F284535

General Info

Members Datasets Scaffolds Average Seq Length
185 126 185 206

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10039821|Ga0265338_100398213
Length 247
Sequence VHLGGKFQACAFVQVGPTIRGAWQHCNFRAPRDAALDSPRGFRNNRRVKQSIVTLDLEGVLTPEIWIAVAEKTGIKELRLTTREVPDYDVLMKGRLKILDAHKLTLSDIQAVIATLGPLPGALEFLRTLRGFTQVIILSDTFEQFAQPLMRQLEWPTLLCHRLVVENDRIVNYQLRQSDQKRKATAALKNLNYQVIAAGDSYNDTAMLIEADHGFLFRAPENVRREFSQFKAVEHYADLLALIKAVA

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
3 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
4 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
5 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
11 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
16 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
17 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
20 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
21 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
33 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
34 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
35 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
36 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
52 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
53 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
54 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
55 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
56 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
57 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
58 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
59 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
60 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
61 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
64 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
65 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
68 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
69 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
70 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
71 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
75 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
76 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
79 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
80 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
81 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
91 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
92 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
95 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
97 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
102 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
104 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
105 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
106 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
107 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
108 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
112 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
113 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
114 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
115 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
119 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
120 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
121 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
122 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
123 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
124 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
125 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.19
Nodule 0
Rhizoplane 1.08
Rhizosphere 89.19
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100150552 3300005331 Bacteria 2014
2 Ga0070687_100315790 3300005343 Bacteria 996
3 Ga0070668_100056009 3300005347 Bacteria 3044
4 Ga0070674_101078760 3300005356 Unclassified 708
5 Ga0070685_10023481 3300005466 Bacteria 3377
6 Ga0070665_100652912 3300005548 Bacteria 1065
7 Ga0068855_100168685 3300005563 Bacteria 2479
8 Ga0070702_100091394 3300005615 Bacteria 1847
9 Ga0070702_100130298 3300005615 Bacteria 1587
10 Ga0068861_100771179 3300005719 Bacteria 900
11 Ga0068860_100242711 3300005843 Bacteria 1753
12 Ga0070717_10000015 3300006028 Bacteria 208620
13 Ga0075363_100004503 3300006048 Bacteria 6109
14 Ga0075363_100025056 3300006048 Bacteria 3038
15 Ga0075364_10002301 3300006051 Bacteria 10705
16 Ga0075364_10091801 3300006051 Bacteria 2015
17 Ga0075367_10087157 3300006178 Bacteria 1896
18 Ga0075370_10058901 3300006353 Bacteria 2185
19 Ga0075428_100057126 3300006844 Bacteria 4273
20 Ga0075428_100570671 3300006844 Unclassified 1209
21 Ga0075430_100084446 3300006846 Bacteria 2659
22 Ga0075431_100004217 3300006847 Bacteria 14079
23 Ga0075431_100128152 3300006847 Bacteria 2619
24 Ga0075436_100368118 3300006914 Bacteria 1038
25 Ga0097620_100490764 3300006931 Unclassified 1323
26 Ga0075435_100247610 3300007076 Bacteria 1517
27 Ga0099794_10431200 3300007265 Unclassified 690
28 Ga0105240_10005502 3300009093 Bacteria 18873
29 Ga0105240_10095374 3300009093 Bacteria 3627
30 Ga0111539_10011554 3300009094 Bacteria 11082
31 Ga0114129_11146963 3300009147 Bacteria 971
32 Ga0105243_10359687 3300009148 Bacteria 1339
33 Ga0105242_10431275 3300009176 Unclassified 1238
34 Ga0105238_10280307 3300009551 Bacteria 1648
35 Ga0105238_10590716 3300009551 Bacteria 1118
36 Ga0105249_10063814 3300009553 Bacteria 3385
37 Ga0105249_10209598 3300009553 Bacteria 1912
38 Ga0105249_10502244 3300009553 Unclassified 1258
39 Ga0105239_11351116 3300010375 Bacteria 822
40 Ga0163162_10212798 3300013306 Unclassified 2063
41 Ga0157372_10038570 3300013307 Bacteria 5273
42 Ga0157380_11061468 3300014326 Unclassified 847
43 Ga0157377_10303291 3300014745 Unclassified 1055
44 Ga0163161_10488811 3300017792 Bacteria 1000
45 Ga0207695_10072683 3300025913 Bacteria 3507
46 Ga0207662_10168498 3300025918 Bacteria 1403
47 Ga0207644_10043727 3300025931 Bacteria 3180
48 Ga0207709_10730912 3300025935 Unclassified 794
49 Ga0207670_10001560 3300025936 Bacteria 12072
50 Ga0207689_10484061 3300025942 Bacteria 1036
51 Ga0207712_10043022 3300025961 Bacteria 3113
52 Ga0207668_10024823 3300025972 Bacteria 3873
53 Ga0207668_10192178 3300025972 Bacteria 1619
54 Ga0207668_10255854 3300025972 Bacteria 1425
55 Ga0207668_10369088 3300025972 Bacteria 1205
56 Ga0207708_10474060 3300026075 Bacteria 1046
57 Ga0207675_100059249 3300026118 Bacteria 3573
58 Ga0207675_100902219 3300026118 Bacteria 900
59 Ga0207683_10332083 3300026121 Bacteria 1394
60 Ga0207428_10333937 3300027907 Bacteria 1117
61 Ga0268266_10324122 3300028379 Bacteria 1443
62 Ga0268264_10218024 3300028381 Bacteria 1755
63 Ga0265319_1047601 3300028563 Bacteria 1426
64 Ga0265318_10016486 3300028577 Bacteria 3054
65 Ga0265338_10039821 3300028800 Bacteria 4425
66 Ga0265320_10001838 3300031240 Bacteria 15053
67 Ga0265320_10003109 3300031240 Bacteria 11271
68 Ga0265320_10014350 3300031240 Bacteria 4515
69 Ga0265339_10136373 3300031249 Unclassified 1251
70 Ga0307408_100343227 3300031548 Bacteria 1265
71 Ga0316575_10023823 3300031665 Bacteria 2368
72 Ga0316579_10052513 3300031691 Bacteria 1909
73 Ga0265314_10000046 3300031711 Bacteria 199789
74 Ga0265314_10027835 3300031711 Bacteria 4225
75 Ga0316576_10001869 3300031727 Bacteria 11708
76 Ga0316576_10009528 3300031727 Bacteria 6272
77 Ga0316576_10017318 3300031727 Bacteria 4891
78 Ga0316576_10070101 3300031727 Bacteria 2586
79 Ga0316576_10296935 3300031727 Bacteria 1208
80 Ga0316578_10018751 3300031728 Bacteria 3798
81 Ga0316578_10037282 3300031728 Bacteria 2800
82 Ga0316578_10255331 3300031728 Bacteria 1051
83 Ga0316577_10097391 3300031733 Bacteria 1648
84 Ga0307416_100596247 3300032002 Bacteria 1184
85 Ga0316580_10045948 3300032139 Bacteria 1346
86 Ga0373960_0140754 3300035121 Bacteria 817
87 Ga0316574_0027970 3300035398 Bacteria 3398
88 Ga0316574_0095268 3300035398 Bacteria 1902
89 Ga0316574_0186432 3300035398 Bacteria 1334
90 Ga0316582_0081495 3300036647 Bacteria 2114
91 Ga0316582_0260156 3300036647 Bacteria 1190
92 Ga0316584_0016331 3300036712 Bacteria 5321
93 Ga0316584_0028461 3300036712 Bacteria 4122
94 Ga0316584_0311277 3300036712 Bacteria 1138
95 Ga0451853_0392130 3300041512 Bacteria 678
96 Ga0439434_0148496 3300042435 Bacteria 775
97 Ga0450918_017088 3300042531 Bacteria 1263
98 Ga0451577_0005218 3300042876 Bacteria 13370
99 Ga0466961_0055835 3300044693 Bacteria 2517
100 Ga0453684_0006548 3300044712 Bacteria 22060
101 Ga0453684_0082120 3300044712 Bacteria 4016
102 Ga0453684_0175701 3300044712 Bacteria 2519
103 Ga0451576_0145299 3300045051 Bacteria 2473
104 Ga0451576_0186612 3300045051 Bacteria 2165
105 Ga0451576_0250961 3300045051 Bacteria 1849
106 Ga0495592_0000301 3300046454 Bacteria 41993
107 Ga0495662_0017987 3300046476 Bacteria 3420
108 Ga0495664_0181403 3300046477 Bacteria 1276
109 Ga0495628_0000898 3300046516 Bacteria 27355
110 Ga0495630_0014178 3300046517 Bacteria 5802
111 Ga0495652_0018116 3300046529 Bacteria 6285
112 Ga0495586_0000886 3300046535 Bacteria 17153
113 Ga0495667_0607782 3300046559 Unclassified 681
114 Ga0495634_0237542 3300046642 Unclassified 1119
115 Ga0495599_0006908 3300046678 Bacteria 6860
116 Ga0495624_0042180 3300046690 Bacteria 2916
117 Ga0495581_0069443 3300047315 Bacteria 2037
118 Ga0495674_0004505 3300047319 Bacteria 13395
119 Ga0495684_0416590 3300047471 Unclassified 940
120 Ga0495684_0672504 3300047471 Bacteria 690
121 Ga0496102_1174438 3300048905 Bacteria 687
122 Ga0496114_0581465 3300048917 Bacteria 988
123 Ga0501031_0157047 3300049568 Bacteria 1487
124 Ga0501033_0053283 3300049570 Bacteria 2996
125 Ga0501034_0011297 3300049571 Bacteria 9264
126 Ga0501034_0174331 3300049571 Bacteria 2117
127 Ga0501034_0390755 3300049571 Bacteria 1315
128 Ga0501034_1021569 3300049571 Bacteria 710
129 Ga0501036_0038294 3300049572 Bacteria 4058
130 Ga0501036_0155764 3300049572 Bacteria 1927
131 Ga0501036_0344345 3300049572 Bacteria 1245
132 Ga0501039_0350042 3300049575 Bacteria 1161
133 Ga0501039_0711497 3300049575 Bacteria 785
134 Ga0501040_0074730 3300049576 Bacteria 2342
135 Ga0501040_0081546 3300049576 Bacteria 2242
136 Ga0501041_0055916 3300049577 Bacteria 2410
137 Ga0501041_0127766 3300049577 Bacteria 1583
138 Ga0501042_0061336 3300049578 Bacteria 2687
139 Ga0501043_0049678 3300049579 Bacteria 3298
140 Ga0501043_0317565 3300049579 Bacteria 1188
141 Ga0501043_0547038 3300049579 Bacteria 860
142 Ga0501046_0009077 3300049580 Bacteria 8621
143 Ga0501047_0010904 3300049581 Bacteria 8594
144 Ga0501047_0036813 3300049581 Bacteria 4730
145 Ga0501047_0125070 3300049581 Bacteria 2452
146 Ga0501048_0213989 3300049582 Bacteria 1367
147 Ga0501067_0036921 3300049583 Bacteria 2713
148 Ga0501070_0104275 3300049586 Bacteria 2345
149 Ga0501070_0187357 3300049586 Bacteria 1702
150 Ga0501070_0776853 3300049586 Bacteria 753
151 Ga0501071_0038655 3300049587 Bacteria 3411
152 Ga0501075_0503812 3300049591 Bacteria 924
153 Ga0501079_0375109 3300049741 Bacteria 1115
154 Ga0501080_0098087 3300049742 Bacteria 2720
155 Ga0501080_0207124 3300049742 Bacteria 1798
156 Ga0501083_0003924 3300049744 Bacteria 10446
157 Ga0501083_0080939 3300049744 Unclassified 2153
158 Ga0501035_0052870 3300049822 Bacteria 3634
159 Ga0501035_0104214 3300049822 Bacteria 2487
160 Ga0501035_0169283 3300049822 Bacteria 1888
161 Ga0501035_0249954 3300049822 Bacteria 1506
162 Ga0501044_0004884 3300049823 Bacteria 14984
163 Ga0501044_0115842 3300049823 Bacteria 2685
164 Ga0501044_0132634 3300049823 Bacteria 2484
165 Ga0501044_0398667 3300049823 Bacteria 1289
166 nmdc:mga00v17_10530_c1 3300050491 Bacteria 5052
167 nmdc:mga00v17_216117_c1 3300050491 Bacteria 1241
168 nmdc:mga00v17_5684_c1 3300050491 Bacteria 6584
169 nmdc:mga0yw44_27114_c1 3300050492 Bacteria 3279
170 nmdc:mga0yw44_94405_c1 3300050492 Bacteria 1896
171 nmdc:mga06z11_192189_c1 3300050494 Bacteria 1182
172 nmdc:mga06z11_47849_c1 3300050494 Bacteria 2173
173 nmdc:mga04h51_212294_c1 3300050495 Bacteria 764
174 nmdc:mga07m45_251064_c1 3300050496 Bacteria 1029
175 nmdc:mga05p37_915678_c1 3300050507 Bacteria 943
176 nmdc:mga09592_48798_c1 3300050508 Bacteria 3569
177 nmdc:mga0qj67_516774_c1 3300050509 Bacteria 959
178 nmdc:mga06r32_157723_c1 3300050510 Bacteria 2251
179 nmdc:mga08y16_3055_c1 3300050511 Bacteria 17296
180 nmdc:mga08y16_516563_c1 3300050511 Bacteria 1212
181 Ga0500568_0031296 3300053139 Bacteria 2197
182 Ga0500616_0001102 3300053153 Bacteria 27963
183 Ga0501084_0527176 3300054114 Bacteria 999
184 Ga0587072_075332 3300059643 Bacteria 720
185 Ga0587076_053935 3300059645 Unclassified 792

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100056009 Ga0070668_1000560093 192
2 3300009553 Ga0105249_10063814 Ga0105249_100638143 192
3 3300025961 Ga0207712_10043022 Ga0207712_100430224 192
4 3300025972 Ga0207668_10024823 Ga0207668_100248234 192
5 3300026118 Ga0207675_100059249 Ga0207675_1000592493 193
6 3300005548 Ga0070665_100652912 Ga0070665_1006529122 198
7 3300028379 Ga0268266_10324122 Ga0268266_103241222 198
8 3300031727 Ga0316576_10296935 Ga0316576_102969352 198
9 3300035398 Ga0316574_0095268 Ga0316574_0095268_990_1610 198
10 3300036712 Ga0316584_0311277 Ga0316584_0311277_260_880 198
11 3300005343 Ga0070687_100315790 Ga0070687_1003157901 200
12 3300005615 Ga0070702_100130298 Ga0070702_1001302982 200
13 3300006844 Ga0075428_100057126 Ga0075428_1000571262 200
14 3300006844 Ga0075428_100570671 Ga0075428_1005706712 200
15 3300006846 Ga0075430_100084446 Ga0075430_1000844462 200
16 3300006847 Ga0075431_100004217 Ga0075431_1000042175 200
17 3300006914 Ga0075436_100368118 Ga0075436_1003681182 200
18 3300007076 Ga0075435_100247610 Ga0075435_1002476102 200
19 3300007265 Ga0099794_10431200 Ga0099794_104312001 200
20 3300009093 Ga0105240_10005502 Ga0105240_1000550213 200
21 3300009093 Ga0105240_10095374 Ga0105240_100953741 200
22 3300009094 Ga0111539_10011554 Ga0111539_100115545 200
23 3300009147 Ga0114129_11146963 Ga0114129_111469631 200
24 3300009551 Ga0105238_10280307 Ga0105238_102803071 200
25 3300009551 Ga0105238_10590716 Ga0105238_105907162 200
26 3300009553 Ga0105249_10502244 Ga0105249_105022442 200
27 3300025913 Ga0207695_10072683 Ga0207695_100726831 200
28 3300025918 Ga0207662_10168498 Ga0207662_101684982 200
29 3300025936 Ga0207670_10001560 Ga0207670_100015602 200
30 3300025972 Ga0207668_10192178 Ga0207668_101921782 200
31 3300026075 Ga0207708_10474060 Ga0207708_104740602 200
32 3300027907 Ga0207428_10333937 Ga0207428_103339372 200
33 3300028563 Ga0265319_1047601 Ga0265319_10476012 200
34 3300028577 Ga0265318_10016486 Ga0265318_100164861 200
35 3300031240 Ga0265320_10001838 Ga0265320_100018384 200
36 3300031240 Ga0265320_10014350 Ga0265320_100143504 200
37 3300031249 Ga0265339_10136373 Ga0265339_101363732 200
38 3300031711 Ga0265314_10027835 Ga0265314_100278353 200
39 3300035121 Ga0373960_0140754 Ga0373960_0140754_58_660 200
40 3300042876 Ga0451577_0005218 Ga0451577_0005218_2555_3163 200
41 3300044693 Ga0466961_0055835 Ga0466961_0055835_764_1369 200
42 3300044712 Ga0453684_0082120 Ga0453684_0082120_721_1323 200
43 3300045051 Ga0451576_0145299 Ga0451576_0145299_1504_2112 200
44 3300045051 Ga0451576_0186612 Ga0451576_0186612_621_1232 200
45 3300046454 Ga0495592_0000301 Ga0495592_0000301_13147_13752 200
46 3300046476 Ga0495662_0017987 Ga0495662_0017987_1017_1622 200
47 3300046477 Ga0495664_0181403 Ga0495664_0181403_307_912 200
48 3300046516 Ga0495628_0000898 Ga0495628_0000898_13498_14103 200
49 3300046517 Ga0495630_0014178 Ga0495630_0014178_4822_5427 200
50 3300046529 Ga0495652_0018116 Ga0495652_0018116_1164_1769 200
51 3300046535 Ga0495586_0000886 Ga0495586_0000886_3013_3618 200
52 3300046559 Ga0495667_0607782 Ga0495667_0607782_21_626 200
53 3300046642 Ga0495634_0237542 Ga0495634_0237542_301_906 200
54 3300046678 Ga0495599_0006908 Ga0495599_0006908_1114_1719 200
55 3300046690 Ga0495624_0042180 Ga0495624_0042180_542_1147 200
56 3300047315 Ga0495581_0069443 Ga0495581_0069443_816_1421 200
57 3300047319 Ga0495674_0004505 Ga0495674_0004505_9942_10547 200
58 3300047471 Ga0495684_0416590 Ga0495684_0416590_243_848 200
59 3300047471 Ga0495684_0672504 Ga0495684_0672504_64_669 200
60 3300048905 Ga0496102_1174438 Ga0496102_1174438_57_659 200
61 3300048917 Ga0496114_0581465 Ga0496114_0581465_70_672 200
62 3300049570 Ga0501033_0053283 Ga0501033_0053283_2261_2866 200
63 3300049571 Ga0501034_0390755 Ga0501034_0390755_222_833 200
64 3300049572 Ga0501036_0155764 Ga0501036_0155764_982_1587 200
65 3300049572 Ga0501036_0344345 Ga0501036_0344345_579_1193 200
66 3300049575 Ga0501039_0350042 Ga0501039_0350042_102_722 200
67 3300049579 Ga0501043_0049678 Ga0501043_0049678_2464_3075 200
68 3300049579 Ga0501043_0547038 Ga0501043_0547038_229_834 200
69 3300049580 Ga0501046_0009077 Ga0501046_0009077_7711_8325 200
70 3300049581 Ga0501047_0010904 Ga0501047_0010904_3383_3985 200
71 3300049586 Ga0501070_0187357 Ga0501070_0187357_149_751 200
72 3300049586 Ga0501070_0776853 Ga0501070_0776853_130_735 200
73 3300049744 Ga0501083_0080939 Ga0501083_0080939_1384_1986 200
74 3300049822 Ga0501035_0052870 Ga0501035_0052870_543_1145 200
75 3300049822 Ga0501035_0104214 Ga0501035_0104214_145_750 200
76 3300049822 Ga0501035_0169283 Ga0501035_0169283_309_923 200
77 3300049823 Ga0501044_0004884 Ga0501044_0004884_2513_3115 200
78 3300049823 Ga0501044_0115842 Ga0501044_0115842_1053_1667 200
79 3300049823 Ga0501044_0132634 Ga0501044_0132634_142_747 200
80 3300050507 nmdc:mga05p37_915678_c1 nmdc:mga05p37_915678_c1_201_821 200
81 3300050508 nmdc:mga09592_48798_c1 nmdc:mga09592_48798_c1_1033_1635 200
82 3300050509 nmdc:mga0qj67_516774_c1 nmdc:mga0qj67_516774_c1_38_646 200
83 3300050511 nmdc:mga08y16_3055_c1 nmdc:mga08y16_3055_c1_14184_14804 200
84 3300053153 Ga0500616_0001102 Ga0500616_0001102_16037_16666 200
85 3300006028 Ga0070717_10000015 Ga0070717_1000001517 201
86 3300014326 Ga0157380_11061468 Ga0157380_110614682 201
87 3300049568 Ga0501031_0157047 Ga0501031_0157047_307_912 201
88 3300049572 Ga0501036_0038294 Ga0501036_0038294_657_1262 201
89 3300049576 Ga0501040_0074730 Ga0501040_0074730_36_641 201
90 3300049577 Ga0501041_0127766 Ga0501041_0127766_546_1151 201
91 3300049578 Ga0501042_0061336 Ga0501042_0061336_969_1574 201
92 3300049579 Ga0501043_0317565 Ga0501043_0317565_175_780 201
93 3300049581 Ga0501047_0036813 Ga0501047_0036813_51_656 201
94 3300049587 Ga0501071_0038655 Ga0501071_0038655_374_979 201
95 3300049741 Ga0501079_0375109 Ga0501079_0375109_232_837 201
96 3300049822 Ga0501035_0249954 Ga0501035_0249954_312_917 201
97 3300005356 Ga0070674_101078760 Ga0070674_1010787601 202
98 3300005466 Ga0070685_10023481 Ga0070685_100234815 202
99 3300005719 Ga0068861_100771179 Ga0068861_1007711792 202
100 3300009148 Ga0105243_10359687 Ga0105243_103596872 202
101 3300009176 Ga0105242_10431275 Ga0105242_104312752 202
102 3300009553 Ga0105249_10209598 Ga0105249_102095981 202
103 3300010375 Ga0105239_11351116 Ga0105239_113511161 202
104 3300013306 Ga0163162_10212798 Ga0163162_102127982 202
105 3300014745 Ga0157377_10303291 Ga0157377_103032912 202
106 3300025935 Ga0207709_10730912 Ga0207709_107309121 202
107 3300026118 Ga0207675_100902219 Ga0207675_1009022192 202
108 3300042531 Ga0450918_017088 Ga0450918_017088_35_643 202
109 3300045051 Ga0451576_0250961 Ga0451576_0250961_1142_1759 202
110 3300049571 Ga0501034_0174331 Ga0501034_0174331_1297_1911 202
111 3300049581 Ga0501047_0125070 Ga0501047_0125070_576_1217 202
112 3300049742 Ga0501080_0207124 Ga0501080_0207124_535_1176 202
113 3300053139 Ga0500568_0031296 Ga0500568_0031296_1213_1830 202
114 3300059643 Ga0587072_075332 Ga0587072_075332_25_639 202
115 3300059645 Ga0587076_053935 Ga0587076_053935_165_779 202
116 3300005331 Ga0070670_100150552 Ga0070670_1001505523 203
117 3300005563 Ga0068855_100168685 Ga0068855_1001686852 203
118 3300005615 Ga0070702_100091394 Ga0070702_1000913943 203
119 3300005843 Ga0068860_100242711 Ga0068860_1002427112 203
120 3300006048 Ga0075363_100004503 Ga0075363_1000045035 203
121 3300006048 Ga0075363_100025056 Ga0075363_1000250562 203
122 3300006051 Ga0075364_10002301 Ga0075364_100023015 203
123 3300006051 Ga0075364_10091801 Ga0075364_100918012 203
124 3300006178 Ga0075367_10087157 Ga0075367_100871572 203
125 3300006353 Ga0075370_10058901 Ga0075370_100589012 203
126 3300006847 Ga0075431_100128152 Ga0075431_1001281522 203
127 3300006931 Ga0097620_100490764 Ga0097620_1004907642 203
128 3300013307 Ga0157372_10038570 Ga0157372_100385705 203
129 3300017792 Ga0163161_10488811 Ga0163161_104888112 203
130 3300025931 Ga0207644_10043727 Ga0207644_100437272 203
131 3300025942 Ga0207689_10484061 Ga0207689_104840612 203
132 3300025972 Ga0207668_10255854 Ga0207668_102558542 203
133 3300025972 Ga0207668_10369088 Ga0207668_103690882 203
134 3300026121 Ga0207683_10332083 Ga0207683_103320832 203
135 3300028381 Ga0268264_10218024 Ga0268264_102180242 203
136 3300028800 Ga0265338_10039821 Ga0265338_100398213 203
137 3300031240 Ga0265320_10003109 Ga0265320_100031096 203
138 3300031548 Ga0307408_100343227 Ga0307408_1003432272 203
139 3300031665 Ga0316575_10023823 Ga0316575_100238232 203
140 3300031691 Ga0316579_10052513 Ga0316579_100525132 203
141 3300031711 Ga0265314_10000046 Ga0265314_10000046125 203
142 3300031727 Ga0316576_10001869 Ga0316576_100018698 203
143 3300031727 Ga0316576_10009528 Ga0316576_100095286 203
144 3300031727 Ga0316576_10017318 Ga0316576_100173184 203
145 3300031727 Ga0316576_10070101 Ga0316576_100701013 203
146 3300031728 Ga0316578_10018751 Ga0316578_100187517 203
147 3300031728 Ga0316578_10037282 Ga0316578_100372822 203
148 3300031728 Ga0316578_10255331 Ga0316578_102553311 203
149 3300031733 Ga0316577_10097391 Ga0316577_100973911 203
150 3300032002 Ga0307416_100596247 Ga0307416_1005962472 203
151 3300032139 Ga0316580_10045948 Ga0316580_100459482 203
152 3300035398 Ga0316574_0027970 Ga0316574_0027970_458_1081 203
153 3300035398 Ga0316574_0186432 Ga0316574_0186432_493_1107 203
154 3300036647 Ga0316582_0081495 Ga0316582_0081495_1465_2085 203
155 3300036647 Ga0316582_0260156 Ga0316582_0260156_361_975 203
156 3300036712 Ga0316584_0016331 Ga0316584_0016331_440_1054 203
157 3300036712 Ga0316584_0028461 Ga0316584_0028461_3302_3916 203
158 3300041512 Ga0451853_0392130 Ga0451853_0392130_14_637 203
159 3300042435 Ga0439434_0148496 Ga0439434_0148496_13_630 203
160 3300044712 Ga0453684_0006548 Ga0453684_0006548_5579_6265 203
161 3300044712 Ga0453684_0175701 Ga0453684_0175701_1855_2481 203
162 3300049571 Ga0501034_0011297 Ga0501034_0011297_1403_2035 203
163 3300049571 Ga0501034_1021569 Ga0501034_1021569_54_677 203
164 3300049575 Ga0501039_0711497 Ga0501039_0711497_105_728 203
165 3300049576 Ga0501040_0081546 Ga0501040_0081546_1421_2044 203
166 3300049577 Ga0501041_0055916 Ga0501041_0055916_256_879 203
167 3300049582 Ga0501048_0213989 Ga0501048_0213989_657_1280 203
168 3300049583 Ga0501067_0036921 Ga0501067_0036921_182_799 203
169 3300049586 Ga0501070_0104275 Ga0501070_0104275_250_867 203
170 3300049591 Ga0501075_0503812 Ga0501075_0503812_40_663 203
171 3300049742 Ga0501080_0098087 Ga0501080_0098087_729_1346 203
172 3300049744 Ga0501083_0003924 Ga0501083_0003924_6271_6888 203
173 3300049823 Ga0501044_0398667 Ga0501044_0398667_210_836 203
174 3300050491 nmdc:mga00v17_10530_c1 nmdc:mga00v17_10530_c1_3512_4135 203
175 3300050491 nmdc:mga00v17_216117_c1 nmdc:mga00v17_216117_c1_119_742 203
176 3300050491 nmdc:mga00v17_5684_c1 nmdc:mga00v17_5684_c1_5135_5758 203
177 3300050492 nmdc:mga0yw44_27114_c1 nmdc:mga0yw44_27114_c1_1179_1802 203
178 3300050492 nmdc:mga0yw44_94405_c1 nmdc:mga0yw44_94405_c1_382_1005 203
179 3300050494 nmdc:mga06z11_192189_c1 nmdc:mga06z11_192189_c1_183_806 203
180 3300050494 nmdc:mga06z11_47849_c1 nmdc:mga06z11_47849_c1_188_811 203
181 3300050495 nmdc:mga04h51_212294_c1 nmdc:mga04h51_212294_c1_30_653 203
182 3300050496 nmdc:mga07m45_251064_c1 nmdc:mga07m45_251064_c1_313_936 203
183 3300050510 nmdc:mga06r32_157723_c1 nmdc:mga06r32_157723_c1_843_1565 203
184 3300050511 nmdc:mga08y16_516563_c1 nmdc:mga08y16_516563_c1_191_868 203
185 3300054114 Ga0501084_0527176 Ga0501084_0527176_141_764 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

18

212

0.75

PF12710

HAD

haloacid dehalogenase-like hydrolase

53

208

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rkv-assembly1.cif.gz_B structure of phosphate complex of thrh from pseudomonas aeruginosa 0.9522 6 203
1rkv-assembly1.cif.gz_B structure of phosphate complex of thrh from pseudomonas aeruginosa 0.9252 6 203
7si7-assembly1.cif.gz_A structure of atp7b in state 2 0.849 71 182
7si3-assembly1.cif.gz_A consensus structure of atp7b 0.8477 71 182
1l7n-assembly1.cif.gz_A transition state analogue of phosphoserine phosphatase (aluminum fluoride complex) 0.8302 4 192
ID Description Score Start End Superfamily
1rkvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9583 6 203 3.40.50.1000
1rkvB02 Alpha Beta;Alpha-Beta Complex;thrh gene product, domain 2;thrh gene product, domain 2 0.8947 18 132 3.90.1470.10
1rkvB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8907 6 203 3.40.50.1000
1rkvB02 Alpha Beta;Alpha-Beta Complex;thrh gene product, domain 2;thrh gene product, domain 2 0.8859 18 132 3.90.1470.10
af_A0A1D6I6W5_2_66_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8449 130 177 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A3C0L4S3-F1-model_v4 Bifunctional phosphoserine phosphatase/homoserine phosphotransferase ThrH 0.9881 138 201 GO:0016740
AF-A0A381PN75-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9844 5 203 GO:0000287
GO:0005737
GO:0006564
GO:0036424
AF-A0A3C0U3J2-F1-model_v4 Bifunctional phosphoserine phosphatase/homoserine phosphotransferase ThrH 0.9831 136 202 GO:0016740
AF-A0A382AI33-F1-model_v4 Bifunctional phosphoserine phosphatase/homoserine phosphotransferase ThrH 0.9807 6 199
AF-A0A2S6RLD3-F1-model_v4 phosphoserine phosphatase (EC 3.1.3.3) 0.9784 7 201 GO:0000287
GO:0005737
GO:0006564
GO:0036424

Feature Viewer

pLDDT pTM Quality
94.46 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map