F283975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 185 | 134 | 185 | 238 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100365622|Ga0070699_1003656222 |
| Length | 270 |
| Sequence | VIGRKRKPSNGESGATMGTTGNGNGAHASAPLLELDGVSRRYQMGSETIHALRDVNFTVHRGEYVAIIGTSGSGKSTLLNLLGCLDTPSEGAYRLRGRDVRGLDDDALSDLRNREIGFVFQTFQLLSRTSALENVELPLVYRGVGRRQRRERARAALARVGLADRMRHRPNELSGGQRQRVAIARALVTEPSILLADEPTGNLDSATGREILQLFMELHAGGNTLILVTHEPAIAAQCPRAIRMSDGRIISDGAGQHVAAELTLSAAVAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 5 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 35 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 69 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 71 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 72 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 73 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 74 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 75 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 76 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 77 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 78 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 79 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 80 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 81 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 82 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 83 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 84 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 85 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 86 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 88 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 89 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 90 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 91 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 92 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 94 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 95 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 96 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 97 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 98 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 99 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 100 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 101 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 102 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 103 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 116 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 120 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 122 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 123 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 124 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 125 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 126 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 127 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 128 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 129 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 131 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 132 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 133 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 134 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.08 |
| Nodule | 0 |
| Rhizoplane | 0.54 |
| Rhizosphere | 96.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10103947 | 3300005327 | Bacteria | 2349 |
| 2 | Ga0070666_10018611 | 3300005335 | Bacteria | 4470 |
| 3 | Ga0070682_100019720 | 3300005337 | Bacteria | 3959 |
| 4 | Ga0068868_100105776 | 3300005338 | Bacteria | 2282 |
| 5 | Ga0070689_100132498 | 3300005340 | Bacteria | 1999 |
| 6 | Ga0070689_100211066 | 3300005340 | Bacteria | 1589 |
| 7 | Ga0070689_100344419 | 3300005340 | Bacteria | 1249 |
| 8 | Ga0070671_100000509 | 3300005355 | Bacteria | 27161 |
| 9 | Ga0070688_100177212 | 3300005365 | Bacteria | 1476 |
| 10 | Ga0070688_100534684 | 3300005365 | Bacteria | 889 |
| 11 | Ga0070714_100003451 | 3300005435 | Bacteria | 11783 |
| 12 | Ga0070713_100693057 | 3300005436 | Bacteria | 972 |
| 13 | Ga0070701_10343401 | 3300005438 | Bacteria | 930 |
| 14 | Ga0070711_100355734 | 3300005439 | Bacteria | 1178 |
| 15 | Ga0070700_100560439 | 3300005441 | Bacteria | 889 |
| 16 | Ga0070708_100101987 | 3300005445 | Bacteria | 2629 |
| 17 | Ga0070663_100006850 | 3300005455 | Bacteria | 6895 |
| 18 | Ga0070678_100744563 | 3300005456 | Bacteria | 886 |
| 19 | Ga0070681_10103997 | 3300005458 | Bacteria | 2783 |
| 20 | Ga0070685_10033952 | 3300005466 | Bacteria | 2870 |
| 21 | Ga0070706_100158555 | 3300005467 | Bacteria | 2113 |
| 22 | Ga0070706_100309254 | 3300005467 | Bacteria | 1474 |
| 23 | Ga0070707_100268405 | 3300005468 | Bacteria | 1659 |
| 24 | Ga0070698_100013338 | 3300005471 | Bacteria | 8699 |
| 25 | Ga0070698_100025304 | 3300005471 | Bacteria | 6186 |
| 26 | Ga0070698_100047564 | 3300005471 | Bacteria | 4385 |
| 27 | Ga0070699_100365622 | 3300005518 | Bacteria | 1301 |
| 28 | Ga0070684_100082549 | 3300005535 | Bacteria | 2846 |
| 29 | Ga0070697_100128353 | 3300005536 | Bacteria | 2125 |
| 30 | Ga0070672_100185642 | 3300005543 | Bacteria | 1734 |
| 31 | Ga0070672_100242878 | 3300005543 | Bacteria | 1515 |
| 32 | Ga0070686_100006854 | 3300005544 | Bacteria | 6344 |
| 33 | Ga0070696_100159709 | 3300005546 | Bacteria | 1660 |
| 34 | Ga0070704_100016511 | 3300005549 | Bacteria | 4667 |
| 35 | Ga0070704_100084583 | 3300005549 | Bacteria | 2346 |
| 36 | Ga0070704_100613764 | 3300005549 | Bacteria | 957 |
| 37 | Ga0068855_100361599 | 3300005563 | Bacteria | 1597 |
| 38 | Ga0068856_100027147 | 3300005614 | Bacteria | 5586 |
| 39 | Ga0068859_100072686 | 3300005617 | Bacteria | 3476 |
| 40 | Ga0068859_100171621 | 3300005617 | Bacteria | 2250 |
| 41 | Ga0068864_100053688 | 3300005618 | Bacteria | 3477 |
| 42 | Ga0068863_100158855 | 3300005841 | Bacteria | 2165 |
| 43 | Ga0068863_100161292 | 3300005841 | Bacteria | 2148 |
| 44 | Ga0068863_100194659 | 3300005841 | Bacteria | 1949 |
| 45 | Ga0070717_10032517 | 3300006028 | Bacteria | 4204 |
| 46 | Ga0070717_10054367 | 3300006028 | Bacteria | 3302 |
| 47 | Ga0068871_100638380 | 3300006358 | Bacteria | 971 |
| 48 | Ga0075434_100110639 | 3300006871 | Bacteria | 2758 |
| 49 | Ga0075434_100706408 | 3300006871 | Bacteria | 1026 |
| 50 | Ga0097620_100072686 | 3300006931 | Bacteria | 3476 |
| 51 | Ga0097620_100171635 | 3300006931 | Bacteria | 2250 |
| 52 | Ga0105240_10086519 | 3300009093 | Bacteria | 3839 |
| 53 | Ga0105240_10104697 | 3300009093 | Bacteria | 3436 |
| 54 | Ga0111539_10002147 | 3300009094 | Bacteria | 26379 |
| 55 | Ga0105243_10211467 | 3300009148 | Bacteria | 1708 |
| 56 | Ga0105242_10706418 | 3300009176 | Bacteria | 987 |
| 57 | Ga0105238_10005049 | 3300009551 | Bacteria | 13046 |
| 58 | Ga0105238_10125394 | 3300009551 | Bacteria | 2547 |
| 59 | Ga0105238_10251340 | 3300009551 | Bacteria | 1746 |
| 60 | Ga0105249_10336084 | 3300009553 | Bacteria | 1526 |
| 61 | Ga0157372_10411531 | 3300013307 | Bacteria | 1576 |
| 62 | Ga0157372_10483755 | 3300013307 | Bacteria | 1443 |
| 63 | Ga0157375_10000040 | 3300013308 | Bacteria | 164344 |
| 64 | Ga0157375_10285657 | 3300013308 | Bacteria | 1813 |
| 65 | Ga0163163_10097426 | 3300014325 | Bacteria | 2961 |
| 66 | Ga0163163_10947620 | 3300014325 | Bacteria | 924 |
| 67 | Ga0157380_10002822 | 3300014326 | Bacteria | 11813 |
| 68 | Ga0157380_10066237 | 3300014326 | Bacteria | 2905 |
| 69 | Ga0157379_10160058 | 3300014968 | Bacteria | 2032 |
| 70 | Ga0207684_10145346 | 3300025910 | Bacteria | 2040 |
| 71 | Ga0207684_10255555 | 3300025910 | Bacteria | 1512 |
| 72 | Ga0207657_10188556 | 3300025919 | Bacteria | 1665 |
| 73 | Ga0207652_10107080 | 3300025921 | Bacteria | 2476 |
| 74 | Ga0207646_10100154 | 3300025922 | Bacteria | 2597 |
| 75 | Ga0207700_10316791 | 3300025928 | Bacteria | 1351 |
| 76 | Ga0207700_10338107 | 3300025928 | Bacteria | 1308 |
| 77 | Ga0207664_10032045 | 3300025929 | Bacteria | 4027 |
| 78 | Ga0207644_10008617 | 3300025931 | Bacteria | 6671 |
| 79 | Ga0207706_10143350 | 3300025933 | Bacteria | 2102 |
| 80 | Ga0207686_10109525 | 3300025934 | Bacteria | 1860 |
| 81 | Ga0207670_10016732 | 3300025936 | Bacteria | 4415 |
| 82 | Ga0207670_10203460 | 3300025936 | Bacteria | 1506 |
| 83 | Ga0207670_10247043 | 3300025936 | Bacteria | 1377 |
| 84 | Ga0207711_10775186 | 3300025941 | Bacteria | 893 |
| 85 | Ga0207689_10075368 | 3300025942 | Bacteria | 2773 |
| 86 | Ga0207667_10152904 | 3300025949 | Bacteria | 2375 |
| 87 | Ga0207651_10271404 | 3300025960 | Bacteria | 1397 |
| 88 | Ga0207712_10121143 | 3300025961 | Bacteria | 1979 |
| 89 | Ga0207677_10653281 | 3300026023 | Bacteria | 928 |
| 90 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 91 | Ga0207678_10003446 | 3300026067 | Bacteria | 14247 |
| 92 | Ga0207702_10343581 | 3300026078 | Bacteria | 1426 |
| 93 | Ga0207641_10152430 | 3300026088 | Bacteria | 2094 |
| 94 | Ga0207428_10019324 | 3300027907 | Bacteria | 5809 |
| 95 | Ga0268264_10447648 | 3300028381 | Bacteria | 1251 |
| 96 | Ga0265337_1021380 | 3300028556 | Bacteria | 2017 |
| 97 | Ga0265326_10017938 | 3300028558 | Bacteria | 2039 |
| 98 | Ga0265319_1006707 | 3300028563 | Bacteria | 5291 |
| 99 | Ga0265334_10001045 | 3300028573 | Bacteria | 13647 |
| 100 | Ga0265334_10002411 | 3300028573 | Bacteria | 8791 |
| 101 | Ga0265334_10023036 | 3300028573 | Bacteria | 2535 |
| 102 | Ga0265334_10106712 | 3300028573 | Bacteria | 1009 |
| 103 | Ga0265318_10000002 | 3300028577 | Bacteria | 428208 |
| 104 | Ga0265318_10000802 | 3300028577 | Bacteria | 20838 |
| 105 | Ga0265323_10010951 | 3300028653 | Bacteria | 3670 |
| 106 | Ga0265338_10012699 | 3300028800 | Bacteria | 9585 |
| 107 | Ga0265338_10022441 | 3300028800 | Bacteria | 6534 |
| 108 | Ga0265338_10089655 | 3300028800 | Bacteria | 2548 |
| 109 | Ga0265324_10010590 | 3300029957 | Bacteria | 3547 |
| 110 | Ga0265324_10012549 | 3300029957 | Bacteria | 3191 |
| 111 | Ga0265324_10021333 | 3300029957 | Bacteria | 2323 |
| 112 | Ga0265324_10028394 | 3300029957 | Bacteria | 1974 |
| 113 | Ga0265324_10072807 | 3300029957 | Bacteria | 1170 |
| 114 | Ga0265330_10092174 | 3300031235 | Bacteria | 1300 |
| 115 | Ga0265332_10070825 | 3300031238 | Bacteria | 1485 |
| 116 | Ga0265320_10007750 | 3300031240 | Bacteria | 6633 |
| 117 | Ga0265320_10009152 | 3300031240 | Bacteria | 5995 |
| 118 | Ga0265320_10048539 | 3300031240 | Bacteria | 2071 |
| 119 | Ga0265325_10013484 | 3300031241 | Bacteria | 4653 |
| 120 | Ga0265339_10059082 | 3300031249 | Bacteria | 2068 |
| 121 | Ga0265339_10192010 | 3300031249 | Bacteria | 1012 |
| 122 | Ga0265331_10016764 | 3300031250 | Bacteria | 3838 |
| 123 | Ga0265331_10075823 | 3300031250 | Bacteria | 1568 |
| 124 | Ga0265316_10003141 | 3300031344 | Bacteria | 16804 |
| 125 | Ga0265316_10083831 | 3300031344 | Bacteria | 2442 |
| 126 | Ga0307513_10259058 | 3300031456 | Bacteria | 1530 |
| 127 | Ga0265313_10001890 | 3300031595 | Bacteria | 19029 |
| 128 | Ga0307508_10042355 | 3300031616 | Bacteria | 4085 |
| 129 | Ga0265314_10003608 | 3300031711 | Bacteria | 14888 |
| 130 | Ga0265314_10007100 | 3300031711 | Bacteria | 9767 |
| 131 | Ga0265314_10059541 | 3300031711 | Bacteria | 2612 |
| 132 | Ga0265342_10027598 | 3300031712 | Bacteria | 3544 |
| 133 | Ga0307413_10097776 | 3300031824 | Bacteria | 1931 |
| 134 | Ga0373934_0193413 | 3300035086 | Bacteria | 837 |
| 135 | Ga0373955_0026904 | 3300035172 | Bacteria | 2968 |
| 136 | Ga0373931_0158236 | 3300035691 | Bacteria | 1326 |
| 137 | Ga0373927_0364307 | 3300035695 | Bacteria | 953 |
| 138 | Ga0373937_0186172 | 3300036401 | Bacteria | 1950 |
| 139 | Ga0400486_14568 | 3300038742 | Bacteria | 1401 |
| 140 | Ga0400489_92808 | 3300039093 | Bacteria | 2800 |
| 141 | Ga0451795_0625305 | 3300041456 | Bacteria | 1721 |
| 142 | Ga0451577_0156355 | 3300042876 | Bacteria | 2052 |
| 143 | Ga0453683_0001306 | 3300044673 | Bacteria | 21969 |
| 144 | Ga0453684_0019330 | 3300044712 | Bacteria | 10378 |
| 145 | Ga0453684_0161208 | 3300044712 | Bacteria | 2653 |
| 146 | Ga0453684_0240618 | 3300044712 | Bacteria | 2083 |
| 147 | Ga0451576_0058488 | 3300045051 | Bacteria | 4028 |
| 148 | Ga0451576_0094820 | 3300045051 | Bacteria | 3104 |
| 149 | Ga0451576_0212911 | 3300045051 | Bacteria | 2018 |
| 150 | Ga0451576_0374501 | 3300045051 | Bacteria | 1492 |
| 151 | Ga0451576_0397973 | 3300045051 | Bacteria | 1444 |
| 152 | Ga0495641_0033529 | 3300046461 | Bacteria | 2436 |
| 153 | Ga0495651_0138746 | 3300046462 | Bacteria | 1766 |
| 154 | Ga0495662_0032764 | 3300046476 | Bacteria | 2511 |
| 155 | Ga0495630_0116931 | 3300046517 | Bacteria | 2021 |
| 156 | Ga0495666_0054033 | 3300046526 | Bacteria | 1927 |
| 157 | Ga0495640_0184602 | 3300046533 | Bacteria | 1328 |
| 158 | Ga0495586_0299278 | 3300046535 | Bacteria | 921 |
| 159 | Ga0495634_0035767 | 3300046642 | Bacteria | 3399 |
| 160 | Ga0495613_0312385 | 3300046689 | Bacteria | 1086 |
| 161 | Ga0495680_0235588 | 3300047322 | Bacteria | 1302 |
| 162 | Ga0501032_0009564 | 3300049569 | Bacteria | 7029 |
| 163 | Ga0501033_0045143 | 3300049570 | Bacteria | 3280 |
| 164 | Ga0501037_0450105 | 3300049573 | Bacteria | 878 |
| 165 | Ga0501043_0164258 | 3300049579 | Bacteria | 1734 |
| 166 | Ga0501046_0416149 | 3300049580 | Bacteria | 969 |
| 167 | Ga0501047_0200026 | 3300049581 | Bacteria | 1859 |
| 168 | Ga0501047_0280863 | 3300049581 | Bacteria | 1510 |
| 169 | Ga0501070_0152596 | 3300049586 | Bacteria | 1905 |
| 170 | Ga0501070_0490558 | 3300049586 | Bacteria | 987 |
| 171 | Ga0501071_0127403 | 3300049587 | Bacteria | 1890 |
| 172 | Ga0501073_0038418 | 3300049589 | Bacteria | 3395 |
| 173 | Ga0501216_000081 | 3300049660 | Bacteria | 8802 |
| 174 | Ga0501227_002282 | 3300049665 | Bacteria | 4239 |
| 175 | Ga0501233_010798 | 3300049668 | Bacteria | 1806 |
| 176 | Ga0501081_0397599 | 3300049743 | Bacteria | 1020 |
| 177 | Ga0501083_0350722 | 3300049744 | Bacteria | 959 |
| 178 | Ga0501035_0017567 | 3300049822 | Bacteria | 6601 |
| 179 | Ga0501044_0010390 | 3300049823 | Bacteria | 10100 |
| 180 | nmdc:mga08y16_2061_c1 | 3300050511 | Bacteria | 20596 |
| 181 | nmdc:mga0n895_214609_c1 | 3300050512 | Bacteria | 1954 |
| 182 | nmdc:mga0rr50_279049_c1 | 3300050513 | Bacteria | 1394 |
| 183 | Ga0500568_0085563 | 3300053139 | Bacteria | 1193 |
| 184 | Ga0500636_0111629 | 3300053177 | Bacteria | 1544 |
| 185 | Ga0501084_0057253 | 3300054114 | Bacteria | 3262 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049581 | Ga0501047_0280863 | Ga0501047_0280863_11_601 | 176 |
| 2 | 3300049569 | Ga0501032_0009564 | Ga0501032_0009564_6086_6796 | 214 |
| 3 | 3300049570 | Ga0501033_0045143 | Ga0501033_0045143_919_1629 | 214 |
| 4 | 3300049573 | Ga0501037_0450105 | Ga0501037_0450105_31_741 | 214 |
| 5 | 3300049579 | Ga0501043_0164258 | Ga0501043_0164258_775_1485 | 214 |
| 6 | 3300049580 | Ga0501046_0416149 | Ga0501046_0416149_157_867 | 214 |
| 7 | 3300049822 | Ga0501035_0017567 | Ga0501035_0017567_5098_5808 | 214 |
| 8 | 3300049823 | Ga0501044_0010390 | Ga0501044_0010390_2437_3147 | 214 |
| 9 | 3300050511 | nmdc:mga08y16_2061_c1 | nmdc:mga08y16_2061_c1_11996_12673 | 218 |
| 10 | 3300039093 | Ga0400489_92808 | Ga0400489_92808_344_1045 | 220 |
| 11 | 3300014326 | Ga0157380_10002822 | Ga0157380_100028229 | 222 |
| 12 | 3300031824 | Ga0307413_10097776 | Ga0307413_100977762 | 222 |
| 13 | 3300038742 | Ga0400486_14568 | Ga0400486_14568_325_999 | 224 |
| 14 | 3300042876 | Ga0451577_0156355 | Ga0451577_0156355_32_751 | 224 |
| 15 | 3300014325 | Ga0163163_10947620 | Ga0163163_109476202 | 225 |
| 16 | 3300049586 | Ga0501070_0152596 | Ga0501070_0152596_104_823 | 225 |
| 17 | 3300025910 | Ga0207684_10255555 | Ga0207684_102555552 | 226 |
| 18 | 3300049586 | Ga0501070_0490558 | Ga0501070_0490558_165_884 | 226 |
| 19 | 3300049587 | Ga0501071_0127403 | Ga0501071_0127403_464_1183 | 226 |
| 20 | 3300053177 | Ga0500636_0111629 | Ga0500636_0111629_624_1304 | 226 |
| 21 | 3300005436 | Ga0070713_100693057 | Ga0070713_1006930572 | 227 |
| 22 | 3300005458 | Ga0070681_10103997 | Ga0070681_101039972 | 227 |
| 23 | 3300014326 | Ga0157380_10066237 | Ga0157380_100662371 | 227 |
| 24 | 3300025921 | Ga0207652_10107080 | Ga0207652_101070801 | 227 |
| 25 | 3300025928 | Ga0207700_10316791 | Ga0207700_103167912 | 227 |
| 26 | 3300028563 | Ga0265319_1006707 | Ga0265319_10067072 | 227 |
| 27 | 3300028573 | Ga0265334_10002411 | Ga0265334_100024116 | 227 |
| 28 | 3300028577 | Ga0265318_10000002 | Ga0265318_10000002274 | 227 |
| 29 | 3300028577 | Ga0265318_10000802 | Ga0265318_1000080220 | 227 |
| 30 | 3300028800 | Ga0265338_10022441 | Ga0265338_100224413 | 227 |
| 31 | 3300029957 | Ga0265324_10010590 | Ga0265324_100105902 | 227 |
| 32 | 3300031240 | Ga0265320_10007750 | Ga0265320_100077502 | 227 |
| 33 | 3300031240 | Ga0265320_10009152 | Ga0265320_100091522 | 227 |
| 34 | 3300031249 | Ga0265339_10192010 | Ga0265339_101920102 | 227 |
| 35 | 3300031250 | Ga0265331_10016764 | Ga0265331_100167644 | 227 |
| 36 | 3300031344 | Ga0265316_10083831 | Ga0265316_100838312 | 227 |
| 37 | 3300031595 | Ga0265313_10001890 | Ga0265313_1000189015 | 227 |
| 38 | 3300031711 | Ga0265314_10003608 | Ga0265314_100036086 | 227 |
| 39 | 3300005340 | Ga0070689_100344419 | Ga0070689_1003444192 | 228 |
| 40 | 3300005365 | Ga0070688_100177212 | Ga0070688_1001772122 | 228 |
| 41 | 3300005549 | Ga0070704_100613764 | Ga0070704_1006137641 | 228 |
| 42 | 3300005841 | Ga0068863_100158855 | Ga0068863_1001588552 | 228 |
| 43 | 3300025936 | Ga0207670_10016732 | Ga0207670_100167321 | 228 |
| 44 | 3300026041 | Ga0207639_10000001 | Ga0207639_1000000198 | 228 |
| 45 | 3300026088 | Ga0207641_10152430 | Ga0207641_101524302 | 228 |
| 46 | 3300029957 | Ga0265324_10012549 | Ga0265324_100125491 | 228 |
| 47 | 3300029957 | Ga0265324_10028394 | Ga0265324_100283942 | 228 |
| 48 | 3300029957 | Ga0265324_10072807 | Ga0265324_100728072 | 228 |
| 49 | 3300031238 | Ga0265332_10070825 | Ga0265332_100708251 | 228 |
| 50 | 3300031711 | Ga0265314_10059541 | Ga0265314_100595413 | 228 |
| 51 | 3300047322 | Ga0495680_0235588 | Ga0495680_0235588_212_898 | 228 |
| 52 | 3300049743 | Ga0501081_0397599 | Ga0501081_0397599_230_916 | 228 |
| 53 | 3300026078 | Ga0207702_10343581 | Ga0207702_103435812 | 229 |
| 54 | 3300049581 | Ga0501047_0200026 | Ga0501047_0200026_391_1080 | 229 |
| 55 | 3300005337 | Ga0070682_100019720 | Ga0070682_1000197204 | 230 |
| 56 | 3300005340 | Ga0070689_100211066 | Ga0070689_1002110662 | 230 |
| 57 | 3300005355 | Ga0070671_100000509 | Ga0070671_10000050914 | 230 |
| 58 | 3300005438 | Ga0070701_10343401 | Ga0070701_103434011 | 230 |
| 59 | 3300005445 | Ga0070708_100101987 | Ga0070708_1001019872 | 230 |
| 60 | 3300005455 | Ga0070663_100006850 | Ga0070663_1000068503 | 230 |
| 61 | 3300005466 | Ga0070685_10033952 | Ga0070685_100339522 | 230 |
| 62 | 3300005467 | Ga0070706_100158555 | Ga0070706_1001585552 | 230 |
| 63 | 3300005536 | Ga0070697_100128353 | Ga0070697_1001283532 | 230 |
| 64 | 3300005543 | Ga0070672_100242878 | Ga0070672_1002428781 | 230 |
| 65 | 3300005563 | Ga0068855_100361599 | Ga0068855_1003615992 | 230 |
| 66 | 3300009093 | Ga0105240_10104697 | Ga0105240_101046973 | 230 |
| 67 | 3300009551 | Ga0105238_10005049 | Ga0105238_100050496 | 230 |
| 68 | 3300009551 | Ga0105238_10251340 | Ga0105238_102513402 | 230 |
| 69 | 3300013307 | Ga0157372_10483755 | Ga0157372_104837552 | 230 |
| 70 | 3300025910 | Ga0207684_10145346 | Ga0207684_101453462 | 230 |
| 71 | 3300025931 | Ga0207644_10008617 | Ga0207644_100086172 | 230 |
| 72 | 3300025933 | Ga0207706_10143350 | Ga0207706_101433502 | 230 |
| 73 | 3300025934 | Ga0207686_10109525 | Ga0207686_101095252 | 230 |
| 74 | 3300025936 | Ga0207670_10203460 | Ga0207670_102034602 | 230 |
| 75 | 3300025949 | Ga0207667_10152904 | Ga0207667_101529042 | 230 |
| 76 | 3300026067 | Ga0207678_10003446 | Ga0207678_1000344610 | 230 |
| 77 | 3300005467 | Ga0070706_100309254 | Ga0070706_1003092542 | 231 |
| 78 | 3300005468 | Ga0070707_100268405 | Ga0070707_1002684052 | 231 |
| 79 | 3300005471 | Ga0070698_100047564 | Ga0070698_1000475642 | 231 |
| 80 | 3300005546 | Ga0070696_100159709 | Ga0070696_1001597092 | 231 |
| 81 | 3300005617 | Ga0068859_100171621 | Ga0068859_1001716212 | 231 |
| 82 | 3300006931 | Ga0097620_100171635 | Ga0097620_1001716352 | 231 |
| 83 | 3300009148 | Ga0105243_10211467 | Ga0105243_102114672 | 231 |
| 84 | 3300009553 | Ga0105249_10336084 | Ga0105249_103360842 | 231 |
| 85 | 3300013308 | Ga0157375_10285657 | Ga0157375_102856572 | 231 |
| 86 | 3300025922 | Ga0207646_10100154 | Ga0207646_101001543 | 231 |
| 87 | 3300025961 | Ga0207712_10121143 | Ga0207712_101211432 | 231 |
| 88 | 3300028381 | Ga0268264_10447648 | Ga0268264_104476482 | 231 |
| 89 | 3300041456 | Ga0451795_0625305 | Ga0451795_0625305_662_1360 | 231 |
| 90 | 3300005327 | Ga0070658_10103947 | Ga0070658_101039472 | 232 |
| 91 | 3300005335 | Ga0070666_10018611 | Ga0070666_100186114 | 232 |
| 92 | 3300005338 | Ga0068868_100105776 | Ga0068868_1001057761 | 232 |
| 93 | 3300005340 | Ga0070689_100132498 | Ga0070689_1001324982 | 232 |
| 94 | 3300005365 | Ga0070688_100534684 | Ga0070688_1005346841 | 232 |
| 95 | 3300005435 | Ga0070714_100003451 | Ga0070714_1000034515 | 232 |
| 96 | 3300005439 | Ga0070711_100355734 | Ga0070711_1003557342 | 232 |
| 97 | 3300005441 | Ga0070700_100560439 | Ga0070700_1005604391 | 232 |
| 98 | 3300005456 | Ga0070678_100744563 | Ga0070678_1007445631 | 232 |
| 99 | 3300005471 | Ga0070698_100013338 | Ga0070698_1000133383 | 232 |
| 100 | 3300005471 | Ga0070698_100025304 | Ga0070698_1000253042 | 232 |
| 101 | 3300005518 | Ga0070699_100365622 | Ga0070699_1003656222 | 232 |
| 102 | 3300005535 | Ga0070684_100082549 | Ga0070684_1000825492 | 232 |
| 103 | 3300005543 | Ga0070672_100185642 | Ga0070672_1001856421 | 232 |
| 104 | 3300005544 | Ga0070686_100006854 | Ga0070686_1000068543 | 232 |
| 105 | 3300005549 | Ga0070704_100016511 | Ga0070704_1000165112 | 232 |
| 106 | 3300005549 | Ga0070704_100084583 | Ga0070704_1000845832 | 232 |
| 107 | 3300005614 | Ga0068856_100027147 | Ga0068856_1000271476 | 232 |
| 108 | 3300005617 | Ga0068859_100072686 | Ga0068859_1000726862 | 232 |
| 109 | 3300005618 | Ga0068864_100053688 | Ga0068864_1000536882 | 232 |
| 110 | 3300005841 | Ga0068863_100161292 | Ga0068863_1001612922 | 232 |
| 111 | 3300005841 | Ga0068863_100194659 | Ga0068863_1001946592 | 232 |
| 112 | 3300006028 | Ga0070717_10032517 | Ga0070717_100325172 | 232 |
| 113 | 3300006028 | Ga0070717_10054367 | Ga0070717_100543672 | 232 |
| 114 | 3300006358 | Ga0068871_100638380 | Ga0068871_1006383801 | 232 |
| 115 | 3300006871 | Ga0075434_100110639 | Ga0075434_1001106392 | 232 |
| 116 | 3300006871 | Ga0075434_100706408 | Ga0075434_1007064082 | 232 |
| 117 | 3300006931 | Ga0097620_100072686 | Ga0097620_1000726862 | 232 |
| 118 | 3300009093 | Ga0105240_10086519 | Ga0105240_100865193 | 232 |
| 119 | 3300009094 | Ga0111539_10002147 | Ga0111539_100021479 | 232 |
| 120 | 3300009176 | Ga0105242_10706418 | Ga0105242_107064182 | 232 |
| 121 | 3300009551 | Ga0105238_10125394 | Ga0105238_101253942 | 232 |
| 122 | 3300013307 | Ga0157372_10411531 | Ga0157372_104115311 | 232 |
| 123 | 3300013308 | Ga0157375_10000040 | Ga0157375_1000004096 | 232 |
| 124 | 3300014325 | Ga0163163_10097426 | Ga0163163_100974262 | 232 |
| 125 | 3300014968 | Ga0157379_10160058 | Ga0157379_101600582 | 232 |
| 126 | 3300025919 | Ga0207657_10188556 | Ga0207657_101885562 | 232 |
| 127 | 3300025928 | Ga0207700_10338107 | Ga0207700_103381072 | 232 |
| 128 | 3300025929 | Ga0207664_10032045 | Ga0207664_100320452 | 232 |
| 129 | 3300025936 | Ga0207670_10247043 | Ga0207670_102470431 | 232 |
| 130 | 3300025941 | Ga0207711_10775186 | Ga0207711_107751861 | 232 |
| 131 | 3300025942 | Ga0207689_10075368 | Ga0207689_100753681 | 232 |
| 132 | 3300025960 | Ga0207651_10271404 | Ga0207651_102714042 | 232 |
| 133 | 3300026023 | Ga0207677_10653281 | Ga0207677_106532812 | 232 |
| 134 | 3300027907 | Ga0207428_10019324 | Ga0207428_100193244 | 232 |
| 135 | 3300028556 | Ga0265337_1021380 | Ga0265337_10213802 | 232 |
| 136 | 3300028558 | Ga0265326_10017938 | Ga0265326_100179382 | 232 |
| 137 | 3300028573 | Ga0265334_10001045 | Ga0265334_100010456 | 232 |
| 138 | 3300028573 | Ga0265334_10023036 | Ga0265334_100230362 | 232 |
| 139 | 3300028573 | Ga0265334_10106712 | Ga0265334_101067122 | 232 |
| 140 | 3300028653 | Ga0265323_10010951 | Ga0265323_100109512 | 232 |
| 141 | 3300028800 | Ga0265338_10012699 | Ga0265338_100126992 | 232 |
| 142 | 3300028800 | Ga0265338_10089655 | Ga0265338_100896553 | 232 |
| 143 | 3300029957 | Ga0265324_10021333 | Ga0265324_100213332 | 232 |
| 144 | 3300031235 | Ga0265330_10092174 | Ga0265330_100921742 | 232 |
| 145 | 3300031240 | Ga0265320_10048539 | Ga0265320_100485392 | 232 |
| 146 | 3300031241 | Ga0265325_10013484 | Ga0265325_100134843 | 232 |
| 147 | 3300031249 | Ga0265339_10059082 | Ga0265339_100590822 | 232 |
| 148 | 3300031250 | Ga0265331_10075823 | Ga0265331_100758232 | 232 |
| 149 | 3300031344 | Ga0265316_10003141 | Ga0265316_100031413 | 232 |
| 150 | 3300031456 | Ga0307513_10259058 | Ga0307513_102590582 | 232 |
| 151 | 3300031616 | Ga0307508_10042355 | Ga0307508_100423552 | 232 |
| 152 | 3300031711 | Ga0265314_10007100 | Ga0265314_100071003 | 232 |
| 153 | 3300031712 | Ga0265342_10027598 | Ga0265342_100275982 | 232 |
| 154 | 3300035086 | Ga0373934_0193413 | Ga0373934_0193413_87_797 | 232 |
| 155 | 3300035172 | Ga0373955_0026904 | Ga0373955_0026904_226_1011 | 232 |
| 156 | 3300035691 | Ga0373931_0158236 | Ga0373931_0158236_33_758 | 232 |
| 157 | 3300035695 | Ga0373927_0364307 | Ga0373927_0364307_98_835 | 232 |
| 158 | 3300036401 | Ga0373937_0186172 | Ga0373937_0186172_153_938 | 232 |
| 159 | 3300044673 | Ga0453683_0001306 | Ga0453683_0001306_20943_21671 | 232 |
| 160 | 3300044712 | Ga0453684_0019330 | Ga0453684_0019330_7095_7823 | 232 |
| 161 | 3300044712 | Ga0453684_0161208 | Ga0453684_0161208_1059_1787 | 232 |
| 162 | 3300044712 | Ga0453684_0240618 | Ga0453684_0240618_705_1433 | 232 |
| 163 | 3300045051 | Ga0451576_0058488 | Ga0451576_0058488_1909_2634 | 232 |
| 164 | 3300045051 | Ga0451576_0094820 | Ga0451576_0094820_38_787 | 232 |
| 165 | 3300045051 | Ga0451576_0212911 | Ga0451576_0212911_235_969 | 232 |
| 166 | 3300045051 | Ga0451576_0374501 | Ga0451576_0374501_24_755 | 232 |
| 167 | 3300045051 | Ga0451576_0397973 | Ga0451576_0397973_615_1400 | 232 |
| 168 | 3300046461 | Ga0495641_0033529 | Ga0495641_0033529_61_768 | 232 |
| 169 | 3300046462 | Ga0495651_0138746 | Ga0495651_0138746_97_882 | 232 |
| 170 | 3300046476 | Ga0495662_0032764 | Ga0495662_0032764_832_1539 | 232 |
| 171 | 3300046517 | Ga0495630_0116931 | Ga0495630_0116931_295_1002 | 232 |
| 172 | 3300046526 | Ga0495666_0054033 | Ga0495666_0054033_1192_1899 | 232 |
| 173 | 3300046533 | Ga0495640_0184602 | Ga0495640_0184602_122_829 | 232 |
| 174 | 3300046535 | Ga0495586_0299278 | Ga0495586_0299278_103_810 | 232 |
| 175 | 3300046642 | Ga0495634_0035767 | Ga0495634_0035767_1545_2252 | 232 |
| 176 | 3300046689 | Ga0495613_0312385 | Ga0495613_0312385_101_808 | 232 |
| 177 | 3300049589 | Ga0501073_0038418 | Ga0501073_0038418_238_942 | 232 |
| 178 | 3300049660 | Ga0501216_000081 | Ga0501216_000081_3386_4123 | 232 |
| 179 | 3300049665 | Ga0501227_002282 | Ga0501227_002282_157_894 | 232 |
| 180 | 3300049668 | Ga0501233_010798 | Ga0501233_010798_128_865 | 232 |
| 181 | 3300049744 | Ga0501083_0350722 | Ga0501083_0350722_171_875 | 232 |
| 182 | 3300050512 | nmdc:mga0n895_214609_c1 | nmdc:mga0n895_214609_c1_544_1293 | 232 |
| 183 | 3300050513 | nmdc:mga0rr50_279049_c1 | nmdc:mga0rr50_279049_c1_609_1331 | 232 |
| 184 | 3300053139 | Ga0500568_0085563 | Ga0500568_0085563_183_920 | 232 |
| 185 | 3300054114 | Ga0501084_0057253 | Ga0501084_0057253_421_1125 | 232 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9842 | 1 | 224 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.982 | 1 | 224 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9766 | 3 | 228 |
| 5ws4-assembly1.cif.gz_B | crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii | 0.9733 | 1 | 229 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.971 | 1 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9842 | 1 | 224 | 3.40.50.300 |
| af_Q8T665_1_248_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9791 | 1 | 227 | 3.40.50.300 |
| af_A4I4M8_123_401_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9776 | 30 | 227 | 3.40.50.300 |
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.971 | 1 | 224 | 3.40.50.300 |
| af_Q4DP20_46_317_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9703 | 1 | 225 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K3MSC0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9928 | 1 | 225 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A2V7LEA9-F1-model_v4 | ABC transporter domain-containing protein | 0.9909 | 2 | 225 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A1Q6ERV0-F1-model_v4 | deleted | 0.9889 | 7 | 227 |
|
| AF-A0A7X4CR54-F1-model_v4 | deleted | 0.9879 | 3 | 226 |
|
| AF-A0A843RV41-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9858 | 1 | 230 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar