F284875

General Info

Members Datasets Scaffolds Average Seq Length
185 108 185 144

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0006339|Ga0495594_0006339_5551_6051
Length 166
Sequence MKYFVSVDGREVEVEVEGDRVRXDGRELTAHLGRVPGTPLRHLLLGDRSVTLALEGGRGHWQVAYHGDRREVEVLDERTRHIRSLTGQAGQAKGLGALKAPMPGLVVRVTVEVGQRVGPGTGLVVLEAMKMENELRAHAEAVVQAVLVRPGQAVEKGEVLIEFANP

Samples

Sample ID Description Type Environment
1 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
2 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
3 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
8 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
9 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
10 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
11 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
18 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
22 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
23 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
39 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
40 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
41 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
42 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
43 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
44 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
45 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
48 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
49 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
50 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
51 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
52 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
55 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
56 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
57 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
58 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
59 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
60 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
61 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
62 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
63 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
66 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
67 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
68 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
71 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
72 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
73 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
74 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
79 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
80 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
81 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
82 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
83 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
84 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
85 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
86 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
87 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
88 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
91 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
92 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
93 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
94 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
95 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
97 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
98 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
99 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
100 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
101 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
102 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
106 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
107 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
108 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.62
Rhizosphere 98.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070677_10064397 3300005333 Archaea 1522
2 Ga0070689_100574034 3300005340 Bacteria 974
3 Ga0070691_10098527 3300005341 Bacteria 1449
4 Ga0070668_100764381 3300005347 Bacteria 856
5 Ga0070708_100101364 3300005445 Bacteria 2636
6 Ga0070708_100608756 3300005445 Bacteria 1030
7 Ga0070707_100016656 3300005468 Bacteria 6899
8 Ga0070699_100202885 3300005518 Bacteria 1764
9 Ga0070697_100219363 3300005536 Bacteria 1621
10 Ga0070697_100611125 3300005536 Bacteria 958
11 Ga0070697_101164753 3300005536 Bacteria 687
12 Ga0070696_101153746 3300005546 Bacteria 653
13 Ga0070704_100487750 3300005549 Bacteria 1067
14 Ga0070664_100120702 3300005564 Bacteria 2295
15 Ga0068864_100262261 3300005618 Bacteria 1608
16 Ga0068861_100663060 3300005719 Bacteria 965
17 Ga0070712_100139993 3300006175 Bacteria 1845
18 Ga0075428_100982216 3300006844 Bacteria 894
19 Ga0075431_100200484 3300006847 Bacteria 2042
20 Ga0075431_100549644 3300006847 Unclassified 1142
21 Ga0075436_100003358 3300006914 Bacteria 10956
22 Ga0075435_100187434 3300007076 Bacteria 1750
23 Ga0075435_100634417 3300007076 Bacteria 927
24 Ga0111539_11588365 3300009094 Bacteria 759
25 Ga0114129_10166236 3300009147 Bacteria 3010
26 Ga0114129_10388770 3300009147 Bacteria 1841
27 Ga0105249_11512275 3300009553 Bacteria 744
28 Ga0157379_10115483 3300014968 Bacteria 2413
29 Ga0207682_10143716 3300025893 Archaea 1072
30 Ga0207699_10239480 3300025906 Bacteria 1246
31 Ga0207684_10440101 3300025910 Bacteria 1119
32 Ga0207707_10002220 3300025912 Bacteria 17547
33 Ga0207660_10073473 3300025917 Bacteria 2493
34 Ga0207652_10014383 3300025921 Bacteria 6411
35 Ga0207646_10041838 3300025922 Bacteria 4117
36 Ga0207659_10738762 3300025926 Bacteria 844
37 Ga0207659_10797670 3300025926 Bacteria 811
38 Ga0207670_10678490 3300025936 Bacteria 851
39 Ga0207661_10673251 3300025944 Bacteria 951
40 Ga0207679_10119358 3300025945 Bacteria 2096
41 Ga0207712_10395104 3300025961 Bacteria 1161
42 Ga0207676_10131966 3300026095 Bacteria 2125
43 Ga0207675_100612469 3300026118 Bacteria 1093
44 Ga0268264_10829829 3300028381 Bacteria 925
45 Ga0307408_100162100 3300031548 Bacteria 1777
46 Ga0307413_10017567 3300031824 Bacteria 3729
47 Ga0307413_10047208 3300031824 Bacteria 2566
48 Ga0307413_10262842 3300031824 Bacteria 1287
49 Ga0307413_11391856 3300031824 Bacteria 617
50 Ga0307410_10005929 3300031852 Bacteria 6534
51 Ga0307410_10073558 3300031852 Bacteria 2377
52 Ga0307410_10215225 3300031852 Bacteria 1475
53 Ga0307410_10493701 3300031852 Bacteria 1006
54 Ga0307410_10575399 3300031852 Bacteria 936
55 Ga0307406_10109486 3300031901 Bacteria 1899
56 Ga0307406_10182080 3300031901 Bacteria 1530
57 Ga0307406_10234792 3300031901 Bacteria 1372
58 Ga0307407_10020430 3300031903 Bacteria 3394
59 Ga0307407_10049780 3300031903 Bacteria 2393
60 Ga0307407_10155576 3300031903 Bacteria 1490
61 Ga0307409_100088713 3300031995 Bacteria 2526
62 Ga0307409_100095465 3300031995 Bacteria 2450
63 Ga0307409_100120720 3300031995 Bacteria 2219
64 Ga0307409_100192694 3300031995 Bacteria 1816
65 Ga0307409_100264738 3300031995 Bacteria 1580
66 Ga0307409_100444702 3300031995 Bacteria 1249
67 Ga0307409_101419186 3300031995 Unclassified 721
68 Ga0307416_100030934 3300032002 Bacteria 4024
69 Ga0307416_100069074 3300032002 Bacteria 2922
70 Ga0307416_100579948 3300032002 Bacteria 1199
71 Ga0307416_100852279 3300032002 Bacteria 1009
72 Ga0307414_10078993 3300032004 Bacteria 2400
73 Ga0307414_10120589 3300032004 Bacteria 2015
74 Ga0307414_10640536 3300032004 Bacteria 957
75 Ga0307411_10004491 3300032005 Bacteria 6692
76 Ga0307411_10019673 3300032005 Bacteria 3906
77 Ga0307411_10140670 3300032005 Bacteria 1779
78 Ga0307411_10422805 3300032005 Bacteria 1107
79 Ga0307411_10435000 3300032005 Bacteria 1093
80 Ga0307411_10501460 3300032005 Bacteria 1026
81 Ga0307411_10669218 3300032005 Bacteria 901
82 Ga0307415_100060666 3300032126 Bacteria 2615
83 Ga0307415_100796790 3300032126 Bacteria 862
84 Ga0307415_100818844 3300032126 Bacteria 851
85 Ga0373951_0017697 3300035091 Bacteria 1614
86 Ga0373931_0045954 3300035691 Bacteria 2307
87 Ga0373931_0345082 3300035691 Bacteria 931
88 Ga0439439_0002283 3300041406 Bacteria 4042
89 Ga0451789_0085355 3300041443 Bacteria 765
90 Ga0451807_1493816 3300041486 Bacteria 2018
91 Ga0439462_0032295 3300042015 Bacteria 1387
92 Ga0450898_009730 3300042134 Bacteria 1542
93 Ga0439446_0060278 3300042156 Bacteria 1146
94 Ga0439434_0338744 3300042435 Bacteria 524
95 Ga0451577_0939186 3300042876 Bacteria 778
96 Ga0453683_0344057 3300044673 Bacteria 957
97 Ga0451576_0303633 3300045051 Bacteria 1670
98 Ga0495594_0006339 3300046499 Bacteria 6084
99 Ga0495594_0408893 3300046499 Bacteria 772
100 Ga0495618_0009589 3300046514 Bacteria 5846
101 Ga0495630_0060577 3300046517 Bacteria 2841
102 Ga0495586_0001882 3300046535 Bacteria 11418
103 Ga0495586_0178860 3300046535 Bacteria 1199
104 Ga0495634_0041778 3300046642 Bacteria 3113
105 Ga0495658_0024044 3300046683 Bacteria 3240
106 Ga0495674_0003864 3300047319 Bacteria 14553
107 Ga0495680_0087918 3300047322 Bacteria 2336
108 Ga0496103_0470887 3300048906 Bacteria 805
109 Ga0501031_0082885 3300049568 Bacteria 2090
110 Ga0501031_0358151 3300049568 Bacteria 944
111 Ga0501033_0094524 3300049570 Bacteria 2186
112 Ga0501033_0202085 3300049570 Bacteria 1419
113 Ga0501034_0001355 3300049571 Bacteria 33121
114 Ga0501034_0059419 3300049571 Bacteria 3840
115 Ga0501034_0185921 3300049571 Bacteria 2041
116 Ga0501036_0132325 3300049572 Bacteria 2105
117 Ga0501037_0016767 3300049573 Bacteria 5390
118 Ga0501038_0062049 3300049574 Bacteria 3195
119 Ga0501040_0100651 3300049576 Bacteria 2015
120 Ga0501041_0644899 3300049577 Bacteria 677
121 Ga0501042_0163882 3300049578 Bacteria 1604
122 Ga0501046_0586752 3300049580 Bacteria 792
123 Ga0501047_0441607 3300049581 Bacteria 1131
124 Ga0501067_0001052 3300049583 Bacteria 14855
125 Ga0501067_0002587 3300049583 Bacteria 9997
126 Ga0501067_0051106 3300049583 Bacteria 2292
127 Ga0501067_0657100 3300049583 Bacteria 589
128 Ga0501068_0000171 3300049584 Bacteria 30356
129 Ga0501068_0011181 3300049584 Bacteria 5058
130 Ga0501068_1122747 3300049584 Bacteria 520
131 Ga0501069_0000098 3300049585 Bacteria 40879
132 Ga0501069_0000278 3300049585 Bacteria 23255
133 Ga0501070_0000192 3300049586 Bacteria 57359
134 Ga0501070_0005766 3300049586 Bacteria 10562
135 Ga0501071_0000060 3300049587 Bacteria 37746
136 Ga0501071_0006621 3300049587 Bacteria 7526
137 Ga0501071_0146652 3300049587 Bacteria 1759
138 Ga0501072_0000081 3300049588 Bacteria 70723
139 Ga0501072_0172389 3300049588 Bacteria 1726
140 Ga0501072_0182288 3300049588 Bacteria 1675
141 Ga0501072_0611122 3300049588 Bacteria 859
142 Ga0501073_0000699 3300049589 Bacteria 23637
143 Ga0501073_0022302 3300049589 Bacteria 4561
144 Ga0501074_0001663 3300049590 Bacteria 15116
145 Ga0501074_0003209 3300049590 Bacteria 11537
146 Ga0501075_0032071 3300049591 Bacteria 3902
147 Ga0501075_0115931 3300049591 Bacteria 2037
148 Ga0501076_0028974 3300049592 Bacteria 4303
149 Ga0501239_069078 3300049672 Bacteria 546
150 Ga0501079_0028743 3300049741 Bacteria 4268
151 Ga0501079_0059873 3300049741 Bacteria 2937
152 Ga0501079_0210011 3300049741 Bacteria 1520
153 Ga0501079_0660611 3300049741 Bacteria 823
154 Ga0501080_0000060 3300049742 Bacteria 71292
155 Ga0501080_0001835 3300049742 Bacteria 18214
156 Ga0501080_0110866 3300049742 Bacteria 2543
157 Ga0501080_0254589 3300049742 Bacteria 1601
158 Ga0501081_0026798 3300049743 Bacteria 3889
159 Ga0501081_0044644 3300049743 Bacteria 3043
160 Ga0501083_0002965 3300049744 Bacteria 11769
161 Ga0501083_0005831 3300049744 Bacteria 8722
162 Ga0501083_0126556 3300049744 Bacteria 1675
163 Ga0501035_0381832 3300049822 Bacteria 1175
164 Ga0501045_0046625 3300049824 Bacteria 3156
165 Ga0501045_0063915 3300049824 Bacteria 2701
166 nmdc:mga0qj67_1153029_c1 3300050509 Bacteria 604
167 nmdc:mga06r32_20412_c1 3300050510 Bacteria 6100
168 nmdc:mga06r32_347780_c1 3300050510 Bacteria 1467
169 nmdc:mga08y16_1226985_c1 3300050511 Bacteria 719
170 nmdc:mga0n895_150400_c1 3300050512 Bacteria 2358
171 nmdc:mga0rr50_334029_c1 3300050513 Bacteria 1272
172 nmdc:mga08x19_120394_c1 3300050514 Bacteria 1759
173 nmdc:mga0a205_71650_c1 3300050515 Bacteria 3347
174 Ga0501084_0005867 3300054114 Bacteria 10106
175 Ga0501084_0050586 3300054114 Bacteria 3477
176 Ga0501084_0089052 3300054114 Bacteria 2590
177 Ga0501084_0588879 3300054114 Bacteria 940
178 Ga0590071_005689 3300059421 Bacteria 2991
179 Ga0590075_006732 3300059424 Bacteria 2722
180 Ga0590077_082454 3300059426 Bacteria 741
181 Ga0501082_0001299 3300060353 Bacteria 21903
182 Ga0501082_0032717 3300060353 Bacteria 4485
183 Ga0501082_0066672 3300060353 Bacteria 3100
184 Ga0501082_0168046 3300060353 Bacteria 1906
185 Ga0501082_0263096 3300060353 Bacteria 1501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049584 Ga0501068_1122747 Ga0501068_1122747_61_501 115
2 3300049568 Ga0501031_0358151 Ga0501031_0358151_119_616 118
3 3300049570 Ga0501033_0202085 Ga0501033_0202085_658_1155 118
4 3300049572 Ga0501036_0132325 Ga0501036_0132325_1033_1530 118
5 3300049576 Ga0501040_0100651 Ga0501040_0100651_1370_1867 118
6 3300049578 Ga0501042_0163882 Ga0501042_0163882_703_1200 118
7 3300049587 Ga0501071_0146652 Ga0501071_0146652_377_874 118
8 3300049588 Ga0501072_0611122 Ga0501072_0611122_244_741 118
9 3300049592 Ga0501076_0028974 Ga0501076_0028974_1274_1771 118
10 3300049741 Ga0501079_0028743 Ga0501079_0028743_3350_3847 118
11 3300049742 Ga0501080_0254589 Ga0501080_0254589_68_565 118
12 3300049744 Ga0501083_0126556 Ga0501083_0126556_303_800 118
13 3300049824 Ga0501045_0063915 Ga0501045_0063915_2083_2580 118
14 3300060353 Ga0501082_0168046 Ga0501082_0168046_483_980 118
15 3300049672 Ga0501239_069078 Ga0501239_069078_15_515 132
16 3300014968 Ga0157379_10115483 Ga0157379_101154834 134
17 3300025926 Ga0207659_10797670 Ga0207659_107976702 134
18 3300005445 Ga0070708_100608756 Ga0070708_1006087562 135
19 3300005518 Ga0070699_100202885 Ga0070699_1002028852 135
20 3300005549 Ga0070704_100487750 Ga0070704_1004877502 135
21 3300025910 Ga0207684_10440101 Ga0207684_104401012 135
22 3300025922 Ga0207646_10041838 Ga0207646_100418383 135
23 3300031995 Ga0307409_101419186 Ga0307409_1014191861 135
24 3300054114 Ga0501084_0588879 Ga0501084_0588879_203_712 135
25 3300059421 Ga0590071_005689 Ga0590071_005689_981_1493 135
26 3300059424 Ga0590075_006732 Ga0590075_006732_1255_1767 135
27 3300005340 Ga0070689_100574034 Ga0070689_1005740342 136
28 3300005445 Ga0070708_100101364 Ga0070708_1001013644 136
29 3300005468 Ga0070707_100016656 Ga0070707_10001665610 136
30 3300005536 Ga0070697_100611125 Ga0070697_1006111251 136
31 3300005536 Ga0070697_101164753 Ga0070697_1011647532 136
32 3300006847 Ga0075431_100549644 Ga0075431_1005496442 136
33 3300025926 Ga0207659_10738762 Ga0207659_107387622 136
34 3300025936 Ga0207670_10678490 Ga0207670_106784901 136
35 3300031824 Ga0307413_10262842 Ga0307413_102628421 136
36 3300031852 Ga0307410_10073558 Ga0307410_100735584 136
37 3300031852 Ga0307410_10493701 Ga0307410_104937012 136
38 3300031852 Ga0307410_10575399 Ga0307410_105753992 136
39 3300031901 Ga0307406_10182080 Ga0307406_101820802 136
40 3300031903 Ga0307407_10155576 Ga0307407_101555761 136
41 3300031995 Ga0307409_100088713 Ga0307409_1000887134 136
42 3300031995 Ga0307409_100264738 Ga0307409_1002647382 136
43 3300031995 Ga0307409_100444702 Ga0307409_1004447022 136
44 3300032002 Ga0307416_100579948 Ga0307416_1005799482 136
45 3300032004 Ga0307414_10078993 Ga0307414_100789932 136
46 3300032004 Ga0307414_10120589 Ga0307414_101205892 136
47 3300032004 Ga0307414_10640536 Ga0307414_106405362 136
48 3300032005 Ga0307411_10140670 Ga0307411_101406702 136
49 3300032005 Ga0307411_10422805 Ga0307411_104228052 136
50 3300032005 Ga0307411_10435000 Ga0307411_104350002 136
51 3300032126 Ga0307415_100818844 Ga0307415_1008188442 136
52 3300035691 Ga0373931_0345082 Ga0373931_0345082_202_708 136
53 3300042134 Ga0450898_009730 Ga0450898_009730_13_525 136
54 3300046499 Ga0495594_0006339 Ga0495594_0006339_5551_6051 136
55 3300046514 Ga0495618_0009589 Ga0495618_0009589_3172_3672 136
56 3300046517 Ga0495630_0060577 Ga0495630_0060577_1439_1939 136
57 3300046535 Ga0495586_0001882 Ga0495586_0001882_10222_10722 136
58 3300046535 Ga0495586_0178860 Ga0495586_0178860_602_1102 136
59 3300046642 Ga0495634_0041778 Ga0495634_0041778_168_668 136
60 3300046683 Ga0495658_0024044 Ga0495658_0024044_402_902 136
61 3300047319 Ga0495674_0003864 Ga0495674_0003864_2029_2529 136
62 3300047322 Ga0495680_0087918 Ga0495680_0087918_132_632 136
63 3300049571 Ga0501034_0059419 Ga0501034_0059419_2194_2700 136
64 3300049580 Ga0501046_0586752 Ga0501046_0586752_161_658 136
65 3300049583 Ga0501067_0002587 Ga0501067_0002587_8467_8973 136
66 3300049583 Ga0501067_0657100 Ga0501067_0657100_50_547 136
67 3300049584 Ga0501068_0000171 Ga0501068_0000171_28803_29309 136
68 3300049585 Ga0501069_0000278 Ga0501069_0000278_1216_1722 136
69 3300049586 Ga0501070_0005766 Ga0501070_0005766_2012_2518 136
70 3300049587 Ga0501071_0006621 Ga0501071_0006621_5926_6432 136
71 3300049588 Ga0501072_0172389 Ga0501072_0172389_11_517 136
72 3300049589 Ga0501073_0000699 Ga0501073_0000699_17044_17550 136
73 3300049590 Ga0501074_0003209 Ga0501074_0003209_1175_1681 136
74 3300049741 Ga0501079_0660611 Ga0501079_0660611_124_630 136
75 3300049742 Ga0501080_0001835 Ga0501080_0001835_1866_2372 136
76 3300049744 Ga0501083_0005831 Ga0501083_0005831_1134_1640 136
77 3300054114 Ga0501084_0089052 Ga0501084_0089052_1132_1638 136
78 3300060353 Ga0501082_0032717 Ga0501082_0032717_1217_1723 136
79 3300060353 Ga0501082_0263096 Ga0501082_0263096_659_1156 136
80 3300005333 Ga0070677_10064397 Ga0070677_100643972 137
81 3300005341 Ga0070691_10098527 Ga0070691_100985272 137
82 3300005347 Ga0070668_100764381 Ga0070668_1007643812 137
83 3300005536 Ga0070697_100219363 Ga0070697_1002193633 137
84 3300005546 Ga0070696_101153746 Ga0070696_1011537461 137
85 3300005564 Ga0070664_100120702 Ga0070664_1001207022 137
86 3300005618 Ga0068864_100262261 Ga0068864_1002622612 137
87 3300005719 Ga0068861_100663060 Ga0068861_1006630602 137
88 3300006175 Ga0070712_100139993 Ga0070712_1001399932 137
89 3300006844 Ga0075428_100982216 Ga0075428_1009822162 137
90 3300006847 Ga0075431_100200484 Ga0075431_1002004842 137
91 3300006914 Ga0075436_100003358 Ga0075436_1000033583 137
92 3300007076 Ga0075435_100187434 Ga0075435_1001874341 137
93 3300007076 Ga0075435_100634417 Ga0075435_1006344172 137
94 3300009094 Ga0111539_11588365 Ga0111539_115883652 137
95 3300009147 Ga0114129_10166236 Ga0114129_101662362 137
96 3300009147 Ga0114129_10388770 Ga0114129_103887703 137
97 3300009553 Ga0105249_11512275 Ga0105249_115122752 137
98 3300025893 Ga0207682_10143716 Ga0207682_101437162 137
99 3300025906 Ga0207699_10239480 Ga0207699_102394802 137
100 3300025912 Ga0207707_10002220 Ga0207707_1000222010 137
101 3300025917 Ga0207660_10073473 Ga0207660_100734732 137
102 3300025921 Ga0207652_10014383 Ga0207652_100143832 137
103 3300025944 Ga0207661_10673251 Ga0207661_106732511 137
104 3300025945 Ga0207679_10119358 Ga0207679_101193582 137
105 3300025961 Ga0207712_10395104 Ga0207712_103951042 137
106 3300026095 Ga0207676_10131966 Ga0207676_101319662 137
107 3300026118 Ga0207675_100612469 Ga0207675_1006124691 137
108 3300028381 Ga0268264_10829829 Ga0268264_108298292 137
109 3300031548 Ga0307408_100162100 Ga0307408_1001621002 137
110 3300031824 Ga0307413_10017567 Ga0307413_100175672 137
111 3300031824 Ga0307413_10047208 Ga0307413_100472084 137
112 3300031824 Ga0307413_11391856 Ga0307413_113918561 137
113 3300031852 Ga0307410_10005929 Ga0307410_100059292 137
114 3300031852 Ga0307410_10215225 Ga0307410_102152252 137
115 3300031901 Ga0307406_10109486 Ga0307406_101094863 137
116 3300031901 Ga0307406_10234792 Ga0307406_102347923 137
117 3300031903 Ga0307407_10020430 Ga0307407_100204305 137
118 3300031903 Ga0307407_10049780 Ga0307407_100497803 137
119 3300031995 Ga0307409_100095465 Ga0307409_1000954651 137
120 3300031995 Ga0307409_100120720 Ga0307409_1001207204 137
121 3300031995 Ga0307409_100192694 Ga0307409_1001926942 137
122 3300032002 Ga0307416_100030934 Ga0307416_1000309344 137
123 3300032002 Ga0307416_100069074 Ga0307416_1000690742 137
124 3300032002 Ga0307416_100852279 Ga0307416_1008522792 137
125 3300032005 Ga0307411_10004491 Ga0307411_100044913 137
126 3300032005 Ga0307411_10019673 Ga0307411_100196735 137
127 3300032005 Ga0307411_10501460 Ga0307411_105014602 137
128 3300032005 Ga0307411_10669218 Ga0307411_106692182 137
129 3300032126 Ga0307415_100060666 Ga0307415_1000606661 137
130 3300032126 Ga0307415_100796790 Ga0307415_1007967902 137
131 3300035091 Ga0373951_0017697 Ga0373951_0017697_862_1359 137
132 3300035691 Ga0373931_0045954 Ga0373931_0045954_791_1288 137
133 3300041406 Ga0439439_0002283 Ga0439439_0002283_1371_1877 137
134 3300041443 Ga0451789_0085355 Ga0451789_0085355_234_755 137
135 3300041486 Ga0451807_1493816 Ga0451807_1493816_478_999 137
136 3300042015 Ga0439462_0032295 Ga0439462_0032295_328_834 137
137 3300042156 Ga0439446_0060278 Ga0439446_0060278_451_975 137
138 3300042435 Ga0439434_0338744 Ga0439434_0338744_10_513 137
139 3300042876 Ga0451577_0939186 Ga0451577_0939186_93_599 137
140 3300044673 Ga0453683_0344057 Ga0453683_0344057_300_800 137
141 3300045051 Ga0451576_0303633 Ga0451576_0303633_454_954 137
142 3300046499 Ga0495594_0408893 Ga0495594_0408893_197_709 137
143 3300048906 Ga0496103_0470887 Ga0496103_0470887_268_765 137
144 3300049568 Ga0501031_0082885 Ga0501031_0082885_1048_1563 137
145 3300049570 Ga0501033_0094524 Ga0501033_0094524_845_1360 137
146 3300049571 Ga0501034_0001355 Ga0501034_0001355_15135_15647 137
147 3300049571 Ga0501034_0185921 Ga0501034_0185921_1156_1662 137
148 3300049573 Ga0501037_0016767 Ga0501037_0016767_4382_4897 137
149 3300049574 Ga0501038_0062049 Ga0501038_0062049_695_1210 137
150 3300049577 Ga0501041_0644899 Ga0501041_0644899_93_590 137
151 3300049581 Ga0501047_0441607 Ga0501047_0441607_351_863 137
152 3300049583 Ga0501067_0001052 Ga0501067_0001052_7933_8445 137
153 3300049583 Ga0501067_0051106 Ga0501067_0051106_60_584 137
154 3300049584 Ga0501068_0011181 Ga0501068_0011181_3314_3826 137
155 3300049585 Ga0501069_0000098 Ga0501069_0000098_8317_8829 137
156 3300049586 Ga0501070_0000192 Ga0501070_0000192_55590_56102 137
157 3300049587 Ga0501071_0000060 Ga0501071_0000060_36080_36592 137
158 3300049588 Ga0501072_0000081 Ga0501072_0000081_36692_37204 137
159 3300049588 Ga0501072_0182288 Ga0501072_0182288_117_632 137
160 3300049589 Ga0501073_0022302 Ga0501073_0022302_1291_1803 137
161 3300049590 Ga0501074_0001663 Ga0501074_0001663_9127_9639 137
162 3300049591 Ga0501075_0032071 Ga0501075_0032071_1027_1542 137
163 3300049591 Ga0501075_0115931 Ga0501075_0115931_1402_1902 137
164 3300049741 Ga0501079_0059873 Ga0501079_0059873_346_846 137
165 3300049741 Ga0501079_0210011 Ga0501079_0210011_58_570 137
166 3300049742 Ga0501080_0000060 Ga0501080_0000060_54146_54658 137
167 3300049742 Ga0501080_0110866 Ga0501080_0110866_1691_2200 137
168 3300049743 Ga0501081_0026798 Ga0501081_0026798_1926_2438 137
169 3300049743 Ga0501081_0044644 Ga0501081_0044644_534_1034 137
170 3300049744 Ga0501083_0002965 Ga0501083_0002965_11200_11712 137
171 3300049822 Ga0501035_0381832 Ga0501035_0381832_291_806 137
172 3300049824 Ga0501045_0046625 Ga0501045_0046625_1382_1897 137
173 3300050509 nmdc:mga0qj67_1153029_c1 nmdc:mga0qj67_1153029_c1_12_518 137
174 3300050510 nmdc:mga06r32_20412_c1 nmdc:mga06r32_20412_c1_4539_5048 137
175 3300050510 nmdc:mga06r32_347780_c1 nmdc:mga06r32_347780_c1_817_1323 137
176 3300050511 nmdc:mga08y16_1226985_c1 nmdc:mga08y16_1226985_c1_113_628 137
177 3300050512 nmdc:mga0n895_150400_c1 nmdc:mga0n895_150400_c1_284_787 137
178 3300050513 nmdc:mga0rr50_334029_c1 nmdc:mga0rr50_334029_c1_362_865 137
179 3300050514 nmdc:mga08x19_120394_c1 nmdc:mga08x19_120394_c1_668_1171 137
180 3300050515 nmdc:mga0a205_71650_c1 nmdc:mga0a205_71650_c1_2561_3058 137
181 3300054114 Ga0501084_0005867 Ga0501084_0005867_1320_1832 137
182 3300054114 Ga0501084_0050586 Ga0501084_0050586_1933_2448 137
183 3300059426 Ga0590077_082454 Ga0590077_082454_142_657 137
184 3300060353 Ga0501082_0001299 Ga0501082_0001299_1277_1789 137
185 3300060353 Ga0501082_0066672 Ga0501082_0066672_1789_2289 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

96

163

0.97

PF18140

PCC_BT

Propionyl-coenzyme A carboxylase BT domain

1

86

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tcb-assembly1.cif.gz_A crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus 0.7806 52 77
7tcb-assembly3.cif.gz_C crystal structure of the yaeq family protein vpa0551 from vibrio parahaemolyticus 0.754 52 78
5csk-assembly1.cif.gz_B crystal structure of yeast acetyl-coa carboxylase, unbiotinylated 0.7375 1 74
5csk-assembly1.cif.gz_A crystal structure of yeast acetyl-coa carboxylase, unbiotinylated 0.7158 1 77
5csa-assembly1.cif.gz_A crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.7056 9 72
ID Description Score Start End Superfamily
af_A0A2R8PV58_477_613_3.30.700.30 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.7959 2 84 3.30.700.30
af_Q91ZA3_508_644_3.30.700.30 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.7819 2 84 3.30.700.30
3n6rA03 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.7789 2 84 3.30.700.30
af_Q553S7_495_639_3.30.700.30 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.7696 2 86 3.30.700.30
af_Q19842_498_642_3.30.700.30 Alpha Beta;2-Layer Sandwich;Glycoprotein, Type 4 Pilin; 0.7426 2 82 3.30.700.30
ID Description Score Start End GO Terms
AF-A0A7V9FJF4-F1-model_v4 Propionyl-coenzyme A carboxylase BT domain-containing protein 0.985 1 78
AF-A0A7V9FJF4-F1-model_v4 Propionyl-coenzyme A carboxylase BT domain-containing protein 0.9607 1 78
AF-A0A3D2SJH7-F1-model_v4 Acetyl-CoA carboxylase biotin carboxyl carrier protein subunit 0.8913 20 78
AF-A0A2V6WBE4-F1-model_v4 Uncharacterized protein 0.874 1 78
AF-A0A7V2RXS1-F1-model_v4 Propionyl-coenzyme A carboxylase BT domain-containing protein 0.8711 1 86

Feature Viewer

pLDDT pTM Quality
79.71 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map