F284399

General Info

Members Datasets Scaffolds Average Seq Length
185 116 370 423

Family's Representative Sequence

Representative Sequence 3300022467|Ga0224712_10010191|Ga0224712_100101913
Length 438
Sequence VGTLPSRRMRSRRRIRFFSAAAATAVLSTVLAACGSDNSKGPVSISFYDQPGSAVATQANADACTKSSGGKYKVKYVKLPTAADQQRLQLVRRMAARDSSVDLMGLDVTWEAEFSEAGWVIPWTGENETKAKADQLAGPLDTATWKGKLVAIPYNSNTQLLWYRSDLVPKPPKTWSEMIDQATALAKQGKPHYIEEQGAQYEGLTVWFNSMVASAGGTILSPDSTKVTLNDKAKMALETMHRMATSPGADPSLSNFMEDQGRLAMESGTAAFEINYPFVWPSMQTDKPKVGGVDLAKVFKWAPFPTVASGQQARSTIGGIDIAVSKYSKHPDLAFQAALCLASKPQQLVGAIQGGLPPTLKSAYTNPTAEFKKLYPFYQDIYTQLQNASVRPKTPAYQSVSIVIQHALSPPSGINPAAAIKTMKSQINDALQSKGLVP

Samples

Sample ID Description Type Environment
1 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
30 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
31 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
36 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
37 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
53 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
61 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
62 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
66 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
67 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
68 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
72 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
75 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
76 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
81 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
98 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
99 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
108 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
115 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
116 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 4.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.78
Rhizosphere 87.57
Stem 0
Stem Tuber 0
Unclassified 0.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0224712_10010191 3300022467 Bacteria 2864
2 rootL2_10063397 3300003322 Bacteria 3027
3 JGI25407J50210_10022042 3300003373 Bacteria 1656
4 Ga0070667_100148235 3300005367 Bacteria 2059
5 Ga0070709_10030490 3300005434 Bacteria 3237
6 Ga0070714_100100079 3300005435 Bacteria 2552
7 Ga0070714_100146699 3300005435 Bacteria 2123
8 Ga0070714_100178243 3300005435 Bacteria 1932
9 Ga0070713_100065100 3300005436 Bacteria 3061
10 Ga0070713_100226876 3300005436 Bacteria 1696
11 Ga0070710_10037199 3300005437 Bacteria 2665
12 Ga0070711_100037904 3300005439 Bacteria 3237
13 Ga0070711_100059617 3300005439 Bacteria 2651
14 Ga0070708_100023920 3300005445 Bacteria 5200
15 Ga0070708_100147092 3300005445 Bacteria 2189
16 Ga0070708_100257587 3300005445 Bacteria 1640
17 Ga0070706_100011901 3300005467 Bacteria 8076
18 Ga0070706_100013244 3300005467 Bacteria 7628
19 Ga0070706_100029568 3300005467 Bacteria 5047
20 Ga0070706_100088728 3300005467 Bacteria 2867
21 Ga0070706_100139404 3300005467 Bacteria 2264
22 Ga0070707_100017758 3300005468 Bacteria 6688
23 Ga0070707_100047120 3300005468 Bacteria 4126
24 Ga0070707_100048680 3300005468 Bacteria 4060
25 Ga0070707_100146127 3300005468 Bacteria 2302
26 Ga0070698_100000534 3300005471 Bacteria 40564
27 Ga0070698_100017296 3300005471 Bacteria 7597
28 Ga0070698_100036371 3300005471 Bacteria 5086
29 Ga0070699_100016019 3300005518 Bacteria 6437
30 Ga0070697_100089795 3300005536 Bacteria 2539
31 Ga0070697_100094367 3300005536 Bacteria 2479
32 Ga0068855_100168681 3300005563 Bacteria 2479
33 Ga0068856_100109744 3300005614 Bacteria 2755
34 Ga0068858_100167373 3300005842 Bacteria 2072
35 Ga0081455_10001610 3300005937 Bacteria 27562
36 Ga0081538_10007006 3300005981 Bacteria 9807
37 Ga0081538_10007779 3300005981 Bacteria 9208
38 Ga0081538_10009238 3300005981 Bacteria 8257
39 Ga0081538_10016005 3300005981 Bacteria 5773
40 Ga0081538_10030082 3300005981 Bacteria 3695
41 Ga0081540_1002634 3300005983 Bacteria 14588
42 Ga0070717_10041779 3300006028 Bacteria 3739
43 Ga0070717_10136556 3300006028 Bacteria 2112
44 Ga0070715_10002556 3300006163 Bacteria 5608
45 Ga0070716_100009230 3300006173 Bacteria 4914
46 Ga0070712_100111245 3300006175 Bacteria 2044
47 Ga0075434_100246154 3300006871 Bacteria 1807
48 Ga0075436_100034252 3300006914 Bacteria 3502
49 Ga0075435_100175902 3300007076 Bacteria 1807
50 Ga0105237_10214486 3300009545 Bacteria 1925
51 Ga0105238_10129961 3300009551 Bacteria 2497
52 Ga0163162_10034050 3300013306 Bacteria 5067
53 Ga0157375_10009087 3300013308 Bacteria 8703
54 Ga0206349_1376085 3300020075 Bacteria 1926
55 Ga0206350_10006676 3300020080 Bacteria 1620
56 Ga0206350_10231277 3300020080 Bacteria 3486
57 Ga0206350_10432718 3300020080 Bacteria 1325
58 Ga0213876_10003344 3300021384 Bacteria 9183
59 Ga0213875_10000728 3300021388 Bacteria 25099
60 Ga0213875_10001331 3300021388 Bacteria 16269
61 Ga0213875_10004064 3300021388 Bacteria 8138
62 Ga0213875_10076813 3300021388 Bacteria 1558
63 Ga0224712_10003947 3300022467 Bacteria 3937
64 Ga0224712_10007670 3300022467 Bacteria 3155
65 Ga0224712_10009611 3300022467 Bacteria 2922
66 Ga0224712_10043572 3300022467 Bacteria 1706
67 Ga0207692_10017650 3300025898 Bacteria 3186
68 Ga0207685_10006291 3300025905 Bacteria 3221
69 Ga0207685_10011923 3300025905 Bacteria 2635
70 Ga0207699_10010627 3300025906 Bacteria 4628
71 Ga0207684_10010500 3300025910 Bacteria 8148
72 Ga0207684_10030084 3300025910 Bacteria 4624
73 Ga0207684_10160867 3300025910 Bacteria 1933
74 Ga0207684_10190810 3300025910 Bacteria 1767
75 Ga0207693_10076251 3300025915 Bacteria 2626
76 Ga0207663_10007894 3300025916 Bacteria 5549
77 Ga0207646_10017424 3300025922 Bacteria 6724
78 Ga0207646_10097574 3300025922 Bacteria 2633
79 Ga0207646_10106782 3300025922 Bacteria 2511
80 Ga0207646_10123463 3300025922 Unclassified 2328
81 Ga0207700_10057130 3300025928 Bacteria 2941
82 Ga0207700_10094334 3300025928 Bacteria 2371
83 Ga0207700_10094738 3300025928 Bacteria 2366
84 Ga0207664_10016366 3300025929 Bacteria 5409
85 Ga0207664_10052911 3300025929 Bacteria 3212
86 Ga0207664_10056353 3300025929 Bacteria 3121
87 Ga0207664_10131895 3300025929 Bacteria 2104
88 Ga0207665_10011997 3300025939 Bacteria 5691
89 Ga0207665_10015123 3300025939 Bacteria 5068
90 Ga0207702_10184227 3300026078 Bacteria 1925
91 Ga0207674_10024185 3300026116 Bacteria 6495
92 Ga0265337_1000751 3300028556 Bacteria 17116
93 Ga0265319_1001723 3300028563 Bacteria 12592
94 Ga0265334_10001172 3300028573 Bacteria 12837
95 Ga0265318_10034898 3300028577 Bacteria 1936
96 Ga0265322_10019617 3300028654 Bacteria 1939
97 Ga0265336_10001734 3300028666 Bacteria 9581
98 Ga0265336_10013493 3300028666 Bacteria 2723
99 Ga0265338_10002382 3300028800 Bacteria 28317
100 Ga0265338_10002709 3300028800 Bacteria 25994
101 Ga0265324_10001636 3300029957 Bacteria 12390
102 Ga0265332_10003441 3300031238 Bacteria 7624
103 Ga0265320_10001589 3300031240 Bacteria 16321
104 Ga0265325_10005179 3300031241 Bacteria 8102
105 Ga0265339_10019243 3300031249 Bacteria 4012
106 Ga0265316_10022534 3300031344 Bacteria 5306
107 Ga0265313_10023536 3300031595 Bacteria 3316
108 Ga0265314_10003585 3300031711 Bacteria 14949
109 Ga0265342_10004528 3300031712 Bacteria 10897
110 Ga0373926_0031771 3300035083 Bacteria 1862
111 Ga0373957_0019068 3300035120 Bacteria 2409
112 Ga0373943_0050184 3300035170 Bacteria 2049
113 Ga0373931_0021589 3300035691 Bacteria 3231
114 Ga0373935_0000645 3300035692 Bacteria 18377
115 Ga0373935_0069890 3300035692 Bacteria 2262
116 Ga0373933_0010146 3300035724 Bacteria 5157
117 Ga0373947_0000005 3300035725 Bacteria 225129
118 Ga0373937_0004134 3300036401 Bacteria 12311
119 Ga0373925_0003022 3300037068 Bacteria 13235
120 Ga0436364_0026348 3300037853 Bacteria 5688
121 Ga0436364_0078738 3300037853 Bacteria 3645
122 Ga0436364_0125429 3300037853 Bacteria 30073
123 Ga0436364_0306952 3300037853 Bacteria 11121
124 Ga0436364_0423427 3300037853 Bacteria 28417
125 Ga0436364_0571463 3300037853 Bacteria 9399
126 Ga0436365_0197210 3300039437 Bacteria 4174
127 Ga0436365_0791138 3300039437 Bacteria 3449
128 Ga0436365_1076499 3300039437 Bacteria 1896
129 Ga0439450_000910 3300042008 Bacteria 4096
130 Ga0466969_0037458 3300044656 Bacteria 2446
131 Ga0466961_0005427 3300044693 Bacteria 8035
132 Ga0466963_0003479 3300044694 Bacteria 9032
133 Ga0466963_0006092 3300044694 Bacteria 7113
134 Ga0466963_0150643 3300044694 Bacteria 1615
135 Ga0466971_0066522 3300044719 Bacteria 1633
136 Ga0466968_0045335 3300044735 Bacteria 1866
137 Ga0466959_0011671 3300045049 Bacteria 6319
138 Ga0466959_0068972 3300045049 Bacteria 2562
139 Ga0466959_0098892 3300045049 Bacteria 2090
140 Ga0466958_0015011 3300045836 Bacteria 4432
141 Ga0466958_0063998 3300045836 Bacteria 2243
142 Ga0466967_0001776 3300045976 Bacteria 12907
143 Ga0495592_0023489 3300046454 Bacteria 4689
144 Ga0495603_0091357 3300046455 Bacteria 1780
145 Ga0495651_0017708 3300046462 Bacteria 5516
146 Ga0495651_0029762 3300046462 Bacteria 4257
147 Ga0495653_0033390 3300046463 Bacteria 4077
148 Ga0495594_0075258 3300046499 Bacteria 1882
149 Ga0495608_0022644 3300046511 Bacteria 4309
150 Ga0495608_0145356 3300046511 Bacteria 1512
151 Ga0495628_0062660 3300046516 Bacteria 2914
152 Ga0495628_0087947 3300046516 Bacteria 2408
153 Ga0495630_0096786 3300046517 Bacteria 2231
154 Ga0495652_0040737 3300046529 Bacteria 4014
155 Ga0495587_0024673 3300046536 Bacteria 3682
156 Ga0495645_0058605 3300046543 Bacteria 2794
157 Ga0495645_0081725 3300046543 Bacteria 2318
158 Ga0495667_0004716 3300046559 Bacteria 9220
159 Ga0495667_0062789 3300046559 Bacteria 2433
160 Ga0495667_0107336 3300046559 Bacteria 1804
161 Ga0495634_0034078 3300046642 Bacteria 3495
162 Ga0495599_0023288 3300046678 Bacteria 3870
163 Ga0495646_0053981 3300046680 Bacteria 2419
164 Ga0495646_0084236 3300046680 Bacteria 1846
165 Ga0495613_0084498 3300046689 Bacteria 2304
166 Ga0495674_0048829 3300047319 Bacteria 3742
167 Ga0495680_0041033 3300047322 Bacteria 3681
168 Ga0495680_0092269 3300047322 Bacteria 2268
169 Ga0495675_0089555 3300047444 Bacteria 1931
170 Ga0495675_0094111 3300047444 Bacteria 1879
171 Ga0495593_0042175 3300047673 Bacteria 2450
172 Ga0495602_0023123 3300048088 Bacteria 6064
173 Ga0495602_0196663 3300048088 Bacteria 1541
174 Ga0496104_0044638 3300048907 Bacteria 4164
175 Ga0496105_0034501 3300048908 Bacteria 4161
176 Ga0496108_0000157 3300048911 Bacteria 64803
177 Ga0496110_0267178 3300048913 Bacteria 1557
178 Ga0496112_0053357 3300048915 Bacteria 3970
179 Ga0496113_0077489 3300048916 Bacteria 2542
180 Ga0496115_0034953 3300048918 Bacteria 3974
181 Ga0496126_0098721 3300048929 Bacteria 2559
182 nmdc:mga0n895_146050_c1 3300050512 Bacteria 2395
183 nmdc:mga0n895_176940_c1 3300050512 Bacteria 2164
184 Ga0495612_0029390 3300053078 Bacteria 2214
185 Ga0495619_0205793 3300053085 Bacteria 1362
186 Ga0224712_10010191
187 rootL2_10063397
188 JGI25407J50210_10022042
189 Ga0070667_100148235
190 Ga0070709_10030490
191 Ga0070714_100100079
192 Ga0070714_100146699
193 Ga0070714_100178243
194 Ga0070713_100065100
195 Ga0070713_100226876
196 Ga0070710_10037199
197 Ga0070711_100037904
198 Ga0070711_100059617
199 Ga0070708_100023920
200 Ga0070708_100147092
201 Ga0070708_100257587
202 Ga0070706_100011901
203 Ga0070706_100013244
204 Ga0070706_100029568
205 Ga0070706_100088728
206 Ga0070706_100139404
207 Ga0070707_100017758
208 Ga0070707_100047120
209 Ga0070707_100048680
210 Ga0070707_100146127
211 Ga0070698_100000534
212 Ga0070698_100017296
213 Ga0070698_100036371
214 Ga0070699_100016019
215 Ga0070697_100089795
216 Ga0070697_100094367
217 Ga0068855_100168681
218 Ga0068856_100109744
219 Ga0068858_100167373
220 Ga0081455_10001610
221 Ga0081538_10007006
222 Ga0081538_10007779
223 Ga0081538_10009238
224 Ga0081538_10016005
225 Ga0081538_10030082
226 Ga0081540_1002634
227 Ga0070717_10041779
228 Ga0070717_10136556
229 Ga0070715_10002556
230 Ga0070716_100009230
231 Ga0070712_100111245
232 Ga0075434_100246154
233 Ga0075436_100034252
234 Ga0075435_100175902
235 Ga0105237_10214486
236 Ga0105238_10129961
237 Ga0163162_10034050
238 Ga0157375_10009087
239 Ga0206349_1376085
240 Ga0206350_10006676
241 Ga0206350_10231277
242 Ga0206350_10432718
243 Ga0213876_10003344
244 Ga0213875_10000728
245 Ga0213875_10001331
246 Ga0213875_10004064
247 Ga0213875_10076813
248 Ga0224712_10003947
249 Ga0224712_10007670
250 Ga0224712_10009611
251 Ga0224712_10043572
252 Ga0207692_10017650
253 Ga0207685_10006291
254 Ga0207685_10011923
255 Ga0207699_10010627
256 Ga0207684_10010500
257 Ga0207684_10030084
258 Ga0207684_10160867
259 Ga0207684_10190810
260 Ga0207693_10076251
261 Ga0207663_10007894
262 Ga0207646_10017424
263 Ga0207646_10097574
264 Ga0207646_10106782
265 Ga0207646_10123463
266 Ga0207700_10057130
267 Ga0207700_10094334
268 Ga0207700_10094738
269 Ga0207664_10016366
270 Ga0207664_10052911
271 Ga0207664_10056353
272 Ga0207664_10131895
273 Ga0207665_10011997
274 Ga0207665_10015123
275 Ga0207702_10184227
276 Ga0207674_10024185
277 Ga0265337_1000751
278 Ga0265319_1001723
279 Ga0265334_10001172
280 Ga0265318_10034898
281 Ga0265322_10019617
282 Ga0265336_10001734
283 Ga0265336_10013493
284 Ga0265338_10002382
285 Ga0265338_10002709
286 Ga0265324_10001636
287 Ga0265332_10003441
288 Ga0265320_10001589
289 Ga0265325_10005179
290 Ga0265339_10019243
291 Ga0265316_10022534
292 Ga0265313_10023536
293 Ga0265314_10003585
294 Ga0265342_10004528
295 Ga0373926_0031771
296 Ga0373957_0019068
297 Ga0373943_0050184
298 Ga0373931_0021589
299 Ga0373935_0000645
300 Ga0373935_0069890
301 Ga0373933_0010146
302 Ga0373947_0000005
303 Ga0373937_0004134
304 Ga0373925_0003022
305 Ga0436364_0026348
306 Ga0436364_0078738
307 Ga0436364_0125429
308 Ga0436364_0306952
309 Ga0436364_0423427
310 Ga0436364_0571463
311 Ga0436365_0197210
312 Ga0436365_0791138
313 Ga0436365_1076499
314 Ga0439450_000910
315 Ga0466969_0037458
316 Ga0466961_0005427
317 Ga0466963_0003479
318 Ga0466963_0006092
319 Ga0466963_0150643
320 Ga0466971_0066522
321 Ga0466968_0045335
322 Ga0466959_0011671
323 Ga0466959_0068972
324 Ga0466959_0098892
325 Ga0466958_0015011
326 Ga0466958_0063998
327 Ga0466967_0001776
328 Ga0495592_0023489
329 Ga0495603_0091357
330 Ga0495651_0017708
331 Ga0495651_0029762
332 Ga0495653_0033390
333 Ga0495594_0075258
334 Ga0495608_0022644
335 Ga0495608_0145356
336 Ga0495628_0062660
337 Ga0495628_0087947
338 Ga0495630_0096786
339 Ga0495652_0040737
340 Ga0495587_0024673
341 Ga0495645_0058605
342 Ga0495645_0081725
343 Ga0495667_0004716
344 Ga0495667_0062789
345 Ga0495667_0107336
346 Ga0495634_0034078
347 Ga0495599_0023288
348 Ga0495646_0053981
349 Ga0495646_0084236
350 Ga0495613_0084498
351 Ga0495674_0048829
352 Ga0495680_0041033
353 Ga0495680_0092269
354 Ga0495675_0089555
355 Ga0495675_0094111
356 Ga0495593_0042175
357 Ga0495602_0023123
358 Ga0495602_0196663
359 Ga0496104_0044638
360 Ga0496105_0034501
361 Ga0496108_0000157
362 Ga0496110_0267178
363 Ga0496112_0053357
364 Ga0496113_0077489
365 Ga0496115_0034953
366 Ga0496126_0098721
367 nmdc:mga0n895_146050_c1
368 nmdc:mga0n895_176940_c1
369 Ga0495612_0029390
370 Ga0495619_0205793

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

50

348

0.88

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

59

376

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wcj-assembly1.cif.gz_A crystal structure lpqy from mycobacterium tuberculosis 0.9464 43 422
7wda-assembly3.cif.gz_C crystal structure lpqy in complex with trehalose from mycobacterium tuberculosis 0.9444 40 422
7wda-assembly4.cif.gz_D crystal structure lpqy in complex with trehalose from mycobacterium tuberculosis 0.944 43 422
7cag-assembly1.cif.gz_E mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state 0.9256 44 428
7ape-assembly1.cif.gz_A crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose 0.9076 40 425
ID Description Score Start End Superfamily
af_P9WGU9_36_151_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9542 46 149 3.40.190.10
af_P9WGU9_154_411_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9292 157 371 3.40.190.10
1eu8A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8658 43 369 3.40.190.10
3k02A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8562 43 382 3.40.190.10
af_P9WGU9_36_151_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8506 46 149 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0K2GXU9-F1-model_v4 ABC transporter substrate-binding protein 0.9445 44 428 GO:0015768
GO:0042956
GO:0055052
GO:1901982
AF-A0A838XH01-F1-model_v4 ABC transporter substrate-binding protein 0.9366 30 428 GO:0015768
GO:0042956
GO:0055052
GO:1901982
AF-A0A069JG99-F1-model_v4 deleted 0.9239 55 421
AF-A0A6I6U681-F1-model_v4 deleted 0.9167 30 428
AF-A0A838XH01-F1-model_v4 ABC transporter substrate-binding protein 0.9145 30 428 GO:0015768
GO:0042956
GO:0055052
GO:1901982

Map