F284552

General Info

Members Datasets Scaffolds Average Seq Length
185 127 185 213

Family's Representative Sequence

Representative Sequence 3300031241|Ga0265325_10111020|Ga0265325_101110202
Length 240
Sequence VIQPPRDCPLCPRLAEFRAANAEAYPDYFNAPVPTFGALDARLLIVGLAPGLHGANRTGRPFTGDWAGDLLYATLLKHGLARGTYDERADDGLTLRECAITNAVRCVPPENKPLPAEIKTCRKFLVAQISAMAHLRAILALGKIAHDSVCDALGAKKSAHPFKHGGAYSLSLTMAGLDPAIHQSAEKLDGRLKAAHGEKRAITLISSYHCSRYNTNTGVLTEAMFDAVVKQAKLAAMPQL

Samples

Sample ID Description Type Environment
1 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
24 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
34 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
56 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
63 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
64 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
79 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
83 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
84 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
91 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
92 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
93 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
94 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
98 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
106 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
107 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
108 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
109 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
110 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
111 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
112 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
113 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
117 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
118 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
123 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
127 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.57
Nodule 0
Rhizoplane 0
Rhizosphere 90.27
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055531_10016409 3300003794 Bacteria 3195
2 Ga0070658_10166128 3300005327 Bacteria 1853
3 Ga0070658_10559082 3300005327 Bacteria 990
4 Ga0070660_100278298 3300005339 Bacteria 1369
5 Ga0070659_100060339 3300005366 Bacteria 2995
6 Ga0070709_10005540 3300005434 Bacteria 6834
7 Ga0070714_100025474 3300005435 Bacteria 4882
8 Ga0070714_100817668 3300005435 Bacteria 903
9 Ga0070713_100000012 3300005436 Bacteria 137708
10 Ga0070710_10082448 3300005437 Bacteria 1880
11 Ga0070711_100463830 3300005439 Bacteria 1039
12 Ga0070681_10091753 3300005458 Bacteria 2987
13 Ga0068853_100000964 3300005539 Bacteria 20234
14 Ga0068853_100678755 3300005539 Bacteria 982
15 Ga0070665_100104935 3300005548 Bacteria 2828
16 Ga0070665_100416933 3300005548 Bacteria 1351
17 Ga0068855_100026640 3300005563 Bacteria 6917
18 Ga0068855_100362196 3300005563 Bacteria 1595
19 Ga0068857_100128519 3300005577 Bacteria 2284
20 Ga0068856_100001151 3300005614 Bacteria 27834
21 Ga0068864_100456401 3300005618 Bacteria 1223
22 Ga0081538_10010800 3300005981 Bacteria 7459
23 Ga0075363_100191704 3300006048 Bacteria 1166
24 Ga0070712_100000098 3300006175 Bacteria 44128
25 Ga0075367_10203729 3300006178 Bacteria 1236
26 Ga0097621_100187110 3300006237 Bacteria 1791
27 Ga0075434_100083446 3300006871 Bacteria 3193
28 Ga0075436_100000416 3300006914 Bacteria 27313
29 Ga0075435_100176716 3300007076 Bacteria 1803
30 Ga0105240_10007938 3300009093 Bacteria 15312
31 Ga0105240_10043302 3300009093 Bacteria 5730
32 Ga0105240_10159139 3300009093 Bacteria 2684
33 Ga0105240_10266930 3300009093 Bacteria 1972
34 Ga0105241_10025069 3300009174 Bacteria 4432
35 Ga0105241_10171834 3300009174 Bacteria 1791
36 Ga0105248_10144689 3300009177 Bacteria 2682
37 Ga0105237_10014555 3300009545 Bacteria 8220
38 Ga0105238_10274186 3300009551 Bacteria 1667
39 Ga0105239_10501710 3300010375 Bacteria 1380
40 Ga0157374_10176959 3300013296 Bacteria 2082
41 Ga0163162_10346726 3300013306 Bacteria 1618
42 Ga0163162_10959644 3300013306 Bacteria 966
43 Ga0209233_1000811 3300025261 Bacteria 13925
44 Ga0209675_1010693 3300025291 Bacteria 3109
45 Ga0209676_1011753 3300025292 Bacteria 3501
46 Ga0209050_1030420 3300025298 Bacteria 1705
47 Ga0207647_10080700 3300025904 Bacteria 1950
48 Ga0207699_10000227 3300025906 Bacteria 32219
49 Ga0207654_10038135 3300025911 Bacteria 2694
50 Ga0207707_10244858 3300025912 Bacteria 1558
51 Ga0207695_10006605 3300025913 Bacteria 14987
52 Ga0207695_10014294 3300025913 Bacteria 9414
53 Ga0207695_10134512 3300025913 Bacteria 2427
54 Ga0207695_10202152 3300025913 Bacteria 1900
55 Ga0207671_10007454 3300025914 Bacteria 9494
56 Ga0207693_10000324 3300025915 Bacteria 44179
57 Ga0207663_10436982 3300025916 Bacteria 1007
58 Ga0207657_10209255 3300025919 Bacteria 1566
59 Ga0207694_10281061 3300025924 Bacteria 1367
60 Ga0207700_10000149 3300025928 Bacteria 41542
61 Ga0207664_10039036 3300025929 Bacteria 3684
62 Ga0207664_10449507 3300025929 Bacteria 1150
63 Ga0207704_10434452 3300025938 Bacteria 1044
64 Ga0207711_10095676 3300025941 Bacteria 2620
65 Ga0207667_10079667 3300025949 Bacteria 3395
66 Ga0207667_10179211 3300025949 Bacteria 2176
67 Ga0207639_10002696 3300026041 Bacteria 11916
68 Ga0207639_10743296 3300026041 Bacteria 912
69 Ga0207702_10002311 3300026078 Bacteria 18241
70 Ga0207648_10508954 3300026089 Bacteria 1102
71 Ga0209813_10081503 3300027866 Bacteria 1071
72 Ga0268266_10000873 3300028379 Bacteria 39154
73 Ga0268266_10276741 3300028379 Bacteria 1559
74 Ga0268266_10653425 3300028379 Bacteria 1012
75 Ga0265338_10080938 3300028800 Bacteria 2726
76 Ga0265338_10225138 3300028800 Bacteria 1398
77 Ga0265330_10257193 3300031235 Bacteria 736
78 Ga0265332_10017769 3300031238 Bacteria 3138
79 Ga0265332_10096491 3300031238 Bacteria 1248
80 Ga0265320_10000670 3300031240 Bacteria 26077
81 Ga0265325_10111020 3300031241 Bacteria 1332
82 Ga0265325_10127524 3300031241 Bacteria 1221
83 Ga0265340_10002681 3300031247 Bacteria 10122
84 Ga0265340_10003335 3300031247 Bacteria 9096
85 Ga0265340_10003522 3300031247 Bacteria 8804
86 Ga0265340_10035181 3300031247 Bacteria 2488
87 Ga0265339_10070747 3300031249 Bacteria 1860
88 Ga0265331_10000129 3300031250 Bacteria 99170
89 Ga0265331_10066972 3300031250 Bacteria 1685
90 Ga0265331_10077824 3300031250 Bacteria 1544
91 Ga0265331_10088047 3300031250 Bacteria 1437
92 Ga0265316_10045030 3300031344 Bacteria 3505
93 Ga0265316_10050543 3300031344 Bacteria 3269
94 Ga0265316_10069739 3300031344 Bacteria 2713
95 Ga0265316_10083593 3300031344 Bacteria 2446
96 Ga0265313_10001478 3300031595 Bacteria 21893
97 Ga0265313_10004469 3300031595 Bacteria 10713
98 Ga0265313_10047708 3300031595 Bacteria 2071
99 Ga0265314_10000635 3300031711 Bacteria 43051
100 Ga0265314_10006199 3300031711 Bacteria 10620
101 Ga0265314_10018336 3300031711 Bacteria 5458
102 Ga0265314_10114794 3300031711 Bacteria 1705
103 Ga0265342_10008888 3300031712 Bacteria 7148
104 Ga0265342_10170792 3300031712 Bacteria 1196
105 Ga0307416_100721064 3300032002 Bacteria 1088
106 Ga0373936_0307088 3300035113 Bacteria 717
107 Ga0373943_0000641 3300035170 Bacteria 15100
108 Ga0373946_0003992 3300035171 Bacteria 5248
109 Ga0373935_0050478 3300035692 Bacteria 2640
110 Ga0373927_0160997 3300035695 Bacteria 1470
111 Ga0373933_0123720 3300035724 Bacteria 1621
112 Ga0373933_0413266 3300035724 Bacteria 881
113 Ga0373947_0038153 3300035725 Bacteria 2853
114 Ga0373937_0071298 3300036401 Bacteria 3204
115 Ga0373925_0017888 3300037068 Bacteria 5144
116 Ga0373925_0170538 3300037068 Bacteria 1718
117 Ga0395899_0079140 3300037312 Bacteria 2394
118 Ga0395900_0045248 3300037418 Bacteria 4533
119 Ga0395898_0242619 3300037466 Bacteria 1718
120 Ga0395901_0008910 3300038443 Bacteria 10162
121 Ga0395901_0210741 3300038443 Bacteria 2034
122 Ga0436365_1111520 3300039437 Bacteria 6835
123 Ga0436362_0447748 3300039453 Bacteria 1192
124 Ga0451577_0240173 3300042876 Bacteria 1639
125 Ga0451576_0000108 3300045051 Bacteria 211233
126 Ga0495580_0005729 3300046472 Bacteria 10210
127 Ga0495658_0001574 3300046683 Bacteria 11903
128 Ga0495613_0127521 3300046689 Bacteria 1824
129 Ga0495602_0265120 3300048088 Bacteria 1272
130 Ga0496121_0139370 3300048924 Bacteria 1802
131 Ga0496126_0056845 3300048929 Bacteria 3535
132 Ga0496126_0144466 3300048929 Bacteria 2045
133 Ga0495682_0214016 3300049460 Bacteria 683
134 Ga0501031_0004459 3300049568 Bacteria 9082
135 Ga0501033_0129532 3300049570 Bacteria 1828
136 Ga0501033_0135388 3300049570 Bacteria 1782
137 Ga0501033_0614069 3300049570 Bacteria 745
138 Ga0501034_0008131 3300049571 Bacteria 11123
139 Ga0501034_0031974 3300049571 Bacteria 5346
140 Ga0501034_0168404 3300049571 Bacteria 2159
141 Ga0501034_0305285 3300049571 Bacteria 1527
142 Ga0501036_0005095 3300049572 Bacteria 10632
143 Ga0501036_0233660 3300049572 Bacteria 1543
144 Ga0501037_0073864 3300049573 Bacteria 2479
145 Ga0501038_0017813 3300049574 Bacteria 6417
146 Ga0501038_0063269 3300049574 Bacteria 3159
147 Ga0501038_0272472 3300049574 Bacteria 1334
148 Ga0501038_0477980 3300049574 Bacteria 955
149 Ga0501046_0018215 3300049580 Bacteria 5848
150 Ga0501046_0036137 3300049580 Bacteria 3977
151 Ga0501047_0003459 3300049581 Bacteria 14920
152 Ga0501047_0027488 3300049581 Bacteria 5481
153 Ga0501048_0006804 3300049582 Bacteria 8684
154 Ga0501067_0002358 3300049583 Bacteria 10461
155 Ga0501069_0008152 3300049585 Bacteria 5503
156 Ga0501070_0044006 3300049586 Bacteria 3715
157 Ga0501072_0338496 3300049588 Bacteria 1195
158 Ga0501073_0031675 3300049589 Bacteria 3773
159 Ga0501073_0045780 3300049589 Bacteria 3081
160 Ga0501074_0002413 3300049590 Bacteria 13023
161 Ga0501075_0217116 3300049591 Bacteria 1459
162 Ga0501076_0484009 3300049592 Bacteria 1020
163 Ga0501079_0001660 3300049741 Bacteria 15834
164 Ga0501080_0010288 3300049742 Bacteria 8553
165 Ga0501080_0300195 3300049742 Bacteria 1457
166 Ga0501080_0373028 3300049742 Bacteria 1286
167 Ga0501080_0485582 3300049742 Bacteria 1105
168 Ga0501083_0092766 3300049744 Bacteria 1993
169 Ga0501035_0014644 3300049822 Bacteria 7241
170 Ga0501035_0022456 3300049822 Bacteria 5794
171 Ga0501044_0037145 3300049823 Bacteria 5092
172 Ga0501044_0068879 3300049823 Bacteria 3603
173 Ga0501045_0063531 3300049824 Bacteria 2710
174 nmdc:mga06z11_169757_c1 3300050494 Bacteria 1252
175 nmdc:mga04h51_147097_c1 3300050495 Bacteria 898
176 nmdc:mga0n895_318181_c1 3300050512 Bacteria 1577
177 nmdc:mga0n895_5260_c1 3300050512 Bacteria 10781
178 nmdc:mga0rr50_86058_c1 3300050513 Bacteria 2437
179 nmdc:mga08x19_177_c1 3300050514 Bacteria 51482
180 Ga0500578_0244955 3300053086 Bacteria 1082
181 Ga0500644_0020571 3300053088 Bacteria 1964
182 Ga0500651_0007372 3300053093 Bacteria 6424
183 Ga0500566_0094770 3300053094 Bacteria 1645
184 Ga0501084_0004597 3300054114 Bacteria 11281
185 Ga0501082_0561215 3300060353 Bacteria 999

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0413266 Ga0373933_0413266_153_734 190
2 3300031247 Ga0265340_10003335 Ga0265340_1000333510 194
3 3300031247 Ga0265340_10035181 Ga0265340_100351813 194
4 3300031250 Ga0265331_10088047 Ga0265331_100880473 194
5 3300031344 Ga0265316_10045030 Ga0265316_100450304 194
6 3300031595 Ga0265313_10047708 Ga0265313_100477083 194
7 3300031712 Ga0265342_10008888 Ga0265342_100088882 194
8 3300035113 Ga0373936_0307088 Ga0373936_0307088_30_626 194
9 3300042876 Ga0451577_0240173 Ga0451577_0240173_941_1528 194
10 3300045051 Ga0451576_0000108 Ga0451576_0000108_206070_206657 194
11 3300009174 Ga0105241_10025069 Ga0105241_100250695 195
12 3300009551 Ga0105238_10274186 Ga0105238_102741863 195
13 3300031711 Ga0265314_10000635 Ga0265314_1000063532 195
14 3300039437 Ga0436365_1111520 Ga0436365_1111520_3803_4402 195
15 3300039453 Ga0436362_0447748 Ga0436362_0447748_279_878 195
16 3300049460 Ga0495682_0214016 Ga0495682_0214016_59_649 195
17 3300049571 Ga0501034_0168404 Ga0501034_0168404_1413_2018 195
18 3300049742 Ga0501080_0373028 Ga0501080_0373028_141_737 195
19 3300053086 Ga0500578_0244955 Ga0500578_0244955_333_923 196
20 3300025291 Ga0209675_1010693 Ga0209675_10106933 200
21 3300025292 Ga0209676_1011753 Ga0209676_10117533 200
22 3300025298 Ga0209050_1030420 Ga0209050_10304201 200
23 3300005434 Ga0070709_10005540 Ga0070709_100055408 207
24 3300005435 Ga0070714_100025474 Ga0070714_1000254743 207
25 3300005436 Ga0070713_100000012 Ga0070713_10000001290 207
26 3300005437 Ga0070710_10082448 Ga0070710_100824482 207
27 3300005614 Ga0068856_100001151 Ga0068856_10000115125 207
28 3300005618 Ga0068864_100456401 Ga0068864_1004564012 207
29 3300006175 Ga0070712_100000098 Ga0070712_10000009825 207
30 3300006914 Ga0075436_100000416 Ga0075436_1000004167 207
31 3300025906 Ga0207699_10000227 Ga0207699_100002279 207
32 3300025915 Ga0207693_10000324 Ga0207693_1000032422 207
33 3300025928 Ga0207700_10000149 Ga0207700_1000014940 207
34 3300025929 Ga0207664_10039036 Ga0207664_100390363 207
35 3300026078 Ga0207702_10002311 Ga0207702_100023117 207
36 3300050512 nmdc:mga0n895_318181_c1 nmdc:mga0n895_318181_c1_912_1544 207
37 3300050514 nmdc:mga08x19_177_c1 nmdc:mga08x19_177_c1_45281_45913 207
38 3300028800 Ga0265338_10080938 Ga0265338_100809383 209
39 3300031240 Ga0265320_10000670 Ga0265320_1000067031 209
40 3300031241 Ga0265325_10111020 Ga0265325_101110202 209
41 3300031241 Ga0265325_10127524 Ga0265325_101275242 209
42 3300031249 Ga0265339_10070747 Ga0265339_100707472 209
43 3300031250 Ga0265331_10077824 Ga0265331_100778243 209
44 3300031711 Ga0265314_10018336 Ga0265314_100183361 209
45 3300031712 Ga0265342_10170792 Ga0265342_101707921 209
46 3300036401 Ga0373937_0071298 Ga0373937_0071298_2111_2749 209
47 3300048088 Ga0495602_0265120 Ga0495602_0265120_505_1143 209
48 3300006871 Ga0075434_100083446 Ga0075434_1000834464 210
49 3300007076 Ga0075435_100176716 Ga0075435_1001767162 210
50 3300009177 Ga0105248_10144689 Ga0105248_101446894 210
51 3300025941 Ga0207711_10095676 Ga0207711_100956763 210
52 3300025949 Ga0207667_10179211 Ga0207667_101792111 210
53 3300031235 Ga0265330_10257193 Ga0265330_102571931 210
54 3300031238 Ga0265332_10017769 Ga0265332_100177694 210
55 3300031247 Ga0265340_10002681 Ga0265340_100026814 210
56 3300031247 Ga0265340_10003522 Ga0265340_100035222 210
57 3300031344 Ga0265316_10069739 Ga0265316_100697392 210
58 3300031344 Ga0265316_10083593 Ga0265316_100835934 210
59 3300050512 nmdc:mga0n895_5260_c1 nmdc:mga0n895_5260_c1_6379_7020 210
60 3300050513 nmdc:mga0rr50_86058_c1 nmdc:mga0rr50_86058_c1_1147_1788 210
61 3300005327 Ga0070658_10166128 Ga0070658_101661282 211
62 3300005327 Ga0070658_10559082 Ga0070658_105590822 211
63 3300005339 Ga0070660_100278298 Ga0070660_1002782982 211
64 3300005366 Ga0070659_100060339 Ga0070659_1000603394 211
65 3300005458 Ga0070681_10091753 Ga0070681_100917532 211
66 3300005539 Ga0068853_100000964 Ga0068853_10000096411 211
67 3300005539 Ga0068853_100678755 Ga0068853_1006787552 211
68 3300005548 Ga0070665_100104935 Ga0070665_1001049353 211
69 3300005548 Ga0070665_100416933 Ga0070665_1004169332 211
70 3300005563 Ga0068855_100026640 Ga0068855_1000266404 211
71 3300005563 Ga0068855_100362196 Ga0068855_1003621963 211
72 3300005577 Ga0068857_100128519 Ga0068857_1001285192 211
73 3300006237 Ga0097621_100187110 Ga0097621_1001871102 211
74 3300009093 Ga0105240_10007938 Ga0105240_100079388 211
75 3300009093 Ga0105240_10043302 Ga0105240_100433026 211
76 3300009093 Ga0105240_10159139 Ga0105240_101591394 211
77 3300009093 Ga0105240_10266930 Ga0105240_102669303 211
78 3300009174 Ga0105241_10171834 Ga0105241_101718343 211
79 3300009545 Ga0105237_10014555 Ga0105237_100145554 211
80 3300010375 Ga0105239_10501710 Ga0105239_105017102 211
81 3300013296 Ga0157374_10176959 Ga0157374_101769592 211
82 3300013306 Ga0163162_10346726 Ga0163162_103467262 211
83 3300013306 Ga0163162_10959644 Ga0163162_109596442 211
84 3300025261 Ga0209233_1000811 Ga0209233_10008115 211
85 3300025911 Ga0207654_10038135 Ga0207654_100381352 211
86 3300025912 Ga0207707_10244858 Ga0207707_102448581 211
87 3300025913 Ga0207695_10006605 Ga0207695_1000660516 211
88 3300025913 Ga0207695_10014294 Ga0207695_100142949 211
89 3300025913 Ga0207695_10134512 Ga0207695_101345122 211
90 3300025913 Ga0207695_10202152 Ga0207695_102021522 211
91 3300025914 Ga0207671_10007454 Ga0207671_100074545 211
92 3300025919 Ga0207657_10209255 Ga0207657_102092552 211
93 3300025924 Ga0207694_10281061 Ga0207694_102810612 211
94 3300025938 Ga0207704_10434452 Ga0207704_104344522 211
95 3300025949 Ga0207667_10079667 Ga0207667_100796674 211
96 3300026041 Ga0207639_10002696 Ga0207639_100026966 211
97 3300026041 Ga0207639_10743296 Ga0207639_107432962 211
98 3300026089 Ga0207648_10508954 Ga0207648_105089541 211
99 3300028379 Ga0268266_10000873 Ga0268266_100008739 211
100 3300028379 Ga0268266_10276741 Ga0268266_102767413 211
101 3300028379 Ga0268266_10653425 Ga0268266_106534252 211
102 3300031238 Ga0265332_10096491 Ga0265332_100964912 211
103 3300031250 Ga0265331_10066972 Ga0265331_100669723 211
104 3300031344 Ga0265316_10050543 Ga0265316_100505433 211
105 3300031595 Ga0265313_10001478 Ga0265313_1000147825 211
106 3300031595 Ga0265313_10004469 Ga0265313_100044699 211
107 3300031711 Ga0265314_10006199 Ga0265314_100061995 211
108 3300038443 Ga0395901_0210741 Ga0395901_0210741_181_825 211
109 3300048924 Ga0496121_0139370 Ga0496121_0139370_1135_1773 211
110 3300048929 Ga0496126_0056845 Ga0496126_0056845_1038_1682 211
111 3300048929 Ga0496126_0144466 Ga0496126_0144466_460_1098 211
112 3300049568 Ga0501031_0004459 Ga0501031_0004459_6649_7311 211
113 3300049570 Ga0501033_0129532 Ga0501033_0129532_55_708 211
114 3300049570 Ga0501033_0135388 Ga0501033_0135388_730_1392 211
115 3300049570 Ga0501033_0614069 Ga0501033_0614069_76_720 211
116 3300049571 Ga0501034_0008131 Ga0501034_0008131_7769_8431 211
117 3300049571 Ga0501034_0305285 Ga0501034_0305285_828_1466 211
118 3300049572 Ga0501036_0005095 Ga0501036_0005095_5345_6007 211
119 3300049573 Ga0501037_0073864 Ga0501037_0073864_229_882 211
120 3300049574 Ga0501038_0017813 Ga0501038_0017813_4310_4972 211
121 3300049574 Ga0501038_0063269 Ga0501038_0063269_325_978 211
122 3300049574 Ga0501038_0272472 Ga0501038_0272472_542_1195 211
123 3300049574 Ga0501038_0477980 Ga0501038_0477980_189_833 211
124 3300049580 Ga0501046_0018215 Ga0501046_0018215_4121_4759 211
125 3300049580 Ga0501046_0036137 Ga0501046_0036137_12_674 211
126 3300049581 Ga0501047_0003459 Ga0501047_0003459_4834_5472 211
127 3300049581 Ga0501047_0027488 Ga0501047_0027488_15_659 211
128 3300049582 Ga0501048_0006804 Ga0501048_0006804_4331_4993 211
129 3300049583 Ga0501067_0002358 Ga0501067_0002358_4715_5377 211
130 3300049585 Ga0501069_0008152 Ga0501069_0008152_783_1445 211
131 3300049586 Ga0501070_0044006 Ga0501070_0044006_1577_2239 211
132 3300049588 Ga0501072_0338496 Ga0501072_0338496_412_1074 211
133 3300049589 Ga0501073_0031675 Ga0501073_0031675_431_1075 211
134 3300049589 Ga0501073_0045780 Ga0501073_0045780_574_1212 211
135 3300049590 Ga0501074_0002413 Ga0501074_0002413_5162_5824 211
136 3300049741 Ga0501079_0001660 Ga0501079_0001660_4375_5037 211
137 3300049742 Ga0501080_0010288 Ga0501080_0010288_5143_5781 211
138 3300049742 Ga0501080_0300195 Ga0501080_0300195_26_670 211
139 3300049742 Ga0501080_0485582 Ga0501080_0485582_378_1031 211
140 3300049744 Ga0501083_0092766 Ga0501083_0092766_209_871 211
141 3300049822 Ga0501035_0014644 Ga0501035_0014644_6570_7214 211
142 3300049822 Ga0501035_0022456 Ga0501035_0022456_4828_5490 211
143 3300049823 Ga0501044_0037145 Ga0501044_0037145_3386_4024 211
144 3300049823 Ga0501044_0068879 Ga0501044_0068879_1983_2636 211
145 3300049824 Ga0501045_0063531 Ga0501045_0063531_205_867 211
146 3300053094 Ga0500566_0094770 Ga0500566_0094770_246_884 211
147 3300054114 Ga0501084_0004597 Ga0501084_0004597_3940_4602 211
148 3300031250 Ga0265331_10000129 Ga0265331_1000012985 212
149 3300031711 Ga0265314_10114794 Ga0265314_101147942 212
150 3300035724 Ga0373933_0123720 Ga0373933_0123720_601_1248 212
151 3300006048 Ga0075363_100191704 Ga0075363_1001917042 213
152 3300006178 Ga0075367_10203729 Ga0075367_102037292 213
153 3300027866 Ga0209813_10081503 Ga0209813_100815032 213
154 3300050494 nmdc:mga06z11_169757_c1 nmdc:mga06z11_169757_c1_123_773 213
155 3300050495 nmdc:mga04h51_147097_c1 nmdc:mga04h51_147097_c1_22_672 213
156 3300005435 Ga0070714_100817668 Ga0070714_1008176681 214
157 3300005439 Ga0070711_100463830 Ga0070711_1004638301 214
158 3300005981 Ga0081538_10010800 Ga0081538_100108002 214
159 3300025916 Ga0207663_10436982 Ga0207663_104369821 214
160 3300025929 Ga0207664_10449507 Ga0207664_104495072 214
161 3300028800 Ga0265338_10225138 Ga0265338_102251382 214
162 3300035170 Ga0373943_0000641 Ga0373943_0000641_14337_14993 214
163 3300035171 Ga0373946_0003992 Ga0373946_0003992_4335_4991 214
164 3300035692 Ga0373935_0050478 Ga0373935_0050478_24_680 214
165 3300035695 Ga0373927_0160997 Ga0373927_0160997_111_767 214
166 3300035725 Ga0373947_0038153 Ga0373947_0038153_1565_2221 214
167 3300037068 Ga0373925_0017888 Ga0373925_0017888_1882_2538 214
168 3300037068 Ga0373925_0170538 Ga0373925_0170538_151_798 214
169 3300046472 Ga0495580_0005729 Ga0495580_0005729_518_1168 214
170 3300046683 Ga0495658_0001574 Ga0495658_0001574_690_1340 214
171 3300046689 Ga0495613_0127521 Ga0495613_0127521_521_1171 214
172 3300049571 Ga0501034_0031974 Ga0501034_0031974_4355_5008 214
173 3300049572 Ga0501036_0233660 Ga0501036_0233660_20_673 214
174 3300049591 Ga0501075_0217116 Ga0501075_0217116_416_1093 214
175 3300049592 Ga0501076_0484009 Ga0501076_0484009_231_908 214
176 3300003794 Ga0055531_10016409 Ga0055531_100164092 215
177 3300025904 Ga0207647_10080700 Ga0207647_100807002 215
178 3300032002 Ga0307416_100721064 Ga0307416_1007210642 215
179 3300037312 Ga0395899_0079140 Ga0395899_0079140_690_1343 215
180 3300037418 Ga0395900_0045248 Ga0395900_0045248_122_775 215
181 3300037466 Ga0395898_0242619 Ga0395898_0242619_187_840 215
182 3300038443 Ga0395901_0008910 Ga0395901_0008910_8050_8703 215
183 3300053088 Ga0500644_0020571 Ga0500644_0020571_1220_1873 215
184 3300053093 Ga0500651_0007372 Ga0500651_0007372_1674_2321 215
185 3300060353 Ga0501082_0561215 Ga0501082_0561215_324_983 215

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

34

233

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.9212 12 215
2dp6-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase in complex with ap:c containing dna 0.8722 12 215
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.8288 12 215
1vk2-assembly1.cif.gz_A crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution 0.8283 12 211
4zbz-assembly1.cif.gz_A family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) 0.7768 12 215
ID Description Score Start End Superfamily
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9105 12 215 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9082 12 215 3.40.470.10
af_P9WM53_47_267_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8624 12 215 3.40.470.10
2d3yA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8599 12 215 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8288 12 215 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A1M3ADW1-F1-model_v4 deleted 0.9866 17 173
AF-A0A520HUK2-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9833 10 138 GO:0006281
GO:0046872
GO:0051539
GO:0097506
AF-A0A257XB46-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9802 8 186 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A2Z5ULC7-F1-model_v4 Type-5 uracil-DNA glycosylase 0.9781 10 212 GO:0004844
GO:0006284
GO:0033958
GO:0046872
GO:0051539
AF-A0A435EQM1-F1-model_v4 Uracil-DNA glycosylase 0.9778 10 136 GO:0006281
GO:0046872
GO:0051539
GO:0097506

Feature Viewer

pLDDT pTM Quality
91.62 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map