F284071

General Info

Members Datasets Scaffolds Average Seq Length
185 121 184 367

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10042382|Ga0081455_100423822
Length 389
Sequence MALNTVCQVYHRPNEVHPRMKFALFYEIPVARPWTPGKEHQAYKNTIEQAVLGEKMGFHAFWTVEHHFLEEYSHCSNPEVLYGAVAALTSTIRIGYGVRLLPKPYNHPIRTAESVAVLDLVSDGRVDFGTGRSSTRAELEGFDVDPDETREQWREALGHIVGAWTNDMYQADGKYWHMGAPRRVLPKPLQDPHPPIFGATSSMGGHKEMGKQGIGLCSFTVGLPPEMLANNIAMYREGLAECEQPAGKFLNDTAATFTMVHCAPTTQEAKEVAKESFEWYPSYGGGLIASVAEWMEERGRTDDLDTYQYTAETLARKREGVMSHINIDYLYDSGSAVMGDPDHCIEAAKKYEEVGCDLLLCLVNPLKIPHENVMQSIELMGKYVLPEFK

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
3 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
16 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
41 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
53 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
60 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
61 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
72 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
73 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
77 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
78 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
79 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
82 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
86 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
87 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
88 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
91 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
92 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
93 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
96 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
99 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
102 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
103 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
106 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
107 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
108 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
109 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
110 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
111 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
118 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
121 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 0
Rhizoplane 4.32
Rhizosphere 81.08
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100008160 3300005355 Bacteria 8382
2 Ga0070674_100171796 3300005356 Bacteria 1653
3 Ga0070674_100232402 3300005356 Bacteria 1440
4 Ga0070667_100041068 3300005367 Bacteria 3881
5 Ga0070709_10040545 3300005434 Bacteria 2864
6 Ga0070708_100003605 3300005445 Bacteria 12148
7 Ga0070681_10092791 3300005458 Bacteria 2968
8 Ga0070706_100005551 3300005467 Bacteria 12008
9 Ga0070707_100160197 3300005468 Bacteria 2193
10 Ga0070699_100077501 3300005518 Bacteria 2894
11 Ga0070699_100190708 3300005518 Bacteria 1821
12 Ga0070679_100338847 3300005530 Bacteria 1452
13 Ga0070665_100254199 3300005548 Bacteria 1758
14 Ga0068855_100307635 3300005563 Bacteria 1754
15 Ga0068858_100001769 3300005842 Bacteria 22035
16 Ga0068860_100098997 3300005843 Unclassified 2781
17 Ga0068860_100260051 3300005843 Bacteria 1692
18 Ga0081455_10042382 3300005937 Bacteria 3993
19 Ga0081455_10067373 3300005937 Bacteria 2983
20 Ga0081455_10278288 3300005937 Bacteria 1210
21 Ga0081538_10065314 3300005981 Bacteria 2050
22 Ga0075365_10019196 3300006038 Bacteria 4216
23 Ga0075365_10081013 3300006038 Bacteria 2199
24 Ga0075365_10164199 3300006038 Bacteria 1549
25 Ga0075368_10072522 3300006042 Unclassified 1392
26 Ga0075363_100003000 3300006048 Bacteria 7059
27 Ga0075363_100077036 3300006048 Bacteria 1819
28 Ga0075364_10001109 3300006051 Bacteria 14394
29 Ga0075362_10030941 3300006177 Bacteria 2314
30 Ga0075367_10052226 3300006178 Bacteria 2419
31 Ga0075367_10098941 3300006178 Bacteria 1781
32 Ga0075367_10116892 3300006178 Bacteria 1641
33 Ga0075370_10005650 3300006353 Bacteria 6243
34 Ga0075428_100025354 3300006844 Bacteria 6563
35 Ga0075428_100026164 3300006844 Bacteria 6462
36 Ga0075428_100030334 3300006844 Bacteria 5981
37 Ga0075428_100031949 3300006844 Bacteria 5816
38 Ga0075428_100148546 3300006844 Bacteria 2547
39 Ga0075430_100002254 3300006846 Bacteria 15992
40 Ga0075430_100026818 3300006846 Bacteria 4900
41 Ga0075430_100139832 3300006846 Bacteria 2016
42 Ga0075430_100156980 3300006846 Bacteria 1894
43 Ga0075431_100000272 3300006847 Bacteria 40028
44 Ga0075431_100001368 3300006847 Bacteria 22367
45 Ga0075431_100071718 3300006847 Bacteria 3574
46 Ga0075431_100147621 3300006847 Bacteria 2423
47 Ga0075433_10010293 3300006852 Bacteria 7502
48 Ga0075434_100016297 3300006871 Bacteria 7142
49 Ga0075434_100167499 3300006871 Bacteria 2217
50 Ga0075429_100000519 3300006880 Bacteria 29246
51 Ga0075429_100163313 3300006880 Bacteria 1951
52 Ga0075436_100011363 3300006914 Bacteria 6112
53 Ga0075435_100042731 3300007076 Bacteria 3626
54 Ga0111539_10011885 3300009094 Bacteria 10912
55 Ga0111539_10029996 3300009094 Bacteria 6616
56 Ga0111539_10245067 3300009094 Bacteria 2086
57 Ga0111539_10310156 3300009094 Bacteria 1836
58 Ga0111539_10409880 3300009094 Unclassified 1578
59 Ga0111539_10422958 3300009094 Bacteria 1552
60 Ga0105245_10106434 3300009098 Bacteria 2602
61 Ga0114129_10060411 3300009147 Bacteria 5300
62 Ga0114129_10296131 3300009147 Bacteria 2158
63 Ga0114129_10693728 3300009147 Bacteria 1309
64 Ga0105238_10375494 3300009551 Unclassified 1412
65 Ga0157369_10380147 3300013105 Bacteria 1466
66 Ga0157378_10130219 3300013297 Bacteria 2328
67 Ga0163163_10133483 3300014325 Bacteria 2523
68 Ga0157380_10403379 3300014326 Bacteria 1298
69 Ga0213873_10001066 3300021358 Bacteria 4462
70 Ga0213873_10010487 3300021358 Bacteria 1955
71 Ga0213876_10001999 3300021384 Bacteria 12203
72 Ga0207645_10139862 3300025907 Unclassified 1577
73 Ga0207693_10195925 3300025915 Bacteria 1589
74 Ga0207662_10095862 3300025918 Bacteria 1832
75 Ga0207649_10201126 3300025920 Bacteria 1407
76 Ga0207652_10273796 3300025921 Bacteria 1523
77 Ga0207706_10083612 3300025933 Bacteria 2806
78 Ga0207691_10146060 3300025940 Bacteria 2082
79 Ga0207691_10225620 3300025940 Bacteria 1623
80 Ga0207703_10013207 3300026035 Bacteria 6432
81 Ga0207708_10121893 3300026075 Bacteria 2032
82 Ga0207641_10041692 3300026088 Bacteria 3848
83 Ga0207428_10048712 3300027907 Bacteria 3398
84 Ga0207428_10207345 3300027907 Bacteria 1474
85 Ga0268265_10032832 3300028380 Bacteria 3767
86 Ga0268264_10123734 3300028381 Bacteria 2283
87 Ga0265338_10005510 3300028800 Bacteria 16495
88 Ga0265325_10002772 3300031241 Bacteria 11700
89 Ga0265331_10061141 3300031250 Unclassified 1779
90 Ga0265327_10005463 3300031251 Bacteria 10603
91 Ga0265313_10007168 3300031595 Bacteria 7677
92 Ga0265314_10156532 3300031711 Unclassified 1391
93 Ga0316578_10053841 3300031728 Bacteria 2359
94 Ga0307413_10010531 3300031824 Bacteria 4492
95 Ga0307413_10025840 3300031824 Unclassified 3227
96 Ga0307410_10011920 3300031852 Bacteria 4998
97 Ga0307410_10015588 3300031852 Bacteria 4512
98 Ga0307406_10019583 3300031901 Bacteria 3974
99 Ga0307412_10215270 3300031911 Unclassified 1469
100 Ga0307412_10235107 3300031911 Bacteria 1414
101 Ga0307409_100014951 3300031995 Bacteria 5072
102 Ga0307409_100043992 3300031995 Bacteria 3359
103 Ga0307416_100201165 3300032002 Bacteria 1890
104 Ga0307416_100331819 3300032002 Bacteria 1529
105 Ga0307414_10023347 3300032004 Bacteria 3922
106 Ga0307414_10047325 3300032004 Bacteria 2959
107 Ga0307414_10373689 3300032004 Archaea 1230
108 Ga0307411_10007075 3300032005 Bacteria 5678
109 Ga0373926_0010781 3300035083 Bacteria 3068
110 Ga0373943_0016409 3300035170 Bacteria 3377
111 Ga0373943_0049361 3300035170 Bacteria 2065
112 Ga0373946_0067618 3300035171 Bacteria 1535
113 Ga0316574_0008413 3300035398 Bacteria 5726
114 Ga0373935_0008636 3300035692 Bacteria 6099
115 Ga0373927_0008995 3300035695 Bacteria 6705
116 Ga0373937_0077118 3300036401 Bacteria 3079
117 Ga0373937_0232380 3300036401 Bacteria 1737
118 Ga0436365_1079424 3300039437 Bacteria 15088
119 Ga0436362_0264477 3300039453 Bacteria 8564
120 Ga0436362_0708775 3300039453 Bacteria 9302
121 Ga0495582_0036918 3300046473 Bacteria 2688
122 Ga0495639_0031045 3300046475 Bacteria 2377
123 Ga0495608_0049128 3300046511 Bacteria 2801
124 Ga0495618_0140360 3300046514 Bacteria 1546
125 Ga0495630_0009329 3300046517 Bacteria 7056
126 Ga0495634_0030738 3300046642 Bacteria 3705
127 Ga0495613_0005337 3300046689 Bacteria 9655
128 Ga0495600_0082376 3300046809 Bacteria 2100
129 Ga0495676_0105226 3300047321 Bacteria 2081
130 Ga0495676_0140792 3300047321 Bacteria 1729
131 Ga0496100_0005013 3300048903 Bacteria 7084
132 Ga0496102_0004931 3300048905 Bacteria 11309
133 Ga0496104_0034034 3300048907 Bacteria 4749
134 Ga0496105_0034906 3300048908 Bacteria 4138
135 Ga0496107_0018382 3300048910 Bacteria 4922
136 Ga0496112_0016406 3300048915 Bacteria 6938
137 Ga0496112_0145544 3300048915 Bacteria 2338
138 Ga0496115_0003580 3300048918 Bacteria 11172
139 Ga0496126_0000039 3300048929 Bacteria 347353
140 Ga0496126_0155171 3300048929 Bacteria 1960
141 Ga0501033_0009784 3300049570 Bacteria 7364
142 Ga0501034_0030520 3300049571 Bacteria 5479
143 Ga0501036_0120997 3300049572 Bacteria 2211
144 Ga0501043_0149475 3300049579 Bacteria 1828
145 Ga0501047_0026437 3300049581 Bacteria 5583
146 Ga0501068_0020574 3300049584 Bacteria 3846
147 Ga0501068_0101884 3300049584 Bacteria 1780
148 Ga0501070_0045579 3300049586 Bacteria 3647
149 Ga0501071_0203675 3300049587 Bacteria 1487
150 Ga0501075_0119023 3300049591 Bacteria 2009
151 Ga0501080_0024891 3300049742 Bacteria 5552
152 Ga0501080_0427165 3300049742 Bacteria 1190
153 Ga0501044_0015098 3300049823 Bacteria 8322
154 nmdc:mga03683_14134_c1 3300050489 Bacteria 2950
155 nmdc:mga03n38_117560_c1 3300050490 Bacteria 1303
156 nmdc:mga03n38_3014_c1 3300050490 Bacteria 5334
157 nmdc:mga00v17_16887_c1 3300050491 Bacteria 4121
158 nmdc:mga0yw44_201316_c1 3300050492 Bacteria 1315
159 nmdc:mga0yw44_21522_c1 3300050492 Bacteria 3599
160 nmdc:mga06z11_105897_c1 3300050494 Unclassified 1550
161 nmdc:mga05p37_284809_c1 3300050507 Bacteria 1969
162 nmdc:mga09592_160729_c1 3300050508 Bacteria 1940
163 nmdc:mga09592_29220_c1 3300050508 Bacteria 4585
164 nmdc:mga09592_3739_c1 3300050508 Bacteria 12269
165 nmdc:mga09592_71449_c1 3300050508 Bacteria 2945
166 nmdc:mga0qj67_100794_c1 3300050509 Bacteria 2328
167 nmdc:mga0qj67_148358_c1 3300050509 Bacteria 1902
168 nmdc:mga0qj67_148512_c1 3300050509 Bacteria 1901
169 nmdc:mga0qj67_2101_c1 3300050509 Bacteria 7139
170 nmdc:mga06r32_391_c1 3300050510 Bacteria 36907
171 nmdc:mga06r32_48894_c1 3300050510 Bacteria 4044
172 nmdc:mga06r32_5820_c1 3300050510 Bacteria 11106
173 nmdc:mga08y16_295181_c1 3300050511 Bacteria 1671
174 nmdc:mga08y16_327455_c1 3300050511 Bacteria 1576
175 nmdc:mga08y16_350471_c1 3300050511 Bacteria 1516
176 nmdc:mga08y16_496722_c1 3300050511 Bacteria 1240
177 nmdc:mga08y16_50014_c1 3300050511 Bacteria 4374
178 nmdc:mga0n895_436972_c1 3300050512 Bacteria 1322
179 nmdc:mga0n895_49374_c1 3300050512 Bacteria 4122
180 nmdc:mga0a205_3809_c1 3300050515 Bacteria 13520
181 nmdc:mga0sz30_23697_c1 3300050516 Bacteria 2074
182 Ga0500568_0075563 3300053139 Bacteria 1284
183 Ga0500616_0000141 3300053153 Bacteria 122164
184 Ga0500616_0007196 3300053153 Bacteria 7116

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048915 Ga0496112_0145544 Ga0496112_0145544_1362_2324 317
2 3300050507 nmdc:mga05p37_284809_c1 nmdc:mga05p37_284809_c1_982_1953 321
3 3300048908 Ga0496105_0034906 Ga0496105_0034906_3145_4128 322
4 3300048929 Ga0496126_0155171 Ga0496126_0155171_171_1274 354
5 3300025918 Ga0207662_10095862 Ga0207662_100958622 355
6 3300005548 Ga0070665_100254199 Ga0070665_1002541993 360
7 3300005843 Ga0068860_100260051 Ga0068860_1002600512 360
8 3300006871 Ga0075434_100167499 Ga0075434_1001674992 360
9 3300035083 Ga0373926_0010781 Ga0373926_0010781_1253_2344 360
10 3300035170 Ga0373943_0016409 Ga0373943_0016409_1396_2484 360
11 3300035170 Ga0373943_0049361 Ga0373943_0049361_364_1455 360
12 3300035171 Ga0373946_0067618 Ga0373946_0067618_82_1173 360
13 3300035692 Ga0373935_0008636 Ga0373935_0008636_4645_5736 360
14 3300035695 Ga0373927_0008995 Ga0373927_0008995_537_1628 360
15 3300036401 Ga0373937_0077118 Ga0373937_0077118_1253_2344 360
16 3300005563 Ga0068855_100307635 Ga0068855_1003076351 363
17 3300005468 Ga0070707_100160197 Ga0070707_1001601972 364
18 3300005518 Ga0070699_100077501 Ga0070699_1000775012 364
19 3300005937 Ga0081455_10067373 Ga0081455_100673733 364
20 3300006844 Ga0075428_100148546 Ga0075428_1001485462 364
21 3300006846 Ga0075430_100139832 Ga0075430_1001398322 364
22 3300006852 Ga0075433_10010293 Ga0075433_100102933 364
23 3300006871 Ga0075434_100016297 Ga0075434_1000162973 364
24 3300006914 Ga0075436_100011363 Ga0075436_1000113637 364
25 3300007076 Ga0075435_100042731 Ga0075435_1000427312 364
26 3300009094 Ga0111539_10029996 Ga0111539_100299963 364
27 3300009094 Ga0111539_10245067 Ga0111539_102450671 364
28 3300009094 Ga0111539_10409880 Ga0111539_104098802 364
29 3300009094 Ga0111539_10422958 Ga0111539_104229582 364
30 3300009147 Ga0114129_10296131 Ga0114129_102961313 364
31 3300009147 Ga0114129_10693728 Ga0114129_106937281 364
32 3300025933 Ga0207706_10083612 Ga0207706_100836123 364
33 3300025940 Ga0207691_10146060 Ga0207691_101460602 364
34 3300027907 Ga0207428_10207345 Ga0207428_102073452 364
35 3300028380 Ga0268265_10032832 Ga0268265_100328324 364
36 3300031728 Ga0316578_10053841 Ga0316578_100538412 364
37 3300035398 Ga0316574_0008413 Ga0316574_0008413_4095_5204 364
38 3300046475 Ga0495639_0031045 Ga0495639_0031045_380_1474 364
39 3300050508 nmdc:mga09592_29220_c1 nmdc:mga09592_29220_c1_2589_3692 364
40 3300050508 nmdc:mga09592_71449_c1 nmdc:mga09592_71449_c1_1768_2868 364
41 3300050511 nmdc:mga08y16_295181_c1 nmdc:mga08y16_295181_c1_80_1174 364
42 3300050511 nmdc:mga08y16_496722_c1 nmdc:mga08y16_496722_c1_73_1176 364
43 3300050512 nmdc:mga0n895_49374_c1 nmdc:mga0n895_49374_c1_2841_3944 364
44 3300050515 nmdc:mga0a205_3809_c1 nmdc:mga0a205_3809_c1_4587_5690 364
45 3300005356 Ga0070674_100171796 Ga0070674_1001717962 365
46 3300005356 Ga0070674_100232402 Ga0070674_1002324022 365
47 3300005367 Ga0070667_100041068 Ga0070667_1000410683 365
48 3300005445 Ga0070708_100003605 Ga0070708_10000360510 365
49 3300005530 Ga0070679_100338847 Ga0070679_1003388471 365
50 3300005843 Ga0068860_100098997 Ga0068860_1000989972 365
51 3300005937 Ga0081455_10042382 Ga0081455_100423822 365
52 3300005937 Ga0081455_10278288 Ga0081455_102782881 365
53 3300005981 Ga0081538_10065314 Ga0081538_100653141 365
54 3300006038 Ga0075365_10019196 Ga0075365_100191964 365
55 3300006038 Ga0075365_10081013 Ga0075365_100810132 365
56 3300006038 Ga0075365_10164199 Ga0075365_101641992 365
57 3300006042 Ga0075368_10072522 Ga0075368_100725221 365
58 3300006048 Ga0075363_100077036 Ga0075363_1000770362 365
59 3300006051 Ga0075364_10001109 Ga0075364_1000110915 365
60 3300006177 Ga0075362_10030941 Ga0075362_100309413 365
61 3300006178 Ga0075367_10052226 Ga0075367_100522263 365
62 3300006178 Ga0075367_10098941 Ga0075367_100989412 365
63 3300006353 Ga0075370_10005650 Ga0075370_100056502 365
64 3300006844 Ga0075428_100025354 Ga0075428_1000253543 365
65 3300006844 Ga0075428_100026164 Ga0075428_1000261643 365
66 3300006844 Ga0075428_100030334 Ga0075428_1000303341 365
67 3300006844 Ga0075428_100031949 Ga0075428_1000319492 365
68 3300006846 Ga0075430_100002254 Ga0075430_10000225416 365
69 3300006846 Ga0075430_100026818 Ga0075430_1000268183 365
70 3300006846 Ga0075430_100156980 Ga0075430_1001569802 365
71 3300006847 Ga0075431_100000272 Ga0075431_10000027219 365
72 3300006847 Ga0075431_100001368 Ga0075431_10000136819 365
73 3300006847 Ga0075431_100071718 Ga0075431_1000717182 365
74 3300006847 Ga0075431_100147621 Ga0075431_1001476212 365
75 3300006880 Ga0075429_100000519 Ga0075429_1000005196 365
76 3300006880 Ga0075429_100163313 Ga0075429_1001633132 365
77 3300009094 Ga0111539_10011885 Ga0111539_100118856 365
78 3300009094 Ga0111539_10310156 Ga0111539_103101561 365
79 3300009098 Ga0105245_10106434 Ga0105245_101064342 365
80 3300009147 Ga0114129_10060411 Ga0114129_100604114 365
81 3300009551 Ga0105238_10375494 Ga0105238_103754942 365
82 3300013297 Ga0157378_10130219 Ga0157378_101302192 365
83 3300014326 Ga0157380_10403379 Ga0157380_104033791 365
84 3300021358 Ga0213873_10010487 Ga0213873_100104872 365
85 3300021384 Ga0213876_10001999 Ga0213876_100019992 365
86 3300025907 Ga0207645_10139862 Ga0207645_101398622 365
87 3300025920 Ga0207649_10201126 Ga0207649_102011262 365
88 3300025921 Ga0207652_10273796 Ga0207652_102737961 365
89 3300025940 Ga0207691_10225620 Ga0207691_102256202 365
90 3300026075 Ga0207708_10121893 Ga0207708_101218932 365
91 3300026088 Ga0207641_10041692 Ga0207641_100416923 365
92 3300027907 Ga0207428_10048712 Ga0207428_100487123 365
93 3300028381 Ga0268264_10123734 Ga0268264_101237342 365
94 3300028800 Ga0265338_10005510 Ga0265338_100055109 365
95 3300031241 Ga0265325_10002772 Ga0265325_100027725 365
96 3300031250 Ga0265331_10061141 Ga0265331_100611412 365
97 3300031595 Ga0265313_10007168 Ga0265313_100071689 365
98 3300031711 Ga0265314_10156532 Ga0265314_101565322 365
99 3300031824 Ga0307413_10010531 Ga0307413_100105314 365
100 3300031824 Ga0307413_10025840 Ga0307413_100258405 365
101 3300031852 Ga0307410_10011920 Ga0307410_100119205 365
102 3300031852 Ga0307410_10015588 Ga0307410_100155884 365
103 3300031901 Ga0307406_10019583 Ga0307406_100195834 365
104 3300031911 Ga0307412_10215270 Ga0307412_102152701 365
105 3300031995 Ga0307409_100043992 Ga0307409_1000439922 365
106 3300032002 Ga0307416_100331819 Ga0307416_1003318192 365
107 3300032004 Ga0307414_10047325 Ga0307414_100473253 365
108 3300032004 Ga0307414_10373689 Ga0307414_103736891 365
109 3300032005 Ga0307411_10007075 Ga0307411_100070754 365
110 3300039437 Ga0436365_1079424 Ga0436365_1079424_5132_6235 365
111 3300039453 Ga0436362_0708775 Ga0436362_0708775_3101_4207 365
112 3300046473 Ga0495582_0036918 Ga0495582_0036918_1132_2235 365
113 3300046511 Ga0495608_0049128 Ga0495608_0049128_631_1734 365
114 3300046514 Ga0495618_0140360 Ga0495618_0140360_283_1386 365
115 3300046517 Ga0495630_0009329 Ga0495630_0009329_1112_2215 365
116 3300046642 Ga0495634_0030738 Ga0495634_0030738_1761_2864 365
117 3300046689 Ga0495613_0005337 Ga0495613_0005337_6925_8028 365
118 3300046809 Ga0495600_0082376 Ga0495600_0082376_664_1767 365
119 3300047321 Ga0495676_0105226 Ga0495676_0105226_965_2071 365
120 3300047321 Ga0495676_0140792 Ga0495676_0140792_378_1484 365
121 3300048915 Ga0496112_0016406 Ga0496112_0016406_2585_3691 365
122 3300048929 Ga0496126_0000039 Ga0496126_0000039_86430_87533 365
123 3300049584 Ga0501068_0020574 Ga0501068_0020574_2175_3278 365
124 3300049584 Ga0501068_0101884 Ga0501068_0101884_136_1239 365
125 3300049587 Ga0501071_0203675 Ga0501071_0203675_178_1293 365
126 3300049591 Ga0501075_0119023 Ga0501075_0119023_291_1394 365
127 3300049742 Ga0501080_0427165 Ga0501080_0427165_73_1176 365
128 3300050489 nmdc:mga03683_14134_c1 nmdc:mga03683_14134_c1_1571_2674 365
129 3300050490 nmdc:mga03n38_117560_c1 nmdc:mga03n38_117560_c1_96_1199 365
130 3300050491 nmdc:mga00v17_16887_c1 nmdc:mga00v17_16887_c1_444_1547 365
131 3300050492 nmdc:mga0yw44_201316_c1 nmdc:mga0yw44_201316_c1_200_1303 365
132 3300050492 nmdc:mga0yw44_21522_c1 nmdc:mga0yw44_21522_c1_335_1438 365
133 3300050494 nmdc:mga06z11_105897_c1 nmdc:mga06z11_105897_c1_15_1118 365
134 3300050508 nmdc:mga09592_160729_c1 nmdc:mga09592_160729_c1_452_1579 365
135 3300050508 nmdc:mga09592_3739_c1 nmdc:mga09592_3739_c1_4471_5574 365
136 3300050509 nmdc:mga0qj67_100794_c1 nmdc:mga0qj67_100794_c1_357_1463 365
137 3300050509 nmdc:mga0qj67_148358_c1 nmdc:mga0qj67_148358_c1_376_1473 365
138 3300050509 nmdc:mga0qj67_148512_c1 nmdc:mga0qj67_148512_c1_141_1247 365
139 3300050509 nmdc:mga0qj67_2101_c1 nmdc:mga0qj67_2101_c1_3168_4271 365
140 3300050510 nmdc:mga06r32_391_c1 nmdc:mga06r32_391_c1_24659_25762 365
141 3300050510 nmdc:mga06r32_48894_c1 nmdc:mga06r32_48894_c1_2277_3395 365
142 3300050510 nmdc:mga06r32_48894_c1 nmdc:mga06r32_48894_c1_578_1675 365
143 3300050510 nmdc:mga06r32_5820_c1 nmdc:mga06r32_5820_c1_1752_2858 365
144 3300050511 nmdc:mga08y16_327455_c1 nmdc:mga08y16_327455_c1_13_1116 365
145 3300050511 nmdc:mga08y16_350471_c1 nmdc:mga08y16_350471_c1_159_1313 365
146 3300050511 nmdc:mga08y16_50014_c1 nmdc:mga08y16_50014_c1_665_1768 365
147 3300050516 nmdc:mga0sz30_23697_c1 nmdc:mga0sz30_23697_c1_424_1527 365
148 3300053153 Ga0500616_0007196 Ga0500616_0007196_3622_4728 365
149 3300005355 Ga0070671_100008160 Ga0070671_1000081608 366
150 3300005434 Ga0070709_10040545 Ga0070709_100405454 366
151 3300005458 Ga0070681_10092791 Ga0070681_100927912 366
152 3300005467 Ga0070706_100005551 Ga0070706_1000055515 366
153 3300005518 Ga0070699_100190708 Ga0070699_1001907082 366
154 3300005842 Ga0068858_100001769 Ga0068858_1000017695 366
155 3300006048 Ga0075363_100003000 Ga0075363_1000030003 366
156 3300006178 Ga0075367_10116892 Ga0075367_101168922 366
157 3300013105 Ga0157369_10380147 Ga0157369_103801471 366
158 3300014325 Ga0163163_10133483 Ga0163163_101334833 366
159 3300021358 Ga0213873_10001066 Ga0213873_100010665 366
160 3300025915 Ga0207693_10195925 Ga0207693_101959252 366
161 3300026035 Ga0207703_10013207 Ga0207703_100132073 366
162 3300031251 Ga0265327_10005463 Ga0265327_100054636 366
163 3300031911 Ga0307412_10235107 Ga0307412_102351071 366
164 3300031995 Ga0307409_100014951 Ga0307409_1000149514 366
165 3300032002 Ga0307416_100201165 Ga0307416_1002011652 366
166 3300032004 Ga0307414_10023347 Ga0307414_100233474 366
167 3300036401 Ga0373937_0232380 Ga0373937_0232380_569_1684 366
168 3300039453 Ga0436362_0264477 Ga0436362_0264477_4426_5526 366
169 3300048903 Ga0496100_0005013 Ga0496100_0005013_485_1600 366
170 3300048905 Ga0496102_0004931 Ga0496102_0004931_1033_2148 366
171 3300048907 Ga0496104_0034034 Ga0496104_0034034_2137_3252 366
172 3300048910 Ga0496107_0018382 Ga0496107_0018382_3534_4649 366
173 3300048918 Ga0496115_0003580 Ga0496115_0003580_4497_5612 366
174 3300049570 Ga0501033_0009784 Ga0501033_0009784_5023_6126 366
175 3300049571 Ga0501034_0030520 Ga0501034_0030520_950_2065 366
176 3300049572 Ga0501036_0120997 Ga0501036_0120997_655_1758 366
177 3300049579 Ga0501043_0149475 Ga0501043_0149475_676_1791 366
178 3300049581 Ga0501047_0026437 Ga0501047_0026437_2127_3242 366
179 3300049586 Ga0501070_0045579 Ga0501070_0045579_1943_3058 366
180 3300049742 Ga0501080_0024891 Ga0501080_0024891_1466_2581 366
181 3300049823 Ga0501044_0015098 Ga0501044_0015098_2368_3471 366
182 3300050490 nmdc:mga03n38_3014_c1 nmdc:mga03n38_3014_c1_3542_4648 366
183 3300050512 nmdc:mga0n895_436972_c1 nmdc:mga0n895_436972_c1_76_1191 366
184 3300053139 Ga0500568_0075563 Ga0500568_0075563_13_1122 366
185 3300053153 Ga0500616_0000141 Ga0500616_0000141_60225_61334 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

20

358

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.864 1 366
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8615 1 366
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.8602 2 363
1luc-assembly1.cif.gz_A bacterial luciferase 0.8391 1 366
1xkj-assembly1.cif.gz_B bacterial luciferase beta2 homodimer 0.8387 1 366
ID Description Score Start End Superfamily
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8646 1 364 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8487 1 363 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8297 1 363 3.20.20.30
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8284 60 366 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8247 1 364 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A537YM69-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9901 46 366 GO:0004497
GO:0005829
GO:0016705
AF-A0A537YM69-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.984 46 366 GO:0004497
GO:0005829
GO:0016705
AF-A0A2V6X228-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9697 1 189 GO:0004497
GO:0005829
GO:0016705
AF-A0A3D0IAB0-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9642 1 179 GO:0004497
GO:0005829
GO:0016705
AF-A0A2V6X228-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9547 1 189 GO:0004497
GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
93.06 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map