F284134

General Info

Members Datasets Scaffolds Average Seq Length
185 140 370 257

Family's Representative Sequence

Representative Sequence 3300006173|Ga0070716_100071968|Ga0070716_1000719681
Length 287
Sequence MCRAKELQCYWRQKCAAQRSLIRTFLFFVMGAVMTTIPARAQSLAADPALIDDLVAANRILYDQGVVDGFGHVSVRHDKNPEHFLLARSMAPGLVTTTDIMEFDRDGNAVDPQGRAVYLERFIHSEIYKARPEVKAVVHSHSPAVIPFGVTSVPLRPIFHLSSFLGAGAPVFEIREAGGPATDMLIRTPELGAALSRALGTAPVALMRGHGDVVVAPSLKEAVFRAVYTEVNARLEAEALRLAPLGQVTFLNDEEAAKATATNAGVLIRAWDLWKAKALAGTAITTR

Samples

Sample ID Description Type Environment
1 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
24 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
43 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
67 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
68 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
69 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
78 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
79 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
80 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
81 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
82 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
83 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
87 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
88 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
92 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
93 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
94 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
95 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
96 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
97 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
100 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
101 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
104 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
105 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
109 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
110 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
111 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
119 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
120 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
121 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
124 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
125 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
126 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
127 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
128 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
129 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
130 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
131 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
132 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
133 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
134 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
135 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
136 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
137 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
138 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
139 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
140 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0
Isolates 1.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.59
Nodule 0.54
Rhizoplane 4.32
Rhizosphere 70.27
Stem 0
Stem Tuber 0
Unclassified 11.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070716_100071968 3300006173 Unclassified 2034
2 rootH2_10175160 3300003320 Bacteria 1667
3 Ga0055540_1004904 3300003792 Bacteria 5842
4 Ga0055531_10000578 3300003794 Bacteria 31923
5 Ga0070690_100086022 3300005330 Bacteria 2063
6 Ga0068868_100023718 3300005338 Bacteria 4647
7 Ga0070692_10091948 3300005345 Bacteria 1651
8 Ga0070675_100036156 3300005354 Bacteria 4016
9 Ga0070709_10001886 3300005434 Bacteria 11370
10 Ga0070709_10009038 3300005434 Bacteria 5488
11 Ga0070709_10030166 3300005434 Bacteria 3251
12 Ga0070709_10147778 3300005434 Bacteria 1621
13 Ga0070714_100012570 3300005435 Bacteria 6763
14 Ga0070714_100032490 3300005435 Bacteria 4356
15 Ga0070714_100037010 3300005435 Bacteria 4098
16 Ga0070714_100303658 3300005435 Unclassified 1488
17 Ga0070713_100238190 3300005436 Bacteria 1656
18 Ga0070710_10001670 3300005437 Bacteria 10456
19 Ga0070710_10207834 3300005437 Bacteria 1239
20 Ga0070711_100000196 3300005439 Bacteria 31936
21 Ga0070711_100037270 3300005439 Bacteria 3262
22 Ga0070711_100044100 3300005439 Bacteria 3025
23 Ga0070705_100028613 3300005440 Bacteria 3054
24 Ga0070694_100027643 3300005444 Bacteria 3686
25 Ga0070681_10019016 3300005458 Bacteria 6875
26 Ga0070698_100024166 3300005471 Bacteria 6341
27 Ga0070697_100160507 3300005536 Bacteria 1899
28 Ga0070695_100034918 3300005545 Bacteria 3156
29 Ga0070696_100197662 3300005546 Bacteria 1499
30 Ga0068856_100166221 3300005614 Bacteria 2217
31 Ga0068864_100027913 3300005618 Bacteria 4770
32 Ga0068858_100059429 3300005842 Bacteria 3533
33 Ga0068860_100000585 3300005843 Bacteria 43723
34 Ga0081540_1076919 3300005983 Bacteria 1519
35 Ga0070717_10002311 3300006028 Bacteria 13390
36 Ga0070717_10015239 3300006028 Bacteria 5931
37 Ga0070717_10045413 3300006028 Bacteria 3591
38 Ga0075363_100175981 3300006048 Unclassified 1216
39 Ga0070712_100023621 3300006175 Bacteria 4064
40 Ga0070712_100045037 3300006175 Bacteria 3045
41 Ga0075367_10109331 3300006178 Bacteria 1696
42 Ga0097621_100145296 3300006237 Bacteria 2030
43 Ga0075430_100348796 3300006846 Bacteria 1222
44 Ga0075431_100657726 3300006847 Unclassified 1028
45 Ga0111539_10528462 3300009094 Bacteria 1374
46 Ga0111539_11003118 3300009094 Bacteria 971
47 Ga0105243_10068914 3300009148 Bacteria 2852
48 Ga0105248_10004897 3300009177 Bacteria 14797
49 Ga0105248_10020471 3300009177 Bacteria 7331
50 Ga0157378_10321554 3300013297 Bacteria 1503
51 Ga0163163_10416129 3300014325 Bacteria 1403
52 Ga0157376_10329145 3300014969 Bacteria 1455
53 Ga0213873_10046963 3300021358 Bacteria 1131
54 Ga0213872_10018121 3300021361 Bacteria 3248
55 Ga0213876_10007435 3300021384 Bacteria 5957
56 Ga0213875_10000556 3300021388 Bacteria 30532
57 Ga0209673_1020334 3300025273 Bacteria 2354
58 Ga0209051_1000025 3300025303 Bacteria 415397
59 Ga0209051_1008331 3300025303 Bacteria 5500
60 Ga0209257_1000039 3300025304 Bacteria 591694
61 Ga0207692_10082570 3300025898 Unclassified 1722
62 Ga0207699_10001797 3300025906 Bacteria 10076
63 Ga0207699_10048891 3300025906 Unclassified 2486
64 Ga0207699_10120798 3300025906 Bacteria 1694
65 Ga0207707_10206655 3300025912 Unclassified 1711
66 Ga0207693_10005609 3300025915 Bacteria 10434
67 Ga0207693_10010628 3300025915 Bacteria 7469
68 Ga0207693_10030336 3300025915 Bacteria 4270
69 Ga0207693_10044687 3300025915 Bacteria 3481
70 Ga0207693_10050901 3300025915 Bacteria 3252
71 Ga0207663_10004539 3300025916 Bacteria 6914
72 Ga0207663_10209459 3300025916 Unclassified 1412
73 Ga0207687_10038629 3300025927 Bacteria 3263
74 Ga0207700_10007650 3300025928 Bacteria 6628
75 Ga0207700_10044641 3300025928 Bacteria 3264
76 Ga0207700_10396955 3300025928 Bacteria 1208
77 Ga0207664_10012276 3300025929 Bacteria 6122
78 Ga0207665_10066803 3300025939 Unclassified 2448
79 Ga0207711_10038195 3300025941 Bacteria 4081
80 Ga0207711_10079611 3300025941 Bacteria 2860
81 Ga0207677_10014088 3300026023 Bacteria 4657
82 Ga0207676_10162021 3300026095 Bacteria 1939
83 Ga0268264_10000084 3300028381 Bacteria 242128
84 Ga0307515_10000030 3300028794 Bacteria 364482
85 Ga0307515_10313394 3300028794 Unclassified 1242
86 Ga0265338_10056576 3300028800 Bacteria 3477
87 Ga0265338_10147673 3300028800 Bacteria 1832
88 Ga0307513_10006170 3300031456 Bacteria 15712
89 Ga0265314_10065894 3300031711 Bacteria 2444
90 Ga0373936_0043595 3300035113 Bacteria 1804
91 Ga0373936_0181238 3300035113 Bacteria 924
92 Ga0395905_0415698 3300037471 Unclassified 1241
93 Ga0436364_0508608 3300037853 Bacteria 35332
94 Ga0436364_1042174 3300037853 Bacteria 3151
95 Ga0436365_0116682 3300039437 Bacteria 10349
96 Ga0436365_0569938 3300039437 Bacteria 2455
97 Ga0436365_1674662 3300039437 Bacteria 1047
98 Ga0436360_0208554 3300039438 Bacteria 4444
99 Ga0436360_0922659 3300039438 Bacteria 3973
100 Ga0436360_0950961 3300039438 Bacteria 2127
101 Ga0436360_1369713 3300039438 Bacteria 2358
102 Ga0436361_0032495 3300039447 Bacteria 1404
103 Ga0436361_0412008 3300039447 Bacteria 5379
104 Ga0436361_0852867 3300039447 Unclassified 1490
105 Ga0436361_1148713 3300039447 Bacteria 941
106 Ga0436363_0527973 3300039450 Bacteria 2660
107 Ga0436363_0864451 3300039450 Bacteria 3841
108 Ga0436362_0727500 3300039453 Unclassified 1457
109 Ga0436362_0731728 3300039453 Bacteria 1911
110 Ga0436362_0976270 3300039453 Bacteria 1644
111 Ga0436362_1252392 3300039453 Bacteria 1834
112 Ga0466968_0015021 3300044735 Bacteria 3067
113 Ga0466959_0293521 3300045049 Bacteria 1114
114 Ga0466967_0083241 3300045976 Bacteria 2893
115 Ga0495617_004052 3300046452 Bacteria 5383
116 Ga0495603_0060294 3300046455 Unclassified 2242
117 Ga0495638_0003739 3300046460 Bacteria 11840
118 Ga0495650_0000295 3300046471 Bacteria 91300
119 Ga0495580_0004945 3300046472 Bacteria 11142
120 Ga0495639_0036948 3300046475 Bacteria 2189
121 Ga0495584_0067429 3300046491 Unclassified 1798
122 Ga0495585_0014205 3300046492 Unclassified 4645
123 Ga0495606_0082938 3300046507 Bacteria 1989
124 Ga0495610_0000139 3300046512 Bacteria 81755
125 Ga0495616_0000430 3300046513 Bacteria 32094
126 Ga0495620_0003129 3300046515 Bacteria 9512
127 Ga0495637_0000098 3300046520 Bacteria 66534
128 Ga0495648_0042379 3300046524 Unclassified 2864
129 Ga0495622_0000056 3300046557 Bacteria 99105
130 Ga0495661_0020564 3300046665 Bacteria 4307
131 Ga0495613_0197585 3300046689 Bacteria 1419
132 Ga0495581_0041940 3300047315 Bacteria 2649
133 Ga0495636_0012742 3300047318 Bacteria 3331
134 Ga0495680_0381603 3300047322 Unclassified 976
135 Ga0495683_0000161 3300047323 Bacteria 65471
136 Ga0495673_0011042 3300047469 Bacteria 4884
137 Ga0495673_0145609 3300047469 Bacteria 920
138 Ga0495626_0000608 3300048091 Bacteria 34924
139 Ga0496102_0254064 3300048905 Bacteria 1657
140 Ga0496104_0000854 3300048907 Bacteria 26337
141 Ga0496106_0002388 3300048909 Bacteria 13989
142 Ga0496108_0002211 3300048911 Bacteria 15566
143 Ga0496109_0003766 3300048912 Bacteria 12668
144 Ga0496111_0051554 3300048914 Bacteria 2970
145 Ga0496111_0323907 3300048914 Bacteria 1141
146 Ga0496113_0002629 3300048916 Bacteria 10514
147 Ga0496117_0006145 3300048920 Bacteria 12278
148 Ga0496118_0001395 3300048921 Bacteria 36424
149 Ga0496121_0000077 3300048924 Bacteria 235293
150 Ga0496124_0006935 3300048927 Bacteria 12176
151 Ga0496125_0025312 3300048928 Bacteria 5437
152 Ga0496126_0007535 3300048929 Bacteria 11912
153 Ga0495678_001003 3300049459 Bacteria 24208
154 Ga0495682_0019124 3300049460 Bacteria 2577
155 Ga0501036_0577542 3300049572 Bacteria 933
156 Ga0501038_0150999 3300049574 Bacteria 1894
157 Ga0501039_0117888 3300049575 Bacteria 2079
158 Ga0501041_0009068 3300049577 Bacteria 5854
159 Ga0501042_0104213 3300049578 Bacteria 2041
160 Ga0501048_0118569 3300049582 Bacteria 1870
161 Ga0501045_0128457 3300049824 Bacteria 1884
162 nmdc:mga03n38_141477_c1 3300050490 Bacteria 1202
163 nmdc:mga0qj67_794380_c1 3300050509 Unclassified 749
164 nmdc:mga06r32_511661_c1 3300050510 Unclassified 1177
165 nmdc:mga08y16_774299_c1 3300050511 Bacteria 954
166 Ga0500635_0012870 3300053080 Bacteria 2415
167 Ga0500651_0033014 3300053093 Bacteria 3264
168 Ga0500651_0093956 3300053093 Unclassified 1844
169 Ga0500566_0000017 3300053094 Bacteria 93636
170 Ga0500640_000030 3300053095 Bacteria 21521
171 Ga0500572_000949 3300053111 Bacteria 8787
172 Ga0500614_000776 3300053123 Bacteria 8100
173 Ga0500559_0000445 3300053136 Bacteria 29374
174 Ga0500568_0068109 3300053139 Bacteria 1367
175 Ga0500590_088217 3300053148 Bacteria 1511
176 Ga0500603_000406 3300053150 Bacteria 11311
177 Ga0500622_0070898 3300053156 Bacteria 1762
178 Ga0500630_000137 3300053159 Bacteria 25742
179 Ga0500638_008077 3300053162 Bacteria 4461
180 Ga0500639_000015 3300053163 Bacteria 119636
181 Ga0500639_041851 3300053163 Bacteria 2407
182 Ga0500637_0037416 3300053178 Bacteria 2728
183 Ga0500596_002837 3300053735 Bacteria 3378
184 2550692938 2548876994 Bacteria 4904866
185 8005316010 8005314921 Bacteria 7072929
186 Ga0070716_100071968
187 rootH2_10175160
188 Ga0055540_1004904
189 Ga0055531_10000578
190 Ga0070690_100086022
191 Ga0068868_100023718
192 Ga0070692_10091948
193 Ga0070675_100036156
194 Ga0070709_10001886
195 Ga0070709_10009038
196 Ga0070709_10030166
197 Ga0070709_10147778
198 Ga0070714_100012570
199 Ga0070714_100032490
200 Ga0070714_100037010
201 Ga0070714_100303658
202 Ga0070713_100238190
203 Ga0070710_10001670
204 Ga0070710_10207834
205 Ga0070711_100000196
206 Ga0070711_100037270
207 Ga0070711_100044100
208 Ga0070705_100028613
209 Ga0070694_100027643
210 Ga0070681_10019016
211 Ga0070698_100024166
212 Ga0070697_100160507
213 Ga0070695_100034918
214 Ga0070696_100197662
215 Ga0068856_100166221
216 Ga0068864_100027913
217 Ga0068858_100059429
218 Ga0068860_100000585
219 Ga0081540_1076919
220 Ga0070717_10002311
221 Ga0070717_10015239
222 Ga0070717_10045413
223 Ga0075363_100175981
224 Ga0070712_100023621
225 Ga0070712_100045037
226 Ga0075367_10109331
227 Ga0097621_100145296
228 Ga0075430_100348796
229 Ga0075431_100657726
230 Ga0111539_10528462
231 Ga0111539_11003118
232 Ga0105243_10068914
233 Ga0105248_10004897
234 Ga0105248_10020471
235 Ga0157378_10321554
236 Ga0163163_10416129
237 Ga0157376_10329145
238 Ga0213873_10046963
239 Ga0213872_10018121
240 Ga0213876_10007435
241 Ga0213875_10000556
242 Ga0209673_1020334
243 Ga0209051_1000025
244 Ga0209051_1008331
245 Ga0209257_1000039
246 Ga0207692_10082570
247 Ga0207699_10001797
248 Ga0207699_10048891
249 Ga0207699_10120798
250 Ga0207707_10206655
251 Ga0207693_10005609
252 Ga0207693_10010628
253 Ga0207693_10030336
254 Ga0207693_10044687
255 Ga0207693_10050901
256 Ga0207663_10004539
257 Ga0207663_10209459
258 Ga0207687_10038629
259 Ga0207700_10007650
260 Ga0207700_10044641
261 Ga0207700_10396955
262 Ga0207664_10012276
263 Ga0207665_10066803
264 Ga0207711_10038195
265 Ga0207711_10079611
266 Ga0207677_10014088
267 Ga0207676_10162021
268 Ga0268264_10000084
269 Ga0307515_10000030
270 Ga0307515_10313394
271 Ga0265338_10056576
272 Ga0265338_10147673
273 Ga0307513_10006170
274 Ga0265314_10065894
275 Ga0373936_0043595
276 Ga0373936_0181238
277 Ga0395905_0415698
278 Ga0436364_0508608
279 Ga0436364_1042174
280 Ga0436365_0116682
281 Ga0436365_0569938
282 Ga0436365_1674662
283 Ga0436360_0208554
284 Ga0436360_0922659
285 Ga0436360_0950961
286 Ga0436360_1369713
287 Ga0436361_0032495
288 Ga0436361_0412008
289 Ga0436361_0852867
290 Ga0436361_1148713
291 Ga0436363_0527973
292 Ga0436363_0864451
293 Ga0436362_0727500
294 Ga0436362_0731728
295 Ga0436362_0976270
296 Ga0436362_1252392
297 Ga0466968_0015021
298 Ga0466959_0293521
299 Ga0466967_0083241
300 Ga0495617_004052
301 Ga0495603_0060294
302 Ga0495638_0003739
303 Ga0495650_0000295
304 Ga0495580_0004945
305 Ga0495639_0036948
306 Ga0495584_0067429
307 Ga0495585_0014205
308 Ga0495606_0082938
309 Ga0495610_0000139
310 Ga0495616_0000430
311 Ga0495620_0003129
312 Ga0495637_0000098
313 Ga0495648_0042379
314 Ga0495622_0000056
315 Ga0495661_0020564
316 Ga0495613_0197585
317 Ga0495581_0041940
318 Ga0495636_0012742
319 Ga0495680_0381603
320 Ga0495683_0000161
321 Ga0495673_0011042
322 Ga0495673_0145609
323 Ga0495626_0000608
324 Ga0496102_0254064
325 Ga0496104_0000854
326 Ga0496106_0002388
327 Ga0496108_0002211
328 Ga0496109_0003766
329 Ga0496111_0051554
330 Ga0496111_0323907
331 Ga0496113_0002629
332 Ga0496117_0006145
333 Ga0496118_0001395
334 Ga0496121_0000077
335 Ga0496124_0006935
336 Ga0496125_0025312
337 Ga0496126_0007535
338 Ga0495678_001003
339 Ga0495682_0019124
340 Ga0501036_0577542
341 Ga0501038_0150999
342 Ga0501039_0117888
343 Ga0501041_0009068
344 Ga0501042_0104213
345 Ga0501048_0118569
346 Ga0501045_0128457
347 nmdc:mga03n38_141477_c1
348 nmdc:mga0qj67_794380_c1
349 nmdc:mga06r32_511661_c1
350 nmdc:mga08y16_774299_c1
351 Ga0500635_0012870
352 Ga0500651_0033014
353 Ga0500651_0093956
354 Ga0500566_0000017
355 Ga0500640_000030
356 Ga0500572_000949
357 Ga0500614_000776
358 Ga0500559_0000445
359 Ga0500568_0068109
360 Ga0500590_088217
361 Ga0500603_000406
362 Ga0500622_0070898
363 Ga0500630_000137
364 Ga0500638_008077
365 Ga0500639_000015
366 Ga0500639_041851
367 Ga0500637_0037416
368 Ga0500596_002837
369 2550692938
370 8005316010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

52

237

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.9507 29 261
2z7b-assembly1.cif.gz_A crystal structure of mesorhizobium loti 3-hydroxy-2-methylpyridine-4,5-dicarboxylate decarboxylase 0.9158 29 261
6btg-assembly1.cif.gz_A crystal structure of deoxyribose-phosphate aldolase bound with dhap from bacillus thuringiensis 0.8371 28 239
4c25-assembly1.cif.gz_A l-fuculose 1-phosphate aldolase 0.8331 36 239
3ocr-assembly2.cif.gz_B crystal structure of aldolase ii superfamily protein from pseudomonas syringae 0.8226 33 261
ID Description Score Start End Superfamily
2z7bA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9467 29 261 3.40.225.10
2z7bA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9154 29 261 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8579 38 239 3.40.225.10
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8371 28 239 3.40.225.10
af_Q54T47_16_268_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8298 20 262 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A7Y4WEQ3-F1-model_v4 Class II aldolase/adducin family protein 0.9887 40 259 GO:0005856
GO:0051015
AF-V8QNL7-F1-model_v4 Aldolase 0.9872 44 260 GO:0005856
GO:0051015
AF-A0A5C7NVA9-F1-model_v4 deleted 0.9863 55 258
AF-A0A536UJH3-F1-model_v4 Class II aldolase/adducin family protein 0.9831 66 175 GO:0005829
GO:0016832
GO:0019323
AF-A0A537D8V4-F1-model_v4 Class II aldolase/adducin family protein 0.9824 34 233 GO:0005829
GO:0016832
GO:0019323

Map