F284552
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 185 | 127 | 185 | 213 |
Family's Representative Sequence
| Representative Sequence | 3300031241|Ga0265325_10111020|Ga0265325_101110202 |
| Length | 240 |
| Sequence | VIQPPRDCPLCPRLAEFRAANAEAYPDYFNAPVPTFGALDARLLIVGLAPGLHGANRTGRPFTGDWAGDLLYATLLKHGLARGTYDERADDGLTLRECAITNAVRCVPPENKPLPAEIKTCRKFLVAQISAMAHLRAILALGKIAHDSVCDALGAKKSAHPFKHGGAYSLSLTMAGLDPAIHQSAEKLDGRLKAAHGEKRAITLISSYHCSRYNTNTGVLTEAMFDAVVKQAKLAAMPQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 12 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 14 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 15 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 16 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 17 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 18 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 19 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 21 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 22 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 23 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 24 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 25 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 34 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 35 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 58 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 59 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 60 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 61 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 62 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 63 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 64 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 65 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 66 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 67 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 68 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 69 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 70 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 71 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 72 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 73 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 74 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 75 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 76 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 77 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 79 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 80 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 81 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 82 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 83 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 84 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 85 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 86 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 87 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 92 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 93 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 95 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 96 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 97 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 98 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 99 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 100 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 101 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 102 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 103 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 104 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 105 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 106 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 108 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 109 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 110 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 112 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 118 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 119 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 121 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 122 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 123 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 124 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 125 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 126 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 127 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.57 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 90.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055531_10016409 | 3300003794 | Bacteria | 3195 |
| 2 | Ga0070658_10166128 | 3300005327 | Bacteria | 1853 |
| 3 | Ga0070658_10559082 | 3300005327 | Bacteria | 990 |
| 4 | Ga0070660_100278298 | 3300005339 | Bacteria | 1369 |
| 5 | Ga0070659_100060339 | 3300005366 | Bacteria | 2995 |
| 6 | Ga0070709_10005540 | 3300005434 | Bacteria | 6834 |
| 7 | Ga0070714_100025474 | 3300005435 | Bacteria | 4882 |
| 8 | Ga0070714_100817668 | 3300005435 | Bacteria | 903 |
| 9 | Ga0070713_100000012 | 3300005436 | Bacteria | 137708 |
| 10 | Ga0070710_10082448 | 3300005437 | Bacteria | 1880 |
| 11 | Ga0070711_100463830 | 3300005439 | Bacteria | 1039 |
| 12 | Ga0070681_10091753 | 3300005458 | Bacteria | 2987 |
| 13 | Ga0068853_100000964 | 3300005539 | Bacteria | 20234 |
| 14 | Ga0068853_100678755 | 3300005539 | Bacteria | 982 |
| 15 | Ga0070665_100104935 | 3300005548 | Bacteria | 2828 |
| 16 | Ga0070665_100416933 | 3300005548 | Bacteria | 1351 |
| 17 | Ga0068855_100026640 | 3300005563 | Bacteria | 6917 |
| 18 | Ga0068855_100362196 | 3300005563 | Bacteria | 1595 |
| 19 | Ga0068857_100128519 | 3300005577 | Bacteria | 2284 |
| 20 | Ga0068856_100001151 | 3300005614 | Bacteria | 27834 |
| 21 | Ga0068864_100456401 | 3300005618 | Bacteria | 1223 |
| 22 | Ga0081538_10010800 | 3300005981 | Bacteria | 7459 |
| 23 | Ga0075363_100191704 | 3300006048 | Bacteria | 1166 |
| 24 | Ga0070712_100000098 | 3300006175 | Bacteria | 44128 |
| 25 | Ga0075367_10203729 | 3300006178 | Bacteria | 1236 |
| 26 | Ga0097621_100187110 | 3300006237 | Bacteria | 1791 |
| 27 | Ga0075434_100083446 | 3300006871 | Bacteria | 3193 |
| 28 | Ga0075436_100000416 | 3300006914 | Bacteria | 27313 |
| 29 | Ga0075435_100176716 | 3300007076 | Bacteria | 1803 |
| 30 | Ga0105240_10007938 | 3300009093 | Bacteria | 15312 |
| 31 | Ga0105240_10043302 | 3300009093 | Bacteria | 5730 |
| 32 | Ga0105240_10159139 | 3300009093 | Bacteria | 2684 |
| 33 | Ga0105240_10266930 | 3300009093 | Bacteria | 1972 |
| 34 | Ga0105241_10025069 | 3300009174 | Bacteria | 4432 |
| 35 | Ga0105241_10171834 | 3300009174 | Bacteria | 1791 |
| 36 | Ga0105248_10144689 | 3300009177 | Bacteria | 2682 |
| 37 | Ga0105237_10014555 | 3300009545 | Bacteria | 8220 |
| 38 | Ga0105238_10274186 | 3300009551 | Bacteria | 1667 |
| 39 | Ga0105239_10501710 | 3300010375 | Bacteria | 1380 |
| 40 | Ga0157374_10176959 | 3300013296 | Bacteria | 2082 |
| 41 | Ga0163162_10346726 | 3300013306 | Bacteria | 1618 |
| 42 | Ga0163162_10959644 | 3300013306 | Bacteria | 966 |
| 43 | Ga0209233_1000811 | 3300025261 | Bacteria | 13925 |
| 44 | Ga0209675_1010693 | 3300025291 | Bacteria | 3109 |
| 45 | Ga0209676_1011753 | 3300025292 | Bacteria | 3501 |
| 46 | Ga0209050_1030420 | 3300025298 | Bacteria | 1705 |
| 47 | Ga0207647_10080700 | 3300025904 | Bacteria | 1950 |
| 48 | Ga0207699_10000227 | 3300025906 | Bacteria | 32219 |
| 49 | Ga0207654_10038135 | 3300025911 | Bacteria | 2694 |
| 50 | Ga0207707_10244858 | 3300025912 | Bacteria | 1558 |
| 51 | Ga0207695_10006605 | 3300025913 | Bacteria | 14987 |
| 52 | Ga0207695_10014294 | 3300025913 | Bacteria | 9414 |
| 53 | Ga0207695_10134512 | 3300025913 | Bacteria | 2427 |
| 54 | Ga0207695_10202152 | 3300025913 | Bacteria | 1900 |
| 55 | Ga0207671_10007454 | 3300025914 | Bacteria | 9494 |
| 56 | Ga0207693_10000324 | 3300025915 | Bacteria | 44179 |
| 57 | Ga0207663_10436982 | 3300025916 | Bacteria | 1007 |
| 58 | Ga0207657_10209255 | 3300025919 | Bacteria | 1566 |
| 59 | Ga0207694_10281061 | 3300025924 | Bacteria | 1367 |
| 60 | Ga0207700_10000149 | 3300025928 | Bacteria | 41542 |
| 61 | Ga0207664_10039036 | 3300025929 | Bacteria | 3684 |
| 62 | Ga0207664_10449507 | 3300025929 | Bacteria | 1150 |
| 63 | Ga0207704_10434452 | 3300025938 | Bacteria | 1044 |
| 64 | Ga0207711_10095676 | 3300025941 | Bacteria | 2620 |
| 65 | Ga0207667_10079667 | 3300025949 | Bacteria | 3395 |
| 66 | Ga0207667_10179211 | 3300025949 | Bacteria | 2176 |
| 67 | Ga0207639_10002696 | 3300026041 | Bacteria | 11916 |
| 68 | Ga0207639_10743296 | 3300026041 | Bacteria | 912 |
| 69 | Ga0207702_10002311 | 3300026078 | Bacteria | 18241 |
| 70 | Ga0207648_10508954 | 3300026089 | Bacteria | 1102 |
| 71 | Ga0209813_10081503 | 3300027866 | Bacteria | 1071 |
| 72 | Ga0268266_10000873 | 3300028379 | Bacteria | 39154 |
| 73 | Ga0268266_10276741 | 3300028379 | Bacteria | 1559 |
| 74 | Ga0268266_10653425 | 3300028379 | Bacteria | 1012 |
| 75 | Ga0265338_10080938 | 3300028800 | Bacteria | 2726 |
| 76 | Ga0265338_10225138 | 3300028800 | Bacteria | 1398 |
| 77 | Ga0265330_10257193 | 3300031235 | Bacteria | 736 |
| 78 | Ga0265332_10017769 | 3300031238 | Bacteria | 3138 |
| 79 | Ga0265332_10096491 | 3300031238 | Bacteria | 1248 |
| 80 | Ga0265320_10000670 | 3300031240 | Bacteria | 26077 |
| 81 | Ga0265325_10111020 | 3300031241 | Bacteria | 1332 |
| 82 | Ga0265325_10127524 | 3300031241 | Bacteria | 1221 |
| 83 | Ga0265340_10002681 | 3300031247 | Bacteria | 10122 |
| 84 | Ga0265340_10003335 | 3300031247 | Bacteria | 9096 |
| 85 | Ga0265340_10003522 | 3300031247 | Bacteria | 8804 |
| 86 | Ga0265340_10035181 | 3300031247 | Bacteria | 2488 |
| 87 | Ga0265339_10070747 | 3300031249 | Bacteria | 1860 |
| 88 | Ga0265331_10000129 | 3300031250 | Bacteria | 99170 |
| 89 | Ga0265331_10066972 | 3300031250 | Bacteria | 1685 |
| 90 | Ga0265331_10077824 | 3300031250 | Bacteria | 1544 |
| 91 | Ga0265331_10088047 | 3300031250 | Bacteria | 1437 |
| 92 | Ga0265316_10045030 | 3300031344 | Bacteria | 3505 |
| 93 | Ga0265316_10050543 | 3300031344 | Bacteria | 3269 |
| 94 | Ga0265316_10069739 | 3300031344 | Bacteria | 2713 |
| 95 | Ga0265316_10083593 | 3300031344 | Bacteria | 2446 |
| 96 | Ga0265313_10001478 | 3300031595 | Bacteria | 21893 |
| 97 | Ga0265313_10004469 | 3300031595 | Bacteria | 10713 |
| 98 | Ga0265313_10047708 | 3300031595 | Bacteria | 2071 |
| 99 | Ga0265314_10000635 | 3300031711 | Bacteria | 43051 |
| 100 | Ga0265314_10006199 | 3300031711 | Bacteria | 10620 |
| 101 | Ga0265314_10018336 | 3300031711 | Bacteria | 5458 |
| 102 | Ga0265314_10114794 | 3300031711 | Bacteria | 1705 |
| 103 | Ga0265342_10008888 | 3300031712 | Bacteria | 7148 |
| 104 | Ga0265342_10170792 | 3300031712 | Bacteria | 1196 |
| 105 | Ga0307416_100721064 | 3300032002 | Bacteria | 1088 |
| 106 | Ga0373936_0307088 | 3300035113 | Bacteria | 717 |
| 107 | Ga0373943_0000641 | 3300035170 | Bacteria | 15100 |
| 108 | Ga0373946_0003992 | 3300035171 | Bacteria | 5248 |
| 109 | Ga0373935_0050478 | 3300035692 | Bacteria | 2640 |
| 110 | Ga0373927_0160997 | 3300035695 | Bacteria | 1470 |
| 111 | Ga0373933_0123720 | 3300035724 | Bacteria | 1621 |
| 112 | Ga0373933_0413266 | 3300035724 | Bacteria | 881 |
| 113 | Ga0373947_0038153 | 3300035725 | Bacteria | 2853 |
| 114 | Ga0373937_0071298 | 3300036401 | Bacteria | 3204 |
| 115 | Ga0373925_0017888 | 3300037068 | Bacteria | 5144 |
| 116 | Ga0373925_0170538 | 3300037068 | Bacteria | 1718 |
| 117 | Ga0395899_0079140 | 3300037312 | Bacteria | 2394 |
| 118 | Ga0395900_0045248 | 3300037418 | Bacteria | 4533 |
| 119 | Ga0395898_0242619 | 3300037466 | Bacteria | 1718 |
| 120 | Ga0395901_0008910 | 3300038443 | Bacteria | 10162 |
| 121 | Ga0395901_0210741 | 3300038443 | Bacteria | 2034 |
| 122 | Ga0436365_1111520 | 3300039437 | Bacteria | 6835 |
| 123 | Ga0436362_0447748 | 3300039453 | Bacteria | 1192 |
| 124 | Ga0451577_0240173 | 3300042876 | Bacteria | 1639 |
| 125 | Ga0451576_0000108 | 3300045051 | Bacteria | 211233 |
| 126 | Ga0495580_0005729 | 3300046472 | Bacteria | 10210 |
| 127 | Ga0495658_0001574 | 3300046683 | Bacteria | 11903 |
| 128 | Ga0495613_0127521 | 3300046689 | Bacteria | 1824 |
| 129 | Ga0495602_0265120 | 3300048088 | Bacteria | 1272 |
| 130 | Ga0496121_0139370 | 3300048924 | Bacteria | 1802 |
| 131 | Ga0496126_0056845 | 3300048929 | Bacteria | 3535 |
| 132 | Ga0496126_0144466 | 3300048929 | Bacteria | 2045 |
| 133 | Ga0495682_0214016 | 3300049460 | Bacteria | 683 |
| 134 | Ga0501031_0004459 | 3300049568 | Bacteria | 9082 |
| 135 | Ga0501033_0129532 | 3300049570 | Bacteria | 1828 |
| 136 | Ga0501033_0135388 | 3300049570 | Bacteria | 1782 |
| 137 | Ga0501033_0614069 | 3300049570 | Bacteria | 745 |
| 138 | Ga0501034_0008131 | 3300049571 | Bacteria | 11123 |
| 139 | Ga0501034_0031974 | 3300049571 | Bacteria | 5346 |
| 140 | Ga0501034_0168404 | 3300049571 | Bacteria | 2159 |
| 141 | Ga0501034_0305285 | 3300049571 | Bacteria | 1527 |
| 142 | Ga0501036_0005095 | 3300049572 | Bacteria | 10632 |
| 143 | Ga0501036_0233660 | 3300049572 | Bacteria | 1543 |
| 144 | Ga0501037_0073864 | 3300049573 | Bacteria | 2479 |
| 145 | Ga0501038_0017813 | 3300049574 | Bacteria | 6417 |
| 146 | Ga0501038_0063269 | 3300049574 | Bacteria | 3159 |
| 147 | Ga0501038_0272472 | 3300049574 | Bacteria | 1334 |
| 148 | Ga0501038_0477980 | 3300049574 | Bacteria | 955 |
| 149 | Ga0501046_0018215 | 3300049580 | Bacteria | 5848 |
| 150 | Ga0501046_0036137 | 3300049580 | Bacteria | 3977 |
| 151 | Ga0501047_0003459 | 3300049581 | Bacteria | 14920 |
| 152 | Ga0501047_0027488 | 3300049581 | Bacteria | 5481 |
| 153 | Ga0501048_0006804 | 3300049582 | Bacteria | 8684 |
| 154 | Ga0501067_0002358 | 3300049583 | Bacteria | 10461 |
| 155 | Ga0501069_0008152 | 3300049585 | Bacteria | 5503 |
| 156 | Ga0501070_0044006 | 3300049586 | Bacteria | 3715 |
| 157 | Ga0501072_0338496 | 3300049588 | Bacteria | 1195 |
| 158 | Ga0501073_0031675 | 3300049589 | Bacteria | 3773 |
| 159 | Ga0501073_0045780 | 3300049589 | Bacteria | 3081 |
| 160 | Ga0501074_0002413 | 3300049590 | Bacteria | 13023 |
| 161 | Ga0501075_0217116 | 3300049591 | Bacteria | 1459 |
| 162 | Ga0501076_0484009 | 3300049592 | Bacteria | 1020 |
| 163 | Ga0501079_0001660 | 3300049741 | Bacteria | 15834 |
| 164 | Ga0501080_0010288 | 3300049742 | Bacteria | 8553 |
| 165 | Ga0501080_0300195 | 3300049742 | Bacteria | 1457 |
| 166 | Ga0501080_0373028 | 3300049742 | Bacteria | 1286 |
| 167 | Ga0501080_0485582 | 3300049742 | Bacteria | 1105 |
| 168 | Ga0501083_0092766 | 3300049744 | Bacteria | 1993 |
| 169 | Ga0501035_0014644 | 3300049822 | Bacteria | 7241 |
| 170 | Ga0501035_0022456 | 3300049822 | Bacteria | 5794 |
| 171 | Ga0501044_0037145 | 3300049823 | Bacteria | 5092 |
| 172 | Ga0501044_0068879 | 3300049823 | Bacteria | 3603 |
| 173 | Ga0501045_0063531 | 3300049824 | Bacteria | 2710 |
| 174 | nmdc:mga06z11_169757_c1 | 3300050494 | Bacteria | 1252 |
| 175 | nmdc:mga04h51_147097_c1 | 3300050495 | Bacteria | 898 |
| 176 | nmdc:mga0n895_318181_c1 | 3300050512 | Bacteria | 1577 |
| 177 | nmdc:mga0n895_5260_c1 | 3300050512 | Bacteria | 10781 |
| 178 | nmdc:mga0rr50_86058_c1 | 3300050513 | Bacteria | 2437 |
| 179 | nmdc:mga08x19_177_c1 | 3300050514 | Bacteria | 51482 |
| 180 | Ga0500578_0244955 | 3300053086 | Bacteria | 1082 |
| 181 | Ga0500644_0020571 | 3300053088 | Bacteria | 1964 |
| 182 | Ga0500651_0007372 | 3300053093 | Bacteria | 6424 |
| 183 | Ga0500566_0094770 | 3300053094 | Bacteria | 1645 |
| 184 | Ga0501084_0004597 | 3300054114 | Bacteria | 11281 |
| 185 | Ga0501082_0561215 | 3300060353 | Bacteria | 999 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035724 | Ga0373933_0413266 | Ga0373933_0413266_153_734 | 190 |
| 2 | 3300031247 | Ga0265340_10003335 | Ga0265340_1000333510 | 194 |
| 3 | 3300031247 | Ga0265340_10035181 | Ga0265340_100351813 | 194 |
| 4 | 3300031250 | Ga0265331_10088047 | Ga0265331_100880473 | 194 |
| 5 | 3300031344 | Ga0265316_10045030 | Ga0265316_100450304 | 194 |
| 6 | 3300031595 | Ga0265313_10047708 | Ga0265313_100477083 | 194 |
| 7 | 3300031712 | Ga0265342_10008888 | Ga0265342_100088882 | 194 |
| 8 | 3300035113 | Ga0373936_0307088 | Ga0373936_0307088_30_626 | 194 |
| 9 | 3300042876 | Ga0451577_0240173 | Ga0451577_0240173_941_1528 | 194 |
| 10 | 3300045051 | Ga0451576_0000108 | Ga0451576_0000108_206070_206657 | 194 |
| 11 | 3300009174 | Ga0105241_10025069 | Ga0105241_100250695 | 195 |
| 12 | 3300009551 | Ga0105238_10274186 | Ga0105238_102741863 | 195 |
| 13 | 3300031711 | Ga0265314_10000635 | Ga0265314_1000063532 | 195 |
| 14 | 3300039437 | Ga0436365_1111520 | Ga0436365_1111520_3803_4402 | 195 |
| 15 | 3300039453 | Ga0436362_0447748 | Ga0436362_0447748_279_878 | 195 |
| 16 | 3300049460 | Ga0495682_0214016 | Ga0495682_0214016_59_649 | 195 |
| 17 | 3300049571 | Ga0501034_0168404 | Ga0501034_0168404_1413_2018 | 195 |
| 18 | 3300049742 | Ga0501080_0373028 | Ga0501080_0373028_141_737 | 195 |
| 19 | 3300053086 | Ga0500578_0244955 | Ga0500578_0244955_333_923 | 196 |
| 20 | 3300025291 | Ga0209675_1010693 | Ga0209675_10106933 | 200 |
| 21 | 3300025292 | Ga0209676_1011753 | Ga0209676_10117533 | 200 |
| 22 | 3300025298 | Ga0209050_1030420 | Ga0209050_10304201 | 200 |
| 23 | 3300005434 | Ga0070709_10005540 | Ga0070709_100055408 | 207 |
| 24 | 3300005435 | Ga0070714_100025474 | Ga0070714_1000254743 | 207 |
| 25 | 3300005436 | Ga0070713_100000012 | Ga0070713_10000001290 | 207 |
| 26 | 3300005437 | Ga0070710_10082448 | Ga0070710_100824482 | 207 |
| 27 | 3300005614 | Ga0068856_100001151 | Ga0068856_10000115125 | 207 |
| 28 | 3300005618 | Ga0068864_100456401 | Ga0068864_1004564012 | 207 |
| 29 | 3300006175 | Ga0070712_100000098 | Ga0070712_10000009825 | 207 |
| 30 | 3300006914 | Ga0075436_100000416 | Ga0075436_1000004167 | 207 |
| 31 | 3300025906 | Ga0207699_10000227 | Ga0207699_100002279 | 207 |
| 32 | 3300025915 | Ga0207693_10000324 | Ga0207693_1000032422 | 207 |
| 33 | 3300025928 | Ga0207700_10000149 | Ga0207700_1000014940 | 207 |
| 34 | 3300025929 | Ga0207664_10039036 | Ga0207664_100390363 | 207 |
| 35 | 3300026078 | Ga0207702_10002311 | Ga0207702_100023117 | 207 |
| 36 | 3300050512 | nmdc:mga0n895_318181_c1 | nmdc:mga0n895_318181_c1_912_1544 | 207 |
| 37 | 3300050514 | nmdc:mga08x19_177_c1 | nmdc:mga08x19_177_c1_45281_45913 | 207 |
| 38 | 3300028800 | Ga0265338_10080938 | Ga0265338_100809383 | 209 |
| 39 | 3300031240 | Ga0265320_10000670 | Ga0265320_1000067031 | 209 |
| 40 | 3300031241 | Ga0265325_10111020 | Ga0265325_101110202 | 209 |
| 41 | 3300031241 | Ga0265325_10127524 | Ga0265325_101275242 | 209 |
| 42 | 3300031249 | Ga0265339_10070747 | Ga0265339_100707472 | 209 |
| 43 | 3300031250 | Ga0265331_10077824 | Ga0265331_100778243 | 209 |
| 44 | 3300031711 | Ga0265314_10018336 | Ga0265314_100183361 | 209 |
| 45 | 3300031712 | Ga0265342_10170792 | Ga0265342_101707921 | 209 |
| 46 | 3300036401 | Ga0373937_0071298 | Ga0373937_0071298_2111_2749 | 209 |
| 47 | 3300048088 | Ga0495602_0265120 | Ga0495602_0265120_505_1143 | 209 |
| 48 | 3300006871 | Ga0075434_100083446 | Ga0075434_1000834464 | 210 |
| 49 | 3300007076 | Ga0075435_100176716 | Ga0075435_1001767162 | 210 |
| 50 | 3300009177 | Ga0105248_10144689 | Ga0105248_101446894 | 210 |
| 51 | 3300025941 | Ga0207711_10095676 | Ga0207711_100956763 | 210 |
| 52 | 3300025949 | Ga0207667_10179211 | Ga0207667_101792111 | 210 |
| 53 | 3300031235 | Ga0265330_10257193 | Ga0265330_102571931 | 210 |
| 54 | 3300031238 | Ga0265332_10017769 | Ga0265332_100177694 | 210 |
| 55 | 3300031247 | Ga0265340_10002681 | Ga0265340_100026814 | 210 |
| 56 | 3300031247 | Ga0265340_10003522 | Ga0265340_100035222 | 210 |
| 57 | 3300031344 | Ga0265316_10069739 | Ga0265316_100697392 | 210 |
| 58 | 3300031344 | Ga0265316_10083593 | Ga0265316_100835934 | 210 |
| 59 | 3300050512 | nmdc:mga0n895_5260_c1 | nmdc:mga0n895_5260_c1_6379_7020 | 210 |
| 60 | 3300050513 | nmdc:mga0rr50_86058_c1 | nmdc:mga0rr50_86058_c1_1147_1788 | 210 |
| 61 | 3300005327 | Ga0070658_10166128 | Ga0070658_101661282 | 211 |
| 62 | 3300005327 | Ga0070658_10559082 | Ga0070658_105590822 | 211 |
| 63 | 3300005339 | Ga0070660_100278298 | Ga0070660_1002782982 | 211 |
| 64 | 3300005366 | Ga0070659_100060339 | Ga0070659_1000603394 | 211 |
| 65 | 3300005458 | Ga0070681_10091753 | Ga0070681_100917532 | 211 |
| 66 | 3300005539 | Ga0068853_100000964 | Ga0068853_10000096411 | 211 |
| 67 | 3300005539 | Ga0068853_100678755 | Ga0068853_1006787552 | 211 |
| 68 | 3300005548 | Ga0070665_100104935 | Ga0070665_1001049353 | 211 |
| 69 | 3300005548 | Ga0070665_100416933 | Ga0070665_1004169332 | 211 |
| 70 | 3300005563 | Ga0068855_100026640 | Ga0068855_1000266404 | 211 |
| 71 | 3300005563 | Ga0068855_100362196 | Ga0068855_1003621963 | 211 |
| 72 | 3300005577 | Ga0068857_100128519 | Ga0068857_1001285192 | 211 |
| 73 | 3300006237 | Ga0097621_100187110 | Ga0097621_1001871102 | 211 |
| 74 | 3300009093 | Ga0105240_10007938 | Ga0105240_100079388 | 211 |
| 75 | 3300009093 | Ga0105240_10043302 | Ga0105240_100433026 | 211 |
| 76 | 3300009093 | Ga0105240_10159139 | Ga0105240_101591394 | 211 |
| 77 | 3300009093 | Ga0105240_10266930 | Ga0105240_102669303 | 211 |
| 78 | 3300009174 | Ga0105241_10171834 | Ga0105241_101718343 | 211 |
| 79 | 3300009545 | Ga0105237_10014555 | Ga0105237_100145554 | 211 |
| 80 | 3300010375 | Ga0105239_10501710 | Ga0105239_105017102 | 211 |
| 81 | 3300013296 | Ga0157374_10176959 | Ga0157374_101769592 | 211 |
| 82 | 3300013306 | Ga0163162_10346726 | Ga0163162_103467262 | 211 |
| 83 | 3300013306 | Ga0163162_10959644 | Ga0163162_109596442 | 211 |
| 84 | 3300025261 | Ga0209233_1000811 | Ga0209233_10008115 | 211 |
| 85 | 3300025911 | Ga0207654_10038135 | Ga0207654_100381352 | 211 |
| 86 | 3300025912 | Ga0207707_10244858 | Ga0207707_102448581 | 211 |
| 87 | 3300025913 | Ga0207695_10006605 | Ga0207695_1000660516 | 211 |
| 88 | 3300025913 | Ga0207695_10014294 | Ga0207695_100142949 | 211 |
| 89 | 3300025913 | Ga0207695_10134512 | Ga0207695_101345122 | 211 |
| 90 | 3300025913 | Ga0207695_10202152 | Ga0207695_102021522 | 211 |
| 91 | 3300025914 | Ga0207671_10007454 | Ga0207671_100074545 | 211 |
| 92 | 3300025919 | Ga0207657_10209255 | Ga0207657_102092552 | 211 |
| 93 | 3300025924 | Ga0207694_10281061 | Ga0207694_102810612 | 211 |
| 94 | 3300025938 | Ga0207704_10434452 | Ga0207704_104344522 | 211 |
| 95 | 3300025949 | Ga0207667_10079667 | Ga0207667_100796674 | 211 |
| 96 | 3300026041 | Ga0207639_10002696 | Ga0207639_100026966 | 211 |
| 97 | 3300026041 | Ga0207639_10743296 | Ga0207639_107432962 | 211 |
| 98 | 3300026089 | Ga0207648_10508954 | Ga0207648_105089541 | 211 |
| 99 | 3300028379 | Ga0268266_10000873 | Ga0268266_100008739 | 211 |
| 100 | 3300028379 | Ga0268266_10276741 | Ga0268266_102767413 | 211 |
| 101 | 3300028379 | Ga0268266_10653425 | Ga0268266_106534252 | 211 |
| 102 | 3300031238 | Ga0265332_10096491 | Ga0265332_100964912 | 211 |
| 103 | 3300031250 | Ga0265331_10066972 | Ga0265331_100669723 | 211 |
| 104 | 3300031344 | Ga0265316_10050543 | Ga0265316_100505433 | 211 |
| 105 | 3300031595 | Ga0265313_10001478 | Ga0265313_1000147825 | 211 |
| 106 | 3300031595 | Ga0265313_10004469 | Ga0265313_100044699 | 211 |
| 107 | 3300031711 | Ga0265314_10006199 | Ga0265314_100061995 | 211 |
| 108 | 3300038443 | Ga0395901_0210741 | Ga0395901_0210741_181_825 | 211 |
| 109 | 3300048924 | Ga0496121_0139370 | Ga0496121_0139370_1135_1773 | 211 |
| 110 | 3300048929 | Ga0496126_0056845 | Ga0496126_0056845_1038_1682 | 211 |
| 111 | 3300048929 | Ga0496126_0144466 | Ga0496126_0144466_460_1098 | 211 |
| 112 | 3300049568 | Ga0501031_0004459 | Ga0501031_0004459_6649_7311 | 211 |
| 113 | 3300049570 | Ga0501033_0129532 | Ga0501033_0129532_55_708 | 211 |
| 114 | 3300049570 | Ga0501033_0135388 | Ga0501033_0135388_730_1392 | 211 |
| 115 | 3300049570 | Ga0501033_0614069 | Ga0501033_0614069_76_720 | 211 |
| 116 | 3300049571 | Ga0501034_0008131 | Ga0501034_0008131_7769_8431 | 211 |
| 117 | 3300049571 | Ga0501034_0305285 | Ga0501034_0305285_828_1466 | 211 |
| 118 | 3300049572 | Ga0501036_0005095 | Ga0501036_0005095_5345_6007 | 211 |
| 119 | 3300049573 | Ga0501037_0073864 | Ga0501037_0073864_229_882 | 211 |
| 120 | 3300049574 | Ga0501038_0017813 | Ga0501038_0017813_4310_4972 | 211 |
| 121 | 3300049574 | Ga0501038_0063269 | Ga0501038_0063269_325_978 | 211 |
| 122 | 3300049574 | Ga0501038_0272472 | Ga0501038_0272472_542_1195 | 211 |
| 123 | 3300049574 | Ga0501038_0477980 | Ga0501038_0477980_189_833 | 211 |
| 124 | 3300049580 | Ga0501046_0018215 | Ga0501046_0018215_4121_4759 | 211 |
| 125 | 3300049580 | Ga0501046_0036137 | Ga0501046_0036137_12_674 | 211 |
| 126 | 3300049581 | Ga0501047_0003459 | Ga0501047_0003459_4834_5472 | 211 |
| 127 | 3300049581 | Ga0501047_0027488 | Ga0501047_0027488_15_659 | 211 |
| 128 | 3300049582 | Ga0501048_0006804 | Ga0501048_0006804_4331_4993 | 211 |
| 129 | 3300049583 | Ga0501067_0002358 | Ga0501067_0002358_4715_5377 | 211 |
| 130 | 3300049585 | Ga0501069_0008152 | Ga0501069_0008152_783_1445 | 211 |
| 131 | 3300049586 | Ga0501070_0044006 | Ga0501070_0044006_1577_2239 | 211 |
| 132 | 3300049588 | Ga0501072_0338496 | Ga0501072_0338496_412_1074 | 211 |
| 133 | 3300049589 | Ga0501073_0031675 | Ga0501073_0031675_431_1075 | 211 |
| 134 | 3300049589 | Ga0501073_0045780 | Ga0501073_0045780_574_1212 | 211 |
| 135 | 3300049590 | Ga0501074_0002413 | Ga0501074_0002413_5162_5824 | 211 |
| 136 | 3300049741 | Ga0501079_0001660 | Ga0501079_0001660_4375_5037 | 211 |
| 137 | 3300049742 | Ga0501080_0010288 | Ga0501080_0010288_5143_5781 | 211 |
| 138 | 3300049742 | Ga0501080_0300195 | Ga0501080_0300195_26_670 | 211 |
| 139 | 3300049742 | Ga0501080_0485582 | Ga0501080_0485582_378_1031 | 211 |
| 140 | 3300049744 | Ga0501083_0092766 | Ga0501083_0092766_209_871 | 211 |
| 141 | 3300049822 | Ga0501035_0014644 | Ga0501035_0014644_6570_7214 | 211 |
| 142 | 3300049822 | Ga0501035_0022456 | Ga0501035_0022456_4828_5490 | 211 |
| 143 | 3300049823 | Ga0501044_0037145 | Ga0501044_0037145_3386_4024 | 211 |
| 144 | 3300049823 | Ga0501044_0068879 | Ga0501044_0068879_1983_2636 | 211 |
| 145 | 3300049824 | Ga0501045_0063531 | Ga0501045_0063531_205_867 | 211 |
| 146 | 3300053094 | Ga0500566_0094770 | Ga0500566_0094770_246_884 | 211 |
| 147 | 3300054114 | Ga0501084_0004597 | Ga0501084_0004597_3940_4602 | 211 |
| 148 | 3300031250 | Ga0265331_10000129 | Ga0265331_1000012985 | 212 |
| 149 | 3300031711 | Ga0265314_10114794 | Ga0265314_101147942 | 212 |
| 150 | 3300035724 | Ga0373933_0123720 | Ga0373933_0123720_601_1248 | 212 |
| 151 | 3300006048 | Ga0075363_100191704 | Ga0075363_1001917042 | 213 |
| 152 | 3300006178 | Ga0075367_10203729 | Ga0075367_102037292 | 213 |
| 153 | 3300027866 | Ga0209813_10081503 | Ga0209813_100815032 | 213 |
| 154 | 3300050494 | nmdc:mga06z11_169757_c1 | nmdc:mga06z11_169757_c1_123_773 | 213 |
| 155 | 3300050495 | nmdc:mga04h51_147097_c1 | nmdc:mga04h51_147097_c1_22_672 | 213 |
| 156 | 3300005435 | Ga0070714_100817668 | Ga0070714_1008176681 | 214 |
| 157 | 3300005439 | Ga0070711_100463830 | Ga0070711_1004638301 | 214 |
| 158 | 3300005981 | Ga0081538_10010800 | Ga0081538_100108002 | 214 |
| 159 | 3300025916 | Ga0207663_10436982 | Ga0207663_104369821 | 214 |
| 160 | 3300025929 | Ga0207664_10449507 | Ga0207664_104495072 | 214 |
| 161 | 3300028800 | Ga0265338_10225138 | Ga0265338_102251382 | 214 |
| 162 | 3300035170 | Ga0373943_0000641 | Ga0373943_0000641_14337_14993 | 214 |
| 163 | 3300035171 | Ga0373946_0003992 | Ga0373946_0003992_4335_4991 | 214 |
| 164 | 3300035692 | Ga0373935_0050478 | Ga0373935_0050478_24_680 | 214 |
| 165 | 3300035695 | Ga0373927_0160997 | Ga0373927_0160997_111_767 | 214 |
| 166 | 3300035725 | Ga0373947_0038153 | Ga0373947_0038153_1565_2221 | 214 |
| 167 | 3300037068 | Ga0373925_0017888 | Ga0373925_0017888_1882_2538 | 214 |
| 168 | 3300037068 | Ga0373925_0170538 | Ga0373925_0170538_151_798 | 214 |
| 169 | 3300046472 | Ga0495580_0005729 | Ga0495580_0005729_518_1168 | 214 |
| 170 | 3300046683 | Ga0495658_0001574 | Ga0495658_0001574_690_1340 | 214 |
| 171 | 3300046689 | Ga0495613_0127521 | Ga0495613_0127521_521_1171 | 214 |
| 172 | 3300049571 | Ga0501034_0031974 | Ga0501034_0031974_4355_5008 | 214 |
| 173 | 3300049572 | Ga0501036_0233660 | Ga0501036_0233660_20_673 | 214 |
| 174 | 3300049591 | Ga0501075_0217116 | Ga0501075_0217116_416_1093 | 214 |
| 175 | 3300049592 | Ga0501076_0484009 | Ga0501076_0484009_231_908 | 214 |
| 176 | 3300003794 | Ga0055531_10016409 | Ga0055531_100164092 | 215 |
| 177 | 3300025904 | Ga0207647_10080700 | Ga0207647_100807002 | 215 |
| 178 | 3300032002 | Ga0307416_100721064 | Ga0307416_1007210642 | 215 |
| 179 | 3300037312 | Ga0395899_0079140 | Ga0395899_0079140_690_1343 | 215 |
| 180 | 3300037418 | Ga0395900_0045248 | Ga0395900_0045248_122_775 | 215 |
| 181 | 3300037466 | Ga0395898_0242619 | Ga0395898_0242619_187_840 | 215 |
| 182 | 3300038443 | Ga0395901_0008910 | Ga0395901_0008910_8050_8703 | 215 |
| 183 | 3300053088 | Ga0500644_0020571 | Ga0500644_0020571_1220_1873 | 215 |
| 184 | 3300053093 | Ga0500651_0007372 | Ga0500651_0007372_1674_2321 | 215 |
| 185 | 3300060353 | Ga0501082_0561215 | Ga0501082_0561215_324_983 | 215 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.9212 | 12 | 215 |
| 2dp6-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase in complex with ap:c containing dna | 0.8722 | 12 | 215 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.8288 | 12 | 215 |
| 1vk2-assembly1.cif.gz_A | crystal structure of uracil-dna glycosylase (tm0511) from thermotoga maritima at 1.90 a resolution | 0.8283 | 12 | 211 |
| 4zbz-assembly1.cif.gz_A | family 4 uracil-dna glycosylase from sulfolobus tokodaii (free form, x-ray wavelength=1.5418) | 0.7768 | 12 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9105 | 12 | 215 | 3.40.470.10 |
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9082 | 12 | 215 | 3.40.470.10 |
| af_P9WM53_47_267_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8624 | 12 | 215 | 3.40.470.10 |
| 2d3yA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8599 | 12 | 215 | 3.40.470.10 |
| 4zbzA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8288 | 12 | 215 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1M3ADW1-F1-model_v4 | deleted | 0.9866 | 17 | 173 |
|
| AF-A0A520HUK2-F1-model_v4 | Uracil-DNA glycosylase-like domain-containing protein | 0.9833 | 10 | 138 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
| AF-A0A257XB46-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9802 | 8 | 186 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A2Z5ULC7-F1-model_v4 | Type-5 uracil-DNA glycosylase | 0.9781 | 10 | 212 |
GO:0004844
GO:0006284 GO:0033958 GO:0046872 GO:0051539 |
| AF-A0A435EQM1-F1-model_v4 | Uracil-DNA glycosylase | 0.9778 | 10 | 136 |
GO:0006281
GO:0046872 GO:0051539 GO:0097506 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar