245_1000009314 | 156 |
| 91 | 3300009098 | Ga0105245_10007677 | Ga0105245_100076774 | 156 |
| 92 | 3300009098 | Ga0105245_10253663 | Ga0105245_102536632 | 156 |
| 93 | 3300009148 | Ga0105243_10000001 | Ga0105243_1000000120 | 156 |
| 94 | 3300009174 | Ga0105241_10000007 | Ga0105241_1000000720 | 156 |
| 95 | 3300009176 | Ga0105242_10000002 | Ga0105242_10000002262 | 156 |
| 96 | 3300009176 | Ga0105242_10019960 | Ga0105242_100199604 | 156 |
| 97 | 3300009176 | Ga0105242_10226751 | Ga0105242_102267512 | 156 |
| 98 | 3300009177 | Ga0105248_10047776 | Ga0105248_100477763 | 156 |
| 99 | 3300009545 | Ga0105237_10291303 | Ga0105237_102913032 | 156 |
| 100 | 3300009545 | Ga0105237_10329790 | Ga0105237_103297902 | 156 |
| 101 | 3300009551 | Ga0105238_10123219 | Ga0105238_101232191 | 156 |
| 102 | 3300009993 | Ga0105028_100541 | Ga0105028_1005411 | 156 |
| 103 | 3300010375 | Ga0105239_10100028 | Ga0105239_101000282 | 156 |
| 104 | 3300010375 | Ga0105239_11073802 | Ga0105239_110738021 | 156 |
| 105 | 3300013102 | Ga0157371_10001301 | Ga0157371_100013017 | 156 |
| 106 | 3300013105 | Ga0157369_10002190 | Ga0157369_1000219020 | 156 |
| 107 | 3300013105 | Ga0157369_10059021 | Ga0157369_100590212 | 156 |
| 108 | 3300013296 | Ga0157374_10000018 | Ga0157374_1000001819 | 156 |
| 109 | 3300013296 | Ga0157374_10001055 | Ga0157374_100010552 | 156 |
| 110 | 3300013296 | Ga0157374_10001830 | Ga0157374_100018302 | 156 |
| 111 | 3300013296 | Ga0157374_10185650 | Ga0157374_101856502 | 156 |
| 112 | 3300013296 | Ga0157374_10479130 | Ga0157374_104791302 | 156 |
| 113 | 3300013297 | Ga0157378_10026756 | Ga0157378_100267564 | 156 |
| 114 | 3300013306 | Ga0163162_10657865 | Ga0163162_106578652 | 156 |
| 115 | 3300013307 | Ga0157372_10033832 | Ga0157372_100338322 | 156 |
| 116 | 3300013308 | Ga0157375_12214869 | Ga0157375_122148691 | 156 |
| 117 | 3300014968 | Ga0157379_10706252 | Ga0157379_107062522 | 156 |
| 118 | 3300025904 | Ga0207647_10075042 | Ga0207647_100750422 | 156 |
| 119 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011573 | 156 |
| 120 | 3300025909 | Ga0207705_10000104 | Ga0207705_100001047 | 156 |
| 121 | 3300025909 | Ga0207705_10000136 | Ga0207705_1000013678 | 156 |
| 122 | 3300025909 | Ga0207705_10016844 | Ga0207705_100168443 | 156 |
| 123 | 3300025909 | Ga0207705_10031091 | Ga0207705_100310912 | 156 |
| 124 | 3300025911 | Ga0207654_10000002 | Ga0207654_100000021527 | 156 |
| 125 | 3300025911 | Ga0207654_10000905 | Ga0207654_100009055 | 156 |
| 126 | 3300025912 | Ga0207707_10069484 | Ga0207707_100694842 | 156 |
| 127 | 3300025913 | Ga0207695_10000005 | Ga0207695_100000051270 | 156 |
| 128 | 3300025917 | Ga0207660_10005812 | Ga0207660_100058124 | 156 |
| 129 | 3300025917 | Ga0207660_10423043 | Ga0207660_104230432 | 156 |
| 130 | 3300025919 | Ga0207657_10006322 | Ga0207657_100063222 | 156 |
| 131 | 3300025919 | Ga0207657_10017074 | Ga0207657_100170742 | 156 |
| 132 | 3300025921 | Ga0207652_10029419 | Ga0207652_100294192 | 156 |
| 133 | 3300025924 | Ga0207694_10290373 | Ga0207694_102903731 | 156 |
| 134 | 3300025927 | Ga0207687_10000001 | Ga0207687_10000001564 | 156 |
| 135 | 3300025927 | Ga0207687_10000004 | Ga0207687_10000004242 | 156 |
| 136 | 3300025927 | Ga0207687_10000008 | Ga0207687_10000008454 | 156 |
| 137 | 3300025927 | Ga0207687_10000127 | Ga0207687_1000012714 | 156 |
| 138 | 3300025927 | Ga0207687_10019620 | Ga0207687_100196203 | 156 |
| 139 | 3300025927 | Ga0207687_10330649 | Ga0207687_103306492 | 156 |
| 140 | 3300025927 | Ga0207687_10567019 | Ga0207687_105670192 | 156 |
| 141 | 3300025931 | Ga0207644_10138672 | Ga0207644_101386722 | 156 |
| 142 | 3300025934 | Ga0207686_10000001 | Ga0207686_100000011124 | 156 |
| 143 | 3300025934 | Ga0207686_10043439 | Ga0207686_100434392 | 156 |
| 144 | 3300025935 | Ga0207709_10000002 | Ga0207709_100000021241 | 156 |
| 145 | 3300025935 | Ga0207709_10001962 | Ga0207709_1000196210 | 156 |
| 146 | 3300025937 | Ga0207669_10095408 | Ga0207669_100954082 | 156 |
| 147 | 3300025937 | Ga0207669_10129600 | Ga0207669_101296002 | 156 |
| 148 | 3300025938 | Ga0207704_10131582 | Ga0207704_101315822 | 156 |
| 149 | 3300025941 | Ga0207711_10171791 | Ga0207711_101717911 | 156 |
| 150 | 3300025941 | Ga0207711_10887589 | Ga0207711_108875891 | 156 |
| 151 | 3300025949 | Ga0207667_10000008 | Ga0207667_10000008637 | 156 |
| 152 | 3300025949 | Ga0207667_10972115 | Ga0207667_109721151 | 156 |
| 153 | 3300025949 | Ga0207667_11676898 | Ga0207667_116768981 | 156 |
| 154 | 3300025960 | Ga0207651_10000735 | Ga0207651_1000073510 | 156 |
| 155 | 3300025961 | Ga0207712_10000982 | Ga0207712_100009826 | 156 |
| 156 | 3300025972 | Ga0207668_10656857 | Ga0207668_106568572 | 156 |
| 157 | 3300026035 | Ga0207703_10001658 | Ga0207703_1000165818 | 156 |
| 158 | 3300026067 | Ga0207678_10122613 | Ga0207678_101226132 | 156 |
| 159 | 3300026078 | Ga0207702_10005986 | Ga0207702_100059862 | 156 |
| 160 | 3300026088 | Ga0207641_10033222 | Ga0207641_100332222 | 156 |
| 161 | 3300026089 | Ga0207648_11089044 | Ga0207648_110890441 | 156 |
| 162 | 3300026116 | Ga0207674_10128935 | Ga0207674_101289353 | 156 |
| 163 | 3300026121 | Ga0207683_10011823 | Ga0207683_100118232 | 156 |
| 164 | 3300026142 | Ga0207698_12168977 | Ga0207698_121689771 | 156 |
| 165 | 3300028379 | Ga0268266_10000652 | Ga0268266_100006529 | 156 |
| 166 | 3300031251 | Ga0265327_10461638 | Ga0265327_104616381 | 156 |
| 167 | 3300037418 | Ga0395900_0399439 | Ga0395900_0399439_81_557 | 156 |
| 168 | 3300037466 | Ga0395898_0079557 | Ga0395898_0079557_2307_2792 | 156 |
| 169 | 3300037471 | Ga0395905_0003559 | Ga0395905_0003559_10800_11276 | 156 |
| 170 | 3300037471 | Ga0395905_0150857 | Ga0395905_0150857_1601_2086 | 156 |
| 171 | 3300037471 | Ga0395905_0907028 | Ga0395905_0907028_263_739 | 156 |
| 172 | 3300038443 | Ga0395901_0002934 | Ga0395901_0002934_1138_1623 | 156 |
| 173 | 3300046694 | Ga0495649_0000057 | Ga0495649_0000057_50352_50822 | 156 |
| 174 | 3300047320 | Ga0495672_0056981 | Ga0495672_0056981_1106_1582 | 156 |
| 175 | 3300048907 | Ga0496104_0645687 | Ga0496104_0645687_64_543 | 156 |
| 176 | 3300048915 | Ga0496112_0014476 | Ga0496112_0014476_41_520 | 156 |
| 177 | 3300048918 | Ga0496115_0259222 | Ga0496115_0259222_107_592 | 156 |
| 178 | 3300049520 | Ga0501297_085646 | Ga0501297_085646_30_500 | 156 |
| 179 | 3300049585 | Ga0501069_0553795 | Ga0501069_0553795_148_627 | 156 |
| 180 | 3300050491 | nmdc:mga00v17_1415_c1 | nmdc:mga00v17_1415_c1_4446_4916 | 156 |
| 181 | 3300050496 | nmdc:mga07m45_14669_c1 | nmdc:mga07m45_14669_c1_1427_1900 | 156 |
| 182 | 3300050496 | nmdc:mga07m45_50204_c1 | nmdc:mga07m45_50204_c1_987_1463 | 156 |
| 183 | 3300050516 | nmdc:mga0sz30_245335_c1 | nmdc:mga0sz30_245335_c1_83_553 | 156 |
| 184 | 3300050516 | nmdc:mga0sz30_2_c1 | nmdc:mga0sz30_2_c1_37025_37498 | 156 |
| 185 | 3300059642 | Ga0587069_033821 | Ga0587069_033821_32_562 | 156 |
| 186 | 3300059654 | Ga0587110_001726 | Ga0587110_001726_496_1026 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5o8p-assembly1.cif.gz_B | the crystal structure of dfoa bound to fad, the desferrioxamine biosynthetic pathway cadaverine monooxygenase from the fire blight disease pathogen erwinia amylovora | 0.8376 | 8 | 41 |
| 7us3-assembly1.cif.gz_B | structure of putrescine n-hydroxylase involved complexed with nadp+ | 0.816 | 11 | 44 |
| 3er0-assembly1.cif.gz_A | crystal structure of the full length eif5a from saccharomyces cerevisiae | 0.8138 | 11 | 43 |
| 1v59-assembly1.cif.gz_A | crystal structure of yeast lipoamide dehydrogenase complexed with nad+ | 0.8017 | 11 | 41 |
| 3bg5-assembly3.cif.gz_B | crystal structure of staphylococcus aureus pyruvate carboxylase | 0.7976 | 11 | 45 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXP3_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9696 | 49 | 137 | 1.10.10.10 |
| af_Q2FXP3_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9591 | 49 | 137 | 1.10.10.10 |
| af_P0A8D0_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.938 | 50 | 137 | 1.10.10.10 |
| af_P0A8D0_49_137_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9182 | 50 | 137 | 1.10.10.10 |
| af_I1JVU1_64_124_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8684 | 11 | 43 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J5W8H9-F1-model_v4 | Transcriptional repressor NrdR | 0.9486 | 48 | 147 |
GO:0003677
GO:0005524 GO:0008270 GO:0045892 |
| AF-A0A350TXW9-F1-model_v4 | deleted | 0.9437 | 41 | 135 |
|
| AF-U1W5Y1-F1-model_v4 | deleted | 0.9354 | 48 | 148 |
|
| AF-A0A350TXW9-F1-model_v4 | deleted | 0.9341 | 41 | 135 |
|
| AF-U5NAA6-F1-model_v4 | Transcriptional repressor NrdR | 0.9334 | 51 | 147 |
GO:0003677
GO:0005524 GO:0008270 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar