F284536

General Info

Members Datasets Scaffolds Average Seq Length
185 148 370 249

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10044286|Ga0265338_100442862
Length 283
Sequence MAGRRPDLAKTSLRRVSDPLHDFARSTFTHDGKTRDVYELGEGPAVIVMAEIPGITPNVAAFARRVVDQGCTVVLPHLFGEPGAPVSVPGALRSMVPACVSKEFAAFAANRTAPVTVWLRALAADAHERCGGPGVGAVGMCFTGGFALAMMVDERLIAPVLSQPSLPIGLTDKARRGLQLSDADLARVKARTADGVCVLGLRFTGDPVVRAERFERLRQELGDNFIGVEIDSSKGNPWGFPRNAHSVLTEHLVDEPGNPTHDALNQVLDFFRQRLVEPTPAAD

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
21 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
22 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
25 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
71 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
78 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
79 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
80 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
81 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
82 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
83 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
88 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
89 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
94 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
104 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
113 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
114 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
122 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
130 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
131 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
132 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
133 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
134 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
137 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
140 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
141 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
142 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 2643221641 Nocardioides sp. Root122 Isolate Unclassified
146 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
147 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
148 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.84
Metatranscriptomes 0
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 0.54
Rhizoplane 9.73
Rhizosphere 74.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10044286 3300028800 Bacteria 4112
2 JGI24738J21930_10011713 3300002075 Bacteria 1924
3 Ga0070683_100145956 3300005329 Bacteria 2242
4 Ga0070683_100202192 3300005329 Bacteria 1886
5 Ga0070683_100327575 3300005329 Bacteria 1458
6 Ga0068869_100497553 3300005334 Bacteria 1017
7 Ga0070660_100363846 3300005339 Bacteria 1192
8 Ga0070659_100046511 3300005366 Bacteria 3401
9 Ga0070667_100083018 3300005367 Bacteria 2744
10 Ga0070703_10100111 3300005406 Bacteria 1020
11 Ga0070700_100000558 3300005441 Bacteria 18695
12 Ga0070700_100241367 3300005441 Bacteria 1291
13 Ga0070694_100627872 3300005444 Bacteria 868
14 Ga0070678_100259793 3300005456 Bacteria 1460
15 Ga0070662_100266804 3300005457 Bacteria 1381
16 Ga0070698_100361209 3300005471 Bacteria 1384
17 Ga0070684_100058709 3300005535 Bacteria 3362
18 Ga0068853_100412694 3300005539 Bacteria 1265
19 Ga0070672_100081373 3300005543 Bacteria 2596
20 Ga0070693_100047565 3300005547 Bacteria 2441
21 Ga0068852_100160569 3300005616 Bacteria 2098
22 Ga0068852_100310553 3300005616 Bacteria 1529
23 Ga0068864_100532602 3300005618 Bacteria 1134
24 Ga0068866_10017165 3300005718 Bacteria 3251
25 Ga0068861_100046029 3300005719 Bacteria 3288
26 Ga0068870_10017500 3300005840 Bacteria 3444
27 Ga0075365_10008128 3300006038 Bacteria 5927
28 Ga0075365_10059773 3300006038 Bacteria 2541
29 Ga0075365_10175836 3300006038 Bacteria 1495
30 Ga0075368_10023079 3300006042 Bacteria 2373
31 Ga0075368_10037444 3300006042 Bacteria 1897
32 Ga0075363_100006559 3300006048 Bacteria 5300
33 Ga0075363_100054067 3300006048 Bacteria 2148
34 Ga0075364_10095083 3300006051 Bacteria 1980
35 Ga0075367_10049083 3300006178 Bacteria 2487
36 Ga0075367_10222650 3300006178 Bacteria 1181
37 Ga0075370_10018985 3300006353 Bacteria 3735
38 Ga0075428_100000700 3300006844 Bacteria 34626
39 Ga0075430_100002828 3300006846 Bacteria 14520
40 Ga0075430_100011303 3300006846 Bacteria 7571
41 Ga0075431_100012310 3300006847 Bacteria 8631
42 Ga0075431_100088427 3300006847 Bacteria 3197
43 Ga0075429_100002519 3300006880 Bacteria 15433
44 Ga0075429_100009116 3300006880 Bacteria 8612
45 Ga0068865_100137424 3300006881 Bacteria 1838
46 Ga0111539_10063576 3300009094 Bacteria 4367
47 Ga0105245_10142190 3300009098 Bacteria 2261
48 Ga0114129_10000084 3300009147 Bacteria 87485
49 Ga0114129_10114600 3300009147 Bacteria 3717
50 Ga0105248_10810804 3300009177 Bacteria 1056
51 Ga0105238_10185261 3300009551 Bacteria 2058
52 Ga0105249_10176598 3300009553 Bacteria 2075
53 Ga0105239_10081011 3300010375 Bacteria 3573
54 Ga0105239_10137833 3300010375 Bacteria 2717
55 Ga0105246_10012870 3300011119 Bacteria 5233
56 Ga0157371_10121551 3300013102 Bacteria 1857
57 Ga0157372_10047434 3300013307 Bacteria 4774
58 Ga0157380_10010995 3300014326 Bacteria 6527
59 Ga0182008_10141882 3300014497 Bacteria 1202
60 Ga0157377_10035015 3300014745 Bacteria 2751
61 Ga0157379_10625808 3300014968 Bacteria 1006
62 Ga0207688_10032137 3300025901 Bacteria 2899
63 Ga0207643_10001500 3300025908 Bacteria 13363
64 Ga0207705_10282079 3300025909 Bacteria 1272
65 Ga0207662_10214993 3300025918 Bacteria 1249
66 Ga0207657_10161102 3300025919 Bacteria 1822
67 Ga0207657_10257142 3300025919 Bacteria 1390
68 Ga0207694_10489775 3300025924 Bacteria 1029
69 Ga0207706_10287866 3300025933 Bacteria 1432
70 Ga0207691_10014090 3300025940 Bacteria 7628
71 Ga0207711_10034783 3300025941 Bacteria 4267
72 Ga0207689_10201078 3300025942 Bacteria 1644
73 Ga0207661_10035364 3300025944 Bacteria 3892
74 Ga0207661_10307750 3300025944 Bacteria 1422
75 Ga0207712_10110461 3300025961 Bacteria 2061
76 Ga0207640_10125411 3300025981 Bacteria 1847
77 Ga0207658_10094203 3300025986 Bacteria 2330
78 Ga0207677_10388684 3300026023 Bacteria 1180
79 Ga0207708_10001200 3300026075 Bacteria 19550
80 Ga0207708_10052220 3300026075 Bacteria 3114
81 Ga0207648_10057505 3300026089 Bacteria 3393
82 Ga0207676_10101712 3300026095 Bacteria 2384
83 Ga0207675_100005418 3300026118 Bacteria 12223
84 Ga0207675_100780556 3300026118 Bacteria 968
85 Ga0207683_10263461 3300026121 Bacteria 1574
86 Ga0207698_10110038 3300026142 Bacteria 2307
87 Ga0207428_10066584 3300027907 Bacteria 2838
88 Ga0307413_10323717 3300031824 Bacteria 1179
89 Ga0307412_10361449 3300031911 Bacteria 1169
90 Ga0307409_100023874 3300031995 Bacteria 4249
91 Ga0307409_100147957 3300031995 Bacteria 2034
92 Ga0307416_100081700 3300032002 Bacteria 2734
93 Ga0307416_100427998 3300032002 Bacteria 1370
94 Ga0307415_100314979 3300032126 Bacteria 1302
95 Ga0373933_0098363 3300035724 Bacteria 1813
96 Ga0373937_0014913 3300036401 Bacteria 6864
97 Ga0451793_1845512 3300041452 Bacteria 1064
98 Ga0451797_1163350 3300041453 Bacteria 1784
99 Ga0451851_0756315 3300041507 Bacteria 1091
100 Ga0451843_0831057 3300041509 Bacteria 1057
101 Ga0451855_0249800 3300041511 Bacteria 738
102 Ga0451577_0002372 3300042876 Bacteria 22597
103 Ga0466972_0029344 3300044658 Bacteria 2708
104 Ga0466961_0135267 3300044693 Bacteria 1544
105 Ga0453684_0016550 3300044712 Bacteria 11516
106 Ga0466960_0004579 3300044901 Bacteria 5423
107 Ga0495641_0158506 3300046461 Bacteria 1012
108 Ga0495651_0013161 3300046462 Bacteria 6394
109 Ga0495653_0122056 3300046463 Bacteria 1855
110 Ga0495608_0092267 3300046511 Bacteria 1957
111 Ga0495628_0281140 3300046516 Bacteria 1236
112 Ga0495652_0153113 3300046529 Bacteria 1799
113 Ga0495587_0033882 3300046536 Bacteria 3081
114 Ga0495667_0023756 3300046559 Bacteria 4129
115 Ga0495635_0279122 3300046663 Bacteria 1122
116 Ga0495657_0188008 3300046675 Bacteria 1263
117 Ga0495623_0012621 3300046679 Bacteria 5468
118 Ga0495600_0001223 3300046809 Bacteria 14068
119 Ga0495604_0036043 3300047317 Bacteria 3902
120 Ga0495672_0000625 3300047320 Bacteria 39556
121 Ga0495680_0002236 3300047322 Bacteria 19955
122 Ga0495675_0025862 3300047444 Bacteria 3741
123 Ga0495602_0056595 3300048088 Bacteria 3447
124 Ga0496100_0238758 3300048903 Bacteria 1340
125 Ga0496102_0143465 3300048905 Bacteria 2240
126 Ga0496102_0321488 3300048905 Bacteria 1458
127 Ga0496104_0417057 3300048907 Bacteria 1255
128 Ga0496104_0853781 3300048907 Bacteria 816
129 Ga0496106_0200788 3300048909 Bacteria 1587
130 Ga0496108_0644251 3300048911 Bacteria 921
131 Ga0496108_0653822 3300048911 Bacteria 914
132 Ga0496109_0236209 3300048912 Bacteria 1720
133 Ga0496110_0115702 3300048913 Bacteria 2414
134 Ga0496110_0238913 3300048913 Bacteria 1653
135 Ga0496112_0891258 3300048915 Bacteria 812
136 Ga0496114_0085287 3300048917 Bacteria 2675
137 Ga0496114_0125279 3300048917 Bacteria 2214
138 Ga0496114_0182489 3300048917 Bacteria 1833
139 Ga0496115_0134731 3300048918 Bacteria 2037
140 Ga0501031_0021905 3300049568 Bacteria 4164
141 Ga0501033_0383977 3300049570 Bacteria 981
142 Ga0501034_0160340 3300049571 Bacteria 2221
143 Ga0501039_0203410 3300049575 Bacteria 1557
144 Ga0501040_0248930 3300049576 Bacteria 1267
145 Ga0501040_0292019 3300049576 Bacteria 1165
146 Ga0501041_0605215 3300049577 Bacteria 700
147 Ga0501048_0169749 3300049582 Bacteria 1545
148 Ga0501067_0064086 3300049583 Bacteria 2035
149 Ga0501068_0229543 3300049584 Bacteria 1180
150 Ga0501070_0261794 3300049586 Bacteria 1413
151 Ga0501070_0387583 3300049586 Bacteria 1131
152 Ga0501072_0668829 3300049588 Bacteria 817
153 Ga0501075_0467501 3300049591 Bacteria 962
154 Ga0501076_0223358 3300049592 Bacteria 1539
155 Ga0501035_0385862 3300049822 Bacteria 1168
156 Ga0501045_0117803 3300049824 Bacteria 1971
157 Ga0501045_0169479 3300049824 Bacteria 1626
158 Ga0501212_021180 3300049851 Bacteria 1007
159 nmdc:mga03n38_29912_c1 3300050490 Bacteria 2284
160 nmdc:mga03n38_81089_c1 3300050490 Bacteria 1525
161 nmdc:mga00v17_27001_c1 3300050491 Bacteria 3349
162 nmdc:mga00v17_275337_c1 3300050491 Bacteria 1092
163 nmdc:mga0yw44_210987_c1 3300050492 Bacteria 1285
164 nmdc:mga0yw44_259534_c1 3300050492 Bacteria 1158
165 nmdc:mga0yw44_271451_c1 3300050492 Bacteria 1132
166 nmdc:mga0yw44_9805_c1 3300050492 Bacteria 4864
167 nmdc:mga06z11_129965_c1 3300050494 Bacteria 1413
168 nmdc:mga07m45_33283_c1 3300050496 Bacteria 2862
169 nmdc:mga05p37_50313_c1 3300050507 Bacteria 5124
170 nmdc:mga05p37_678_c1 3300050507 Bacteria 37695
171 nmdc:mga09592_3_c1 3300050508 Bacteria 144376
172 nmdc:mga09592_744_c1 3300050508 Bacteria 25085
173 nmdc:mga0qj67_17_c1 3300050509 Bacteria 121673
174 nmdc:mga0qj67_8267_c1 3300050509 Bacteria 7714
175 nmdc:mga06r32_7147_c1 3300050510 Bacteria 10061
176 nmdc:mga08y16_29546_c1 3300050511 Bacteria 5774
177 Ga0495601_0348124 3300053077 Bacteria 964
178 Ga0495595_0003956 3300053084 Bacteria 5921
179 Ga0495619_0039267 3300053085 Bacteria 3090
180 Ga0500573_0099712 3300053140 Bacteria 1635
181 Ga0500616_0037782 3300053153 Bacteria 2612
182 2644232173 2643221641 Bacteria 4490190
183 2855387009 2855386786 Bacteria 4752232
184 2857482237 2857481737 Bacteria 4761446
185 8054612881 8054609563 Bacteria 5170090
186 Ga0265338_10044286
187 JGI24738J21930_10011713
188 Ga0070683_100145956
189 Ga0070683_100202192
190 Ga0070683_100327575
191 Ga0068869_100497553
192 Ga0070660_100363846
193 Ga0070659_100046511
194 Ga0070667_100083018
195 Ga0070703_10100111
196 Ga0070700_100000558
197 Ga0070700_100241367
198 Ga0070694_100627872
199 Ga0070678_100259793
200 Ga0070662_100266804
201 Ga0070698_100361209
202 Ga0070684_100058709
203 Ga0068853_100412694
204 Ga0070672_100081373
205 Ga0070693_100047565
206 Ga0068852_100160569
207 Ga0068852_100310553
208 Ga0068864_100532602
209 Ga0068866_10017165
210 Ga0068861_100046029
211 Ga0068870_10017500
212 Ga0075365_10008128
213 Ga0075365_10059773
214 Ga0075365_10175836
215 Ga0075368_10023079
216 Ga0075368_10037444
217 Ga0075363_100006559
218 Ga0075363_100054067
219 Ga0075364_10095083
220 Ga0075367_10049083
221 Ga0075367_10222650
222 Ga0075370_10018985
223 Ga0075428_100000700
224 Ga0075430_100002828
225 Ga0075430_100011303
226 Ga0075431_100012310
227 Ga0075431_100088427
228 Ga0075429_100002519
229 Ga0075429_100009116
230 Ga0068865_100137424
231 Ga0111539_10063576
232 Ga0105245_10142190
233 Ga0114129_10000084
234 Ga0114129_10114600
235 Ga0105248_10810804
236 Ga0105238_10185261
237 Ga0105249_10176598
238 Ga0105239_10081011
239 Ga0105239_10137833
240 Ga0105246_10012870
241 Ga0157371_10121551
242 Ga0157372_10047434
243 Ga0157380_10010995
244 Ga0182008_10141882
245 Ga0157377_10035015
246 Ga0157379_10625808
247 Ga0207688_10032137
248 Ga0207643_10001500
249 Ga0207705_10282079
250 Ga0207662_10214993
251 Ga0207657_10161102
252 Ga0207657_10257142
253 Ga0207694_10489775
254 Ga0207706_10287866
255 Ga0207691_10014090
256 Ga0207711_10034783
257 Ga0207689_10201078
258 Ga0207661_10035364
259 Ga0207661_10307750
260 Ga0207712_10110461
261 Ga0207640_10125411
262 Ga0207658_10094203
263 Ga0207677_10388684
264 Ga0207708_10001200
265 Ga0207708_10052220
266 Ga0207648_10057505
267 Ga0207676_10101712
268 Ga0207675_100005418
269 Ga0207675_100780556
270 Ga0207683_10263461
271 Ga0207698_10110038
272 Ga0207428_10066584
273 Ga0307413_10323717
274 Ga0307412_10361449
275 Ga0307409_100023874
276 Ga0307409_100147957
277 Ga0307416_100081700
278 Ga0307416_100427998
279 Ga0307415_100314979
280 Ga0373933_0098363
281 Ga0373937_0014913
282 Ga0451793_1845512
283 Ga0451797_1163350
284 Ga0451851_0756315
285 Ga0451843_0831057
286 Ga0451855_0249800
287 Ga0451577_0002372
288 Ga0466972_0029344
289 Ga0466961_0135267
290 Ga0453684_0016550
291 Ga0466960_0004579
292 Ga0495641_0158506
293 Ga0495651_0013161
294 Ga0495653_0122056
295 Ga0495608_0092267
296 Ga0495628_0281140
297 Ga0495652_0153113
298 Ga0495587_0033882
299 Ga0495667_0023756
300 Ga0495635_0279122
301 Ga0495657_0188008
302 Ga0495623_0012621
303 Ga0495600_0001223
304 Ga0495604_0036043
305 Ga0495672_0000625
306 Ga0495680_0002236
307 Ga0495675_0025862
308 Ga0495602_0056595
309 Ga0496100_0238758
310 Ga0496102_0143465
311 Ga0496102_0321488
312 Ga0496104_0417057
313 Ga0496104_0853781
314 Ga0496106_0200788
315 Ga0496108_0644251
316 Ga0496108_0653822
317 Ga0496109_0236209
318 Ga0496110_0115702
319 Ga0496110_0238913
320 Ga0496112_0891258
321 Ga0496114_0085287
322 Ga0496114_0125279
323 Ga0496114_0182489
324 Ga0496115_0134731
325 Ga0501031_0021905
326 Ga0501033_0383977
327 Ga0501034_0160340
328 Ga0501039_0203410
329 Ga0501040_0248930
330 Ga0501040_0292019
331 Ga0501041_0605215
332 Ga0501048_0169749
333 Ga0501067_0064086
334 Ga0501068_0229543
335 Ga0501070_0261794
336 Ga0501070_0387583
337 Ga0501072_0668829
338 Ga0501075_0467501
339 Ga0501076_0223358
340 Ga0501035_0385862
341 Ga0501045_0117803
342 Ga0501045_0169479
343 Ga0501212_021180
344 nmdc:mga03n38_29912_c1
345 nmdc:mga03n38_81089_c1
346 nmdc:mga00v17_27001_c1
347 nmdc:mga00v17_275337_c1
348 nmdc:mga0yw44_210987_c1
349 nmdc:mga0yw44_259534_c1
350 nmdc:mga0yw44_271451_c1
351 nmdc:mga0yw44_9805_c1
352 nmdc:mga06z11_129965_c1
353 nmdc:mga07m45_33283_c1
354 nmdc:mga05p37_50313_c1
355 nmdc:mga05p37_678_c1
356 nmdc:mga09592_3_c1
357 nmdc:mga09592_744_c1
358 nmdc:mga0qj67_17_c1
359 nmdc:mga0qj67_8267_c1
360 nmdc:mga06r32_7147_c1
361 nmdc:mga08y16_29546_c1
362 Ga0495601_0348124
363 Ga0495595_0003956
364 Ga0495619_0039267
365 Ga0500573_0099712
366 Ga0500616_0037782
367 2644232173
368 2855387009
369 2857482237
370 8054612881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

36

275

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.7537 7 241
2o2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (yp_324580.1) from anabaena variabilis atcc 29413 at 1.92 a resolution 0.7381 7 241
8g3d-assembly1.cif.gz_3D 48-nm doublet microtubule from tetrahymena thermophila strain k40r 0.7377 18 241
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.7269 5 238
1ggv-assembly1.cif.gz_A crystal structure of the c123s mutant of dienelactone hydrolase (dlh) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf) 0.7157 5 239
ID Description Score Start End Superfamily
2o2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7555 7 241 3.40.50.1820
2o2gA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7398 7 241 3.40.50.1820
af_B4FY74_55_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.722 19 239 3.40.50.1820
af_I1K6A2_1_89_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.721 179 214 3.40.50.1820
af_A0A0R0FIM6_28_181_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7199 21 206 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A3D0S6S4-F1-model_v4 Dienelactone hydrolase 0.9939 125 243 GO:0016787
AF-A0A0Q7C3P8-F1-model_v4 Dienelactone hydrolase 0.9876 1 244 GO:0016787
AF-A0A1V1VZF8-F1-model_v4 ATP-dependent helicase HrpB 0.985 1 242 GO:0003676
GO:0004386
GO:0005524
GO:0016787
AF-A0A1G9WGH6-F1-model_v4 Dienelactone hydrolase family protein 0.9841 1 240 GO:0016787
AF-A0A0Q7C3P8-F1-model_v4 Dienelactone hydrolase 0.9836 1 244 GO:0016787

Map