F284969

General Info

Members Datasets Scaffolds Average Seq Length
185 130 160 437

Family's Representative Sequence

Representative Sequence 3300048920|Ga0496117_0002244|Ga0496117_0002244_5437_6861
Length 474
Sequence MKRIGIVLPWVLAAGLAGCSDTAHLDVMDGSGPSPQLPPPNKTLVPTVNIAPAIGWPQGAKPQAAAGTQVTAFADKLDHPRWLYVLPNGDVLVAETNAPPKPEDGKGLRGWVMGKAMQRAGAGVPSANRITLLRDADHDGVAEVRTTFIEGLNSPFGMALVGKDFYVADTDKLLRFHYEPGAMHIRGEGQQVVELPGGPLNHHWTKNVIASPDGKKLYVTVGSNSNVGENGLNKEQGRAAIWEVDPASGQQRVFASGLRNPNGLAWEPHSGALWTAVNERDEIGSDLVPDYITSVKDGGFYGWPYSYYGQHVDQRVEPQAPQKVAQALMPDYAVGPHTASLGLTFAEPGVLPPPFGQGAFVGQHGSWNRKPHSGYKVIFVPFDATGKPAGKPVDLLTGFLNDEGKAMXXXVGVINDQRGGLLVADDVGNVIWRVSKALEQPCAAKRPVKAPTSKPYAPASSQRKAAPTQSAINC

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231024 Pseudomonas sp. GM84 Isolate Nodule
3 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
4 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2643221660 Methylibium sp. Root1272 Isolate Unclassified
9 2643221664 Massilia sp. Root418 Isolate Unclassified
10 2738541280 Massilia sp. GV090 Isolate Unclassified
11 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
12 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
13 2765235841 Pseudomonas putida AA7 Isolate Unclassified
14 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
15 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
16 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
17 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
18 2858950400 Achromobacter sp. K91 Isolate Unclassified
19 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
20 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
21 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
22 2941479691
23 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
24 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
47 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
62 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
67 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
68 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
69 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
72 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
86 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
89 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
90 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
91 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
92 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
93 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
94 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
95 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
96 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
97 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
101 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
102 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
111 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
112 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
122 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
125 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
126 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
127 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
128 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
129 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
130 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.49
Metatranscriptomes 0
Isolates 13.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.73
Nodule 2.7
Rhizoplane 3.78
Rhizosphere 58.92
Stem 0
Stem Tuber 0
Unclassified 24.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2614868 2162886007 Bacteria 5425
2 Ga0055524_1000097 3300003775 Bacteria 108145
3 Ga0055524_1001382 3300003775 Bacteria 14029
4 Ga0055530_10012953 3300003791 Bacteria 2877
5 Ga0055540_1000023 3300003792 Bacteria 201131
6 Ga0055531_10012234 3300003794 Bacteria 4054
7 Ga0065704_10073233 3300005289 Bacteria 7409
8 Ga0065704_10073986 3300005289 Bacteria 6613
9 Ga0070683_100126162 3300005329 Bacteria 2420
10 Ga0070661_100000171 3300005344 Bacteria 53073
11 Ga0070668_100044670 3300005347 Bacteria 3398
12 Ga0070674_100027697 3300005356 Bacteria 3715
13 Ga0070659_100001128 3300005366 Bacteria 19488
14 Ga0070659_100040839 3300005366 Bacteria 3626
15 Ga0070667_100215988 3300005367 Bacteria 1706
16 Ga0070662_100186751 3300005457 Bacteria 1637
17 Ga0068855_100018985 3300005563 Bacteria 8266
18 Ga0070664_100002177 3300005564 Bacteria 15739
19 Ga0068865_100119428 3300006881 Bacteria 1957
20 Ga0079104_1000019 3300006946 Bacteria 269313
21 Ga0105251_10002567 3300009011 Bacteria 14090
22 Ga0105244_10001184 3300009036 Bacteria 21595
23 Ga0105244_10008109 3300009036 Bacteria 6598
24 Ga0105244_10079558 3300009036 Bacteria 1624
25 Ga0105243_10002564 3300009148 Bacteria 15187
26 Ga0157372_10190599 3300013307 Bacteria 2375
27 Ga0157375_10131919 3300013308 Bacteria 2618
28 Ga0163161_10023236 3300017792 Bacteria 4372
29 Ga0209676_1000973 3300025292 Bacteria 34485
30 Ga0209676_1009466 3300025292 Bacteria 4199
31 Ga0209050_1000378 3300025298 Bacteria 83974
32 Ga0209050_1000802 3300025298 Bacteria 44317
33 Ga0209050_1010127 3300025298 Bacteria 4692
34 Ga0209256_1000051 3300025299 Bacteria 307241
35 Ga0209256_1000089 3300025299 Bacteria 214426
36 Ga0209051_1000079 3300025303 Bacteria 201183
37 Ga0209257_1000141 3300025304 Bacteria 201130
38 Ga0207696_1000144 3300025711 Bacteria 122345
39 Ga0207696_1007437 3300025711 Bacteria 4288
40 Ga0207655_1000501 3300025728 Bacteria 50226
41 Ga0207655_1001799 3300025728 Bacteria 18594
42 Ga0207655_1031098 3300025728 Bacteria 2468
43 Ga0207713_1005012 3300025735 Bacteria 8432
44 Ga0207713_1005218 3300025735 Bacteria 8195
45 Ga0207649_10000261 3300025920 Bacteria 41690
46 Ga0207690_10127563 3300025932 Bacteria 1857
47 Ga0207706_10219415 3300025933 Bacteria 1665
48 Ga0207709_10001683 3300025935 Bacteria 14894
49 Ga0207709_10011849 3300025935 Bacteria 4810
50 Ga0207679_10000205 3300025945 Bacteria 47113
51 Ga0207667_10093665 3300025949 Bacteria 3102
52 Ga0209281_1000160 3300027111 Bacteria 161071
53 Ga0265327_10002540 3300031251 Bacteria 19011
54 Ga0307513_10270905 3300031456 Bacteria 1481
55 Ga0307412_10002688 3300031911 Bacteria 9866
56 Ga0307415_100081392 3300032126 Bacteria 2313
57 Ga0373925_0040497 3300037068 Bacteria 3450
58 Ga0439436_0045347 3300041404 Bacteria 1251
59 Ga0439456_000089 3300042013 Bacteria 31822
60 Ga0451577_0006619 3300042876 Bacteria 11511
61 Ga0495617_000305 3300046452 Bacteria 27697
62 Ga0495590_0010576 3300046457 Bacteria 3462
63 Ga0495638_0002282 3300046460 Bacteria 15847
64 Ga0495605_0001457 3300046474 Bacteria 15459
65 Ga0495605_0017514 3300046474 Bacteria 3853
66 Ga0495584_0000592 3300046491 Bacteria 24414
67 Ga0495585_0000500 3300046492 Bacteria 37095
68 Ga0495585_0014912 3300046492 Bacteria 4519
69 Ga0495596_0034251 3300046500 Bacteria 2017
70 Ga0495607_0019907 3300046501 Bacteria 4252
71 Ga0495583_0000004 3300046506 Bacteria 655287
72 Ga0495606_0001158 3300046507 Bacteria 37308
73 Ga0495616_0001914 3300046513 Bacteria 14016
74 Ga0495616_0002891 3300046513 Bacteria 11212
75 Ga0495620_0000003 3300046515 Bacteria 345923
76 Ga0495632_0000186 3300046519 Bacteria 63352
77 Ga0495632_0005873 3300046519 Bacteria 8016
78 Ga0495643_0000319 3300046522 Bacteria 66471
79 Ga0495643_0000569 3300046522 Bacteria 45560
80 Ga0495643_0001974 3300046522 Bacteria 17209
81 Ga0495643_0002637 3300046522 Bacteria 13917
82 Ga0495643_0008410 3300046522 Bacteria 6536
83 Ga0495648_0000117 3300046524 Bacteria 97341
84 Ga0495648_0000676 3300046524 Bacteria 36436
85 Ga0495648_0000860 3300046524 Bacteria 31968
86 Ga0495663_0037171 3300046525 Bacteria 1468
87 Ga0495654_0009973 3300046530 Bacteria 5188
88 Ga0495587_0030993 3300046536 Bacteria 3241
89 Ga0495609_0000964 3300046538 Bacteria 20666
90 Ga0495633_0003938 3300046558 Bacteria 9667
91 Ga0495633_0017327 3300046558 Bacteria 3686
92 Ga0495611_0015296 3300046648 Bacteria 3279
93 Ga0495625_0002646 3300046660 Bacteria 19101
94 Ga0495659_0000015 3300046664 Bacteria 76146
95 Ga0495659_0000878 3300046664 Bacteria 10678
96 Ga0495661_0021461 3300046665 Bacteria 4210
97 Ga0495661_0024256 3300046665 Bacteria 3928
98 Ga0495670_0004023 3300046691 Bacteria 7208
99 Ga0495670_0004168 3300046691 Bacteria 7082
100 Ga0495670_0037769 3300046691 Bacteria 2407
101 Ga0495671_0000359 3300046692 Bacteria 37925
102 Ga0495671_0002959 3300046692 Bacteria 10563
103 Ga0495671_0035049 3300046692 Bacteria 2550
104 Ga0495649_0001815 3300046694 Bacteria 15676
105 Ga0495649_0031258 3300046694 Bacteria 2936
106 Ga0495636_0000301 3300047318 Bacteria 19415
107 Ga0495672_0000035 3300047320 Bacteria 290329
108 Ga0495672_0025625 3300047320 Bacteria 3770
109 Ga0495672_0026942 3300047320 Bacteria 3659
110 Ga0495680_0150734 3300047322 Bacteria 1695
111 Ga0495683_0000344 3300047323 Bacteria 38540
112 Ga0495683_0003366 3300047323 Bacteria 9342
113 Ga0495687_000536 3300047443 Bacteria 45378
114 Ga0495685_000004 3300047447 Bacteria 115775
115 Ga0495602_0001476 3300048088 Bacteria 23369
116 Ga0495626_0023071 3300048091 Bacteria 3067
117 Ga0496103_0007960 3300048906 Bacteria 6298
118 Ga0496104_0251552 3300048907 Bacteria 1680
119 Ga0496108_0201119 3300048911 Bacteria 1729
120 Ga0496110_0022963 3300048913 Bacteria 5302
121 Ga0496114_0000502 3300048917 Bacteria 28617
122 Ga0496114_0004116 3300048917 Bacteria 11251
123 Ga0496116_0057317 3300048919 Bacteria 2548
124 Ga0496117_0001008 3300048920 Bacteria 43122
125 Ga0496117_0002244 3300048920 Bacteria 24928
126 Ga0496117_0008345 3300048920 Bacteria 9848
127 Ga0496117_0010630 3300048920 Bacteria 8348
128 Ga0496118_0003309 3300048921 Bacteria 20446
129 Ga0496118_0010322 3300048921 Bacteria 9261
130 Ga0496118_0018360 3300048921 Bacteria 6314
131 Ga0496118_0038574 3300048921 Bacteria 3826
132 Ga0496119_0009144 3300048922 Bacteria 8565
133 Ga0496119_0074583 3300048922 Bacteria 1975
134 Ga0496120_0002825 3300048923 Bacteria 16748
135 Ga0496121_0001092 3300048924 Bacteria 47942
136 Ga0496121_0117301 3300048924 Bacteria 2017
137 Ga0496122_0004088 3300048925 Bacteria 18485
138 Ga0496122_0052557 3300048925 Bacteria 3082
139 Ga0496123_0016580 3300048926 Bacteria 5972
140 Ga0496123_0017626 3300048926 Bacteria 5733
141 Ga0496123_0035674 3300048926 Bacteria 3540
142 Ga0496124_0001100 3300048927 Bacteria 42478
143 Ga0496124_0010243 3300048927 Bacteria 9520
144 Ga0496124_0042687 3300048927 Bacteria 3903
145 Ga0496124_0043979 3300048927 Bacteria 3836
146 Ga0496124_0050049 3300048927 Bacteria 3562
147 Ga0496125_0000768 3300048928 Bacteria 52483
148 Ga0496125_0002991 3300048928 Bacteria 21184
149 Ga0496125_0027113 3300048928 Bacteria 5200
150 Ga0496126_0010539 3300048929 Bacteria 9679
151 Ga0496126_0029684 3300048929 Bacteria 5191
152 Ga0495678_001788 3300049459 Bacteria 15897
153 Ga0495682_0001222 3300049460 Bacteria 14572
154 Ga0495682_0001240 3300049460 Bacteria 14428
155 Ga0501044_0069988 3300049823 Bacteria 3571
156 Ga0495612_0006928 3300053078 Bacteria 4637
157 Ga0500556_0000117 3300053104 Bacteria 69237
158 Ga0500562_036334 3300053108 Bacteria 1306
159 Ga0500618_000473 3300053125 Bacteria 26049
160 Ga0500559_0000003 3300053136 Bacteria 252693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0006619 Ga0451577_0006619_6493_7638 370
2 3300041404 Ga0439436_0045347 Ga0439436_0045347_99_1226 374
3 3300053108 Ga0500562_036334 Ga0500562_036334_41_1264 393
4 3300046522 Ga0495643_0000569 Ga0495643_0000569_38073_39431 399
5 3300048091 Ga0495626_0023071 Ga0495626_0023071_801_2168 399
6 3300046501 Ga0495607_0019907 Ga0495607_0019907_1761_3128 400
7 3300046665 Ga0495661_0021461 Ga0495661_0021461_1460_2827 400
8 3300046519 Ga0495632_0005873 Ga0495632_0005873_1117_2460 405
9 3300046452 Ga0495617_000305 Ga0495617_000305_7694_9010 407
10 3300046492 Ga0495585_0000500 Ga0495585_0000500_28511_29827 407
11 3300046513 Ga0495616_0001914 Ga0495616_0001914_5506_6822 407
12 3300046524 Ga0495648_0000117 Ga0495648_0000117_9139_10455 407
13 3300046525 Ga0495663_0037171 Ga0495663_0037171_203_1438 409
14 3300046491 Ga0495584_0000592 Ga0495584_0000592_16214_17527 417
15 3300046492 Ga0495585_0014912 Ga0495585_0014912_1613_2926 417
16 3300046500 Ga0495596_0034251 Ga0495596_0034251_53_1366 417
17 3300046513 Ga0495616_0002891 Ga0495616_0002891_3037_4350 417
18 3300046558 Ga0495633_0003938 Ga0495633_0003938_6761_8074 417
19 3300047323 Ga0495683_0000344 Ga0495683_0000344_1501_2814 417
20 3300046691 Ga0495670_0004168 Ga0495670_0004168_2849_4162 418
21 3300025292 Ga0209676_1000973 Ga0209676_10009731 420
22 3300047322 Ga0495680_0150734 Ga0495680_0150734_17_1300 421
23 3300003775 Ga0055524_1001382 Ga0055524_10013826 422
24 3300025299 Ga0209256_1000089 Ga0209256_100008989 422
25 3300048929 Ga0496126_0029684 Ga0496126_0029684_2631_3932 422
26 3300005329 Ga0070683_100126162 Ga0070683_1001261622 423
27 3300046522 Ga0495643_0001974 Ga0495643_0001974_3198_4508 423
28 3300005289 Ga0065704_10073986 Ga0065704_100739866 424
29 3300005366 Ga0070659_100040839 Ga0070659_1000408393 424
30 3300005563 Ga0068855_100018985 Ga0068855_1000189857 424
31 3300009148 Ga0105243_10002564 Ga0105243_100025644 424
32 3300013307 Ga0157372_10190599 Ga0157372_101905992 424
33 3300017792 Ga0163161_10023236 Ga0163161_100232364 424
34 3300025935 Ga0207709_10001683 Ga0207709_1000168314 424
35 3300025949 Ga0207667_10093665 Ga0207667_100936653 424
36 3300046515 Ga0495620_0000003 Ga0495620_0000003_229195_230511 424
37 3300046519 Ga0495632_0000186 Ga0495632_0000186_56823_58139 424
38 3300046522 Ga0495643_0000319 Ga0495643_0000319_24081_25397 424
39 3300046524 Ga0495648_0000676 Ga0495648_0000676_10104_11420 424
40 3300046694 Ga0495649_0031258 Ga0495649_0031258_170_1480 424
41 3300048919 Ga0496116_0057317 Ga0496116_0057317_574_1920 424
42 3300048920 Ga0496117_0001008 Ga0496117_0001008_36820_38166 424
43 3300037068 Ga0373925_0040497 Ga0373925_0040497_2034_3347 425
44 3300031251 Ga0265327_10002540 Ga0265327_100025407 426
45 3300046530 Ga0495654_0009973 Ga0495654_0009973_814_2154 426
46 3300046664 Ga0495659_0000015 Ga0495659_0000015_7578_8918 426
47 3300046692 Ga0495671_0000359 Ga0495671_0000359_29509_30849 426
48 3300047320 Ga0495672_0000035 Ga0495672_0000035_111651_112991 426
49 3300048913 Ga0496110_0022963 Ga0496110_0022963_1271_2584 426
50 3300009011 Ga0105251_10002567 Ga0105251_1000256710 427
51 3300025711 Ga0207696_1007437 Ga0207696_10074372 427
52 3300025735 Ga0207713_1005218 Ga0207713_10052183 427
53 3300048925 Ga0496122_0052557 Ga0496122_0052557_568_1884 427
54 3300048926 Ga0496123_0035674 Ga0496123_0035674_2165_3481 427
55 3300048927 Ga0496124_0001100 Ga0496124_0001100_36352_37668 427
56 iso_pu_bacteria 2808606418 2809144020 427
57 3300046522 Ga0495643_0002637 Ga0495643_0002637_548_1858 429
58 3300046665 Ga0495661_0024256 Ga0495661_0024256_2084_3385 429
59 iso_pu_bacteria 2811994881 2812369844 429
60 iso_pu_bacteria 2923519811 2923523930 429
61 iso_pu_bacteria 2738543020 2739285921 431
62 iso_pu_bacteria 2738543021 2739291234 431
63 3300032126 Ga0307415_100081392 Ga0307415_1000813921 432
64 3300046536 Ga0495587_0030993 Ga0495587_0030993_278_1609 432
65 3300048906 Ga0496103_0007960 Ga0496103_0007960_25_1335 432
66 3300053078 Ga0495612_0006928 Ga0495612_0006928_2591_3922 432
67 3300053104 Ga0500556_0000117 Ga0500556_0000117_42252_43592 432
68 3300053125 Ga0500618_000473 Ga0500618_000473_16178_17521 432
69 iso_pu_bacteria 2554235231 2555249252 432
70 3300005344 Ga0070661_100000171 Ga0070661_10000017155 433
71 3300005347 Ga0070668_100044670 Ga0070668_1000446702 433
72 3300005356 Ga0070674_100027697 Ga0070674_1000276972 433
73 3300005366 Ga0070659_100001128 Ga0070659_10000112820 433
74 3300005367 Ga0070667_100215988 Ga0070667_1002159882 433
75 3300005457 Ga0070662_100186751 Ga0070662_1001867511 433
76 3300005564 Ga0070664_100002177 Ga0070664_10000217716 433
77 3300013308 Ga0157375_10131919 Ga0157375_101319191 433
78 3300025920 Ga0207649_10000261 Ga0207649_1000026120 433
79 3300025932 Ga0207690_10127563 Ga0207690_101275632 433
80 3300025933 Ga0207706_10219415 Ga0207706_102194151 433
81 3300025945 Ga0207679_10000205 Ga0207679_1000020534 433
82 3300046691 Ga0495670_0037769 Ga0495670_0037769_276_1586 433
83 3300048088 Ga0495602_0001476 Ga0495602_0001476_14971_16278 433
84 iso_pu_bacteria 2599185292 2599907291 433
85 iso_pu_bacteria 2643221569 2643863962 433
86 iso_pu_bacteria 2643221594 2643982524 433
87 iso_pu_bacteria 2643221621 2644121467 433
88 iso_pu_bacteria 2808606395 2809034634 433
89 iso_pu_bacteria 2857537821 2857541798 433
90 iso_pu_bacteria 2858950400 2858953751 433
91 iso_pu_bacteria 2941479691 2941480373 433
92 3300003775 Ga0055524_1000097 Ga0055524_100009760 434
93 3300003791 Ga0055530_10012953 Ga0055530_100129531 434
94 3300003792 Ga0055540_1000023 Ga0055540_1000023148 434
95 3300003794 Ga0055531_10012234 Ga0055531_100122345 434
96 3300006881 Ga0068865_100119428 Ga0068865_1001194282 434
97 3300006946 Ga0079104_1000019 Ga0079104_100001938 434
98 3300025298 Ga0209050_1000378 Ga0209050_100037838 434
99 3300025298 Ga0209050_1010127 Ga0209050_10101272 434
100 3300025299 Ga0209256_1000051 Ga0209256_100005139 434
101 3300025303 Ga0209051_1000079 Ga0209051_100007939 434
102 3300025304 Ga0209257_1000141 Ga0209257_1000141185 434
103 3300027111 Ga0209281_1000160 Ga0209281_100016038 434
104 3300046558 Ga0495633_0017327 Ga0495633_0017327_1342_2655 434
105 3300048907 Ga0496104_0251552 Ga0496104_0251552_338_1654 434
106 3300048917 Ga0496114_0000502 Ga0496114_0000502_7713_9068 434
107 iso_pu_bacteria 2511231024 2511374182 434
108 iso_pu_bacteria 2765235841 2765585517 434
109 iso_pu_bacteria 2912963787 2912967756 434
110 iso_pu_bacteria 2939651529 2939655790 434
111 iso_pu_bacteria 2965062239 2965070118 434
112 iso_pu_bacteria 3007803356 3007803792 434
113 iso_pu_bacteria 643692032 643826144 434
114 iso_pu_bacteria 8055878733 8055881309 434
115 3300009036 Ga0105244_10001184 Ga0105244_1000118419 435
116 3300009036 Ga0105244_10008109 Ga0105244_100081095 435
117 3300025728 Ga0207655_1000501 Ga0207655_100050141 435
118 3300025728 Ga0207655_1001799 Ga0207655_100179916 435
119 3300046474 Ga0495605_0017514 Ga0495605_0017514_14_1366 435
120 3300046507 Ga0495606_0001158 Ga0495606_0001158_11105_12415 435
121 3300046692 Ga0495671_0035049 Ga0495671_0035049_633_1943 435
122 3300046694 Ga0495649_0001815 Ga0495649_0001815_12985_14295 435
123 3300047320 Ga0495672_0025625 Ga0495672_0025625_145_1497 435
124 3300048920 Ga0496117_0010630 Ga0496117_0010630_201_1514 435
125 3300048921 Ga0496118_0038574 Ga0496118_0038574_497_1810 435
126 3300048924 Ga0496121_0117301 Ga0496121_0117301_628_1992 435
127 3300048927 Ga0496124_0010243 Ga0496124_0010243_407_1771 435
128 3300048927 Ga0496124_0043979 Ga0496124_0043979_2279_3589 435
129 3300048928 Ga0496125_0027113 Ga0496125_0027113_261_1625 435
130 3300025292 Ga0209676_1009466 Ga0209676_10094663 436
131 3300025298 Ga0209050_1000802 Ga0209050_10008024 436
132 3300031911 Ga0307412_10002688 Ga0307412_100026887 436
133 3300048911 Ga0496108_0201119 Ga0496108_0201119_256_1578 436
134 3300048921 Ga0496118_0018360 Ga0496118_0018360_413_1729 436
135 3300048922 Ga0496119_0009144 Ga0496119_0009144_5796_7112 436
136 3300048923 Ga0496120_0002825 Ga0496120_0002825_5670_6986 436
137 3300048924 Ga0496121_0001092 Ga0496121_0001092_18542_19858 436
138 3300048926 Ga0496123_0017626 Ga0496123_0017626_100_1416 436
139 3300048927 Ga0496124_0050049 Ga0496124_0050049_235_1551 436
140 3300048928 Ga0496125_0000768 Ga0496125_0000768_14036_15352 436
141 3300048929 Ga0496126_0010539 Ga0496126_0010539_679_1995 436
142 iso_pu_bacteria 2643221664 2644359463 436
143 3300031456 Ga0307513_10270905 Ga0307513_102709051 437
144 3300046457 Ga0495590_0010576 Ga0495590_0010576_388_1752 437
145 3300046460 Ga0495638_0002282 Ga0495638_0002282_7146_8510 437
146 3300046474 Ga0495605_0001457 Ga0495605_0001457_4881_6245 437
147 3300046506 Ga0495583_0000004 Ga0495583_0000004_410891_412255 437
148 3300046524 Ga0495648_0000860 Ga0495648_0000860_7180_8544 437
149 3300046538 Ga0495609_0000964 Ga0495609_0000964_16687_18051 437
150 3300046648 Ga0495611_0015296 Ga0495611_0015296_1666_3030 437
151 3300046660 Ga0495625_0002646 Ga0495625_0002646_14016_15380 437
152 3300046664 Ga0495659_0000878 Ga0495659_0000878_6132_7496 437
153 3300046691 Ga0495670_0004023 Ga0495670_0004023_4538_5902 437
154 3300046692 Ga0495671_0002959 Ga0495671_0002959_2042_3406 437
155 3300047318 Ga0495636_0000301 Ga0495636_0000301_11984_13348 437
156 3300047320 Ga0495672_0026942 Ga0495672_0026942_745_2109 437
157 3300047323 Ga0495683_0003366 Ga0495683_0003366_1719_3083 437
158 3300047443 Ga0495687_000536 Ga0495687_000536_28999_30363 437
159 3300047447 Ga0495685_000004 Ga0495685_000004_99856_101220 437
160 3300049459 Ga0495678_001788 Ga0495678_001788_7060_8424 437
161 3300049460 Ga0495682_0001222 Ga0495682_0001222_7517_8881 437
162 3300049460 Ga0495682_0001240 Ga0495682_0001240_5688_7052 437
163 3300049823 Ga0501044_0069988 Ga0501044_0069988_1893_3278 437
164 3300053136 Ga0500559_0000003 Ga0500559_0000003_6376_7725 437
165 iso_pu_bacteria 2643221660 2644340628 437
166 iso_pu_bacteria 2738541280 2738740788 437
167 2162886007 SwRhRL2b_contig_2614868 SwRhRL2b_0046.00002820 438
168 3300005289 Ga0065704_10073233 Ga0065704_100732331 438
169 3300009036 Ga0105244_10079558 Ga0105244_100795581 438
170 3300025711 Ga0207696_1000144 Ga0207696_100014437 438
171 3300025728 Ga0207655_1031098 Ga0207655_10310982 438
172 3300025735 Ga0207713_1005012 Ga0207713_10050122 438
173 3300025935 Ga0207709_10011849 Ga0207709_100118493 438
174 3300042013 Ga0439456_000089 Ga0439456_000089_24728_26044 438
175 3300046522 Ga0495643_0008410 Ga0495643_0008410_112_1596 438
176 3300048917 Ga0496114_0004116 Ga0496114_0004116_7625_8941 438
177 3300048920 Ga0496117_0002244 Ga0496117_0002244_5437_6861 438
178 3300048920 Ga0496117_0008345 Ga0496117_0008345_639_2012 438
179 3300048921 Ga0496118_0003309 Ga0496118_0003309_14431_15855 438
180 3300048921 Ga0496118_0010322 Ga0496118_0010322_153_1526 438
181 3300048922 Ga0496119_0074583 Ga0496119_0074583_496_1812 438
182 3300048925 Ga0496122_0004088 Ga0496122_0004088_16839_18212 438
183 3300048926 Ga0496123_0016580 Ga0496123_0016580_3921_5294 438
184 3300048927 Ga0496124_0042687 Ga0496124_0042687_1861_3177 438
185 3300048928 Ga0496125_0002991 Ga0496125_0002991_5234_6658 438

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

169

363

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6jwf-assembly1.cif.gz_A holo form of pyranose dehydrogenase pqq domain from coprinopsis cinerea 0.759 50 432
6i1q-assembly1.cif.gz_A iodide structure of trichoderma reesei carbohydrate-active enzymes family aa12 0.7359 41 434
7cdy-assembly2.cif.gz_B crystal structure of glucose dehydrogenase 0.7341 69 435
7cgz-assembly1.cif.gz_B glucose dehydrogenase 0.7322 69 435
6i1t-assembly1.cif.gz_A calcium structure of trichoderma reesei carbohydrate-active enzymes family aa12 0.7309 41 434
ID Description Score Start End Superfamily
af_A0A0R4IBY0_470_547_2.40.10.480 Mainly Beta;Beta Barrel;Thrombin, subunit H; 0.7332 159 252 2.40.10.480
af_P98163_727_1026_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7321 76 294 2.120.10.30
3s8zA01 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7319 72 394 2.120.10.30
af_Q8K450_481_639_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7314 71 279 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7285 65 433 2.120.10.30
ID Description Score Start End GO Terms
AF-A0A3M5BH66-F1-model_v4 L-sorbosone dehydrogenase 0.9696 127 435
AF-A0A136QLG4-F1-model_v4 deleted 0.9678 217 435
AF-A0A5E7E3X4-F1-model_v4 Glucose/Sorbosone dehydrogenase domain-containing protein 0.9628 1 435
AF-A0A2R7SZ97-F1-model_v4 deleted 0.9627 149 435
AF-A0A528NVY6-F1-model_v4 deleted 0.9614 290 408

Feature Viewer

pLDDT pTM Quality
83.95 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map