F283975

General Info

Members Datasets Scaffolds Average Seq Length
185 134 185 238

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100365622|Ga0070699_1003656222
Length 270
Sequence VIGRKRKPSNGESGATMGTTGNGNGAHASAPLLELDGVSRRYQMGSETIHALRDVNFTVHRGEYVAIIGTSGSGKSTLLNLLGCLDTPSEGAYRLRGRDVRGLDDDALSDLRNREIGFVFQTFQLLSRTSALENVELPLVYRGVGRRQRRERARAALARVGLADRMRHRPNELSGGQRQRVAIARALVTEPSILLADEPTGNLDSATGREILQLFMELHAGGNTLILVTHEPAIAAQCPRAIRMSDGRIISDGAGQHVAAELTLSAAVAT

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
71 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
72 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
73 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
74 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
75 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
78 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
81 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
88 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
89 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
90 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
91 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
96 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
97 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
98 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
99 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
100 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
101 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
112 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
123 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
124 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
125 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
126 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
134 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 0.54
Rhizosphere 96.22
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10103947 3300005327 Bacteria 2349
2 Ga0070666_10018611 3300005335 Bacteria 4470
3 Ga0070682_100019720 3300005337 Bacteria 3959
4 Ga0068868_100105776 3300005338 Bacteria 2282
5 Ga0070689_100132498 3300005340 Bacteria 1999
6 Ga0070689_100211066 3300005340 Bacteria 1589
7 Ga0070689_100344419 3300005340 Bacteria 1249
8 Ga0070671_100000509 3300005355 Bacteria 27161
9 Ga0070688_100177212 3300005365 Bacteria 1476
10 Ga0070688_100534684 3300005365 Bacteria 889
11 Ga0070714_100003451 3300005435 Bacteria 11783
12 Ga0070713_100693057 3300005436 Bacteria 972
13 Ga0070701_10343401 3300005438 Bacteria 930
14 Ga0070711_100355734 3300005439 Bacteria 1178
15 Ga0070700_100560439 3300005441 Bacteria 889
16 Ga0070708_100101987 3300005445 Bacteria 2629
17 Ga0070663_100006850 3300005455 Bacteria 6895
18 Ga0070678_100744563 3300005456 Bacteria 886
19 Ga0070681_10103997 3300005458 Bacteria 2783
20 Ga0070685_10033952 3300005466 Bacteria 2870
21 Ga0070706_100158555 3300005467 Bacteria 2113
22 Ga0070706_100309254 3300005467 Bacteria 1474
23 Ga0070707_100268405 3300005468 Bacteria 1659
24 Ga0070698_100013338 3300005471 Bacteria 8699
25 Ga0070698_100025304 3300005471 Bacteria 6186
26 Ga0070698_100047564 3300005471 Bacteria 4385
27 Ga0070699_100365622 3300005518 Bacteria 1301
28 Ga0070684_100082549 3300005535 Bacteria 2846
29 Ga0070697_100128353 3300005536 Bacteria 2125
30 Ga0070672_100185642 3300005543 Bacteria 1734
31 Ga0070672_100242878 3300005543 Bacteria 1515
32 Ga0070686_100006854 3300005544 Bacteria 6344
33 Ga0070696_100159709 3300005546 Bacteria 1660
34 Ga0070704_100016511 3300005549 Bacteria 4667
35 Ga0070704_100084583 3300005549 Bacteria 2346
36 Ga0070704_100613764 3300005549 Bacteria 957
37 Ga0068855_100361599 3300005563 Bacteria 1597
38 Ga0068856_100027147 3300005614 Bacteria 5586
39 Ga0068859_100072686 3300005617 Bacteria 3476
40 Ga0068859_100171621 3300005617 Bacteria 2250
41 Ga0068864_100053688 3300005618 Bacteria 3477
42 Ga0068863_100158855 3300005841 Bacteria 2165
43 Ga0068863_100161292 3300005841 Bacteria 2148
44 Ga0068863_100194659 3300005841 Bacteria 1949
45 Ga0070717_10032517 3300006028 Bacteria 4204
46 Ga0070717_10054367 3300006028 Bacteria 3302
47 Ga0068871_100638380 3300006358 Bacteria 971
48 Ga0075434_100110639 3300006871 Bacteria 2758
49 Ga0075434_100706408 3300006871 Bacteria 1026
50 Ga0097620_100072686 3300006931 Bacteria 3476
51 Ga0097620_100171635 3300006931 Bacteria 2250
52 Ga0105240_10086519 3300009093 Bacteria 3839
53 Ga0105240_10104697 3300009093 Bacteria 3436
54 Ga0111539_10002147 3300009094 Bacteria 26379
55 Ga0105243_10211467 3300009148 Bacteria 1708
56 Ga0105242_10706418 3300009176 Bacteria 987
57 Ga0105238_10005049 3300009551 Bacteria 13046
58 Ga0105238_10125394 3300009551 Bacteria 2547
59 Ga0105238_10251340 3300009551 Bacteria 1746
60 Ga0105249_10336084 3300009553 Bacteria 1526
61 Ga0157372_10411531 3300013307 Bacteria 1576
62 Ga0157372_10483755 3300013307 Bacteria 1443
63 Ga0157375_10000040 3300013308 Bacteria 164344
64 Ga0157375_10285657 3300013308 Bacteria 1813
65 Ga0163163_10097426 3300014325 Bacteria 2961
66 Ga0163163_10947620 3300014325 Bacteria 924
67 Ga0157380_10002822 3300014326 Bacteria 11813
68 Ga0157380_10066237 3300014326 Bacteria 2905
69 Ga0157379_10160058 3300014968 Bacteria 2032
70 Ga0207684_10145346 3300025910 Bacteria 2040
71 Ga0207684_10255555 3300025910 Bacteria 1512
72 Ga0207657_10188556 3300025919 Bacteria 1665
73 Ga0207652_10107080 3300025921 Bacteria 2476
74 Ga0207646_10100154 3300025922 Bacteria 2597
75 Ga0207700_10316791 3300025928 Bacteria 1351
76 Ga0207700_10338107 3300025928 Bacteria 1308
77 Ga0207664_10032045 3300025929 Bacteria 4027
78 Ga0207644_10008617 3300025931 Bacteria 6671
79 Ga0207706_10143350 3300025933 Bacteria 2102
80 Ga0207686_10109525 3300025934 Bacteria 1860
81 Ga0207670_10016732 3300025936 Bacteria 4415
82 Ga0207670_10203460 3300025936 Bacteria 1506
83 Ga0207670_10247043 3300025936 Bacteria 1377
84 Ga0207711_10775186 3300025941 Bacteria 893
85 Ga0207689_10075368 3300025942 Bacteria 2773
86 Ga0207667_10152904 3300025949 Bacteria 2375
87 Ga0207651_10271404 3300025960 Bacteria 1397
88 Ga0207712_10121143 3300025961 Bacteria 1979
89 Ga0207677_10653281 3300026023 Bacteria 928
90 Ga0207639_10000001 3300026041 Bacteria 1431562
91 Ga0207678_10003446 3300026067 Bacteria 14247
92 Ga0207702_10343581 3300026078 Bacteria 1426
93 Ga0207641_10152430 3300026088 Bacteria 2094
94 Ga0207428_10019324 3300027907 Bacteria 5809
95 Ga0268264_10447648 3300028381 Bacteria 1251
96 Ga0265337_1021380 3300028556 Bacteria 2017
97 Ga0265326_10017938 3300028558 Bacteria 2039
98 Ga0265319_1006707 3300028563 Bacteria 5291
99 Ga0265334_10001045 3300028573 Bacteria 13647
100 Ga0265334_10002411 3300028573 Bacteria 8791
101 Ga0265334_10023036 3300028573 Bacteria 2535
102 Ga0265334_10106712 3300028573 Bacteria 1009
103 Ga0265318_10000002 3300028577 Bacteria 428208
104 Ga0265318_10000802 3300028577 Bacteria 20838
105 Ga0265323_10010951 3300028653 Bacteria 3670
106 Ga0265338_10012699 3300028800 Bacteria 9585
107 Ga0265338_10022441 3300028800 Bacteria 6534
108 Ga0265338_10089655 3300028800 Bacteria 2548
109 Ga0265324_10010590 3300029957 Bacteria 3547
110 Ga0265324_10012549 3300029957 Bacteria 3191
111 Ga0265324_10021333 3300029957 Bacteria 2323
112 Ga0265324_10028394 3300029957 Bacteria 1974
113 Ga0265324_10072807 3300029957 Bacteria 1170
114 Ga0265330_10092174 3300031235 Bacteria 1300
115 Ga0265332_10070825 3300031238 Bacteria 1485
116 Ga0265320_10007750 3300031240 Bacteria 6633
117 Ga0265320_10009152 3300031240 Bacteria 5995
118 Ga0265320_10048539 3300031240 Bacteria 2071
119 Ga0265325_10013484 3300031241 Bacteria 4653
120 Ga0265339_10059082 3300031249 Bacteria 2068
121 Ga0265339_10192010 3300031249 Bacteria 1012
122 Ga0265331_10016764 3300031250 Bacteria 3838
123 Ga0265331_10075823 3300031250 Bacteria 1568
124 Ga0265316_10003141 3300031344 Bacteria 16804
125 Ga0265316_10083831 3300031344 Bacteria 2442
126 Ga0307513_10259058 3300031456 Bacteria 1530
127 Ga0265313_10001890 3300031595 Bacteria 19029
128 Ga0307508_10042355 3300031616 Bacteria 4085
129 Ga0265314_10003608 3300031711 Bacteria 14888
130 Ga0265314_10007100 3300031711 Bacteria 9767
131 Ga0265314_10059541 3300031711 Bacteria 2612
132 Ga0265342_10027598 3300031712 Bacteria 3544
133 Ga0307413_10097776 3300031824 Bacteria 1931
134 Ga0373934_0193413 3300035086 Bacteria 837
135 Ga0373955_0026904 3300035172 Bacteria 2968
136 Ga0373931_0158236 3300035691 Bacteria 1326
137 Ga0373927_0364307 3300035695 Bacteria 953
138 Ga0373937_0186172 3300036401 Bacteria 1950
139 Ga0400486_14568 3300038742 Bacteria 1401
140 Ga0400489_92808 3300039093 Bacteria 2800
141 Ga0451795_0625305 3300041456 Bacteria 1721
142 Ga0451577_0156355 3300042876 Bacteria 2052
143 Ga0453683_0001306 3300044673 Bacteria 21969
144 Ga0453684_0019330 3300044712 Bacteria 10378
145 Ga0453684_0161208 3300044712 Bacteria 2653
146 Ga0453684_0240618 3300044712 Bacteria 2083
147 Ga0451576_0058488 3300045051 Bacteria 4028
148 Ga0451576_0094820 3300045051 Bacteria 3104
149 Ga0451576_0212911 3300045051 Bacteria 2018
150 Ga0451576_0374501 3300045051 Bacteria 1492
151 Ga0451576_0397973 3300045051 Bacteria 1444
152 Ga0495641_0033529 3300046461 Bacteria 2436
153 Ga0495651_0138746 3300046462 Bacteria 1766
154 Ga0495662_0032764 3300046476 Bacteria 2511
155 Ga0495630_0116931 3300046517 Bacteria 2021
156 Ga0495666_0054033 3300046526 Bacteria 1927
157 Ga0495640_0184602 3300046533 Bacteria 1328
158 Ga0495586_0299278 3300046535 Bacteria 921
159 Ga0495634_0035767 3300046642 Bacteria 3399
160 Ga0495613_0312385 3300046689 Bacteria 1086
161 Ga0495680_0235588 3300047322 Bacteria 1302
162 Ga0501032_0009564 3300049569 Bacteria 7029
163 Ga0501033_0045143 3300049570 Bacteria 3280
164 Ga0501037_0450105 3300049573 Bacteria 878
165 Ga0501043_0164258 3300049579 Bacteria 1734
166 Ga0501046_0416149 3300049580 Bacteria 969
167 Ga0501047_0200026 3300049581 Bacteria 1859
168 Ga0501047_0280863 3300049581 Bacteria 1510
169 Ga0501070_0152596 3300049586 Bacteria 1905
170 Ga0501070_0490558 3300049586 Bacteria 987
171 Ga0501071_0127403 3300049587 Bacteria 1890
172 Ga0501073_0038418 3300049589 Bacteria 3395
173 Ga0501216_000081 3300049660 Bacteria 8802
174 Ga0501227_002282 3300049665 Bacteria 4239
175 Ga0501233_010798 3300049668 Bacteria 1806
176 Ga0501081_0397599 3300049743 Bacteria 1020
177 Ga0501083_0350722 3300049744 Bacteria 959
178 Ga0501035_0017567 3300049822 Bacteria 6601
179 Ga0501044_0010390 3300049823 Bacteria 10100
180 nmdc:mga08y16_2061_c1 3300050511 Bacteria 20596
181 nmdc:mga0n895_214609_c1 3300050512 Bacteria 1954
182 nmdc:mga0rr50_279049_c1 3300050513 Bacteria 1394
183 Ga0500568_0085563 3300053139 Bacteria 1193
184 Ga0500636_0111629 3300053177 Bacteria 1544
185 Ga0501084_0057253 3300054114 Bacteria 3262

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049581 Ga0501047_0280863 Ga0501047_0280863_11_601 176
2 3300049569 Ga0501032_0009564 Ga0501032_0009564_6086_6796 214
3 3300049570 Ga0501033_0045143 Ga0501033_0045143_919_1629 214
4 3300049573 Ga0501037_0450105 Ga0501037_0450105_31_741 214
5 3300049579 Ga0501043_0164258 Ga0501043_0164258_775_1485 214
6 3300049580 Ga0501046_0416149 Ga0501046_0416149_157_867 214
7 3300049822 Ga0501035_0017567 Ga0501035_0017567_5098_5808 214
8 3300049823 Ga0501044_0010390 Ga0501044_0010390_2437_3147 214
9 3300050511 nmdc:mga08y16_2061_c1 nmdc:mga08y16_2061_c1_11996_12673 218
10 3300039093 Ga0400489_92808 Ga0400489_92808_344_1045 220
11 3300014326 Ga0157380_10002822 Ga0157380_100028229 222
12 3300031824 Ga0307413_10097776 Ga0307413_100977762 222
13 3300038742 Ga0400486_14568 Ga0400486_14568_325_999 224
14 3300042876 Ga0451577_0156355 Ga0451577_0156355_32_751 224
15 3300014325 Ga0163163_10947620 Ga0163163_109476202 225
16 3300049586 Ga0501070_0152596 Ga0501070_0152596_104_823 225
17 3300025910 Ga0207684_10255555 Ga0207684_102555552 226
18 3300049586 Ga0501070_0490558 Ga0501070_0490558_165_884 226
19 3300049587 Ga0501071_0127403 Ga0501071_0127403_464_1183 226
20 3300053177 Ga0500636_0111629 Ga0500636_0111629_624_1304 226
21 3300005436 Ga0070713_100693057 Ga0070713_1006930572 227
22 3300005458 Ga0070681_10103997 Ga0070681_101039972 227
23 3300014326 Ga0157380_10066237 Ga0157380_100662371 227
24 3300025921 Ga0207652_10107080 Ga0207652_101070801 227
25 3300025928 Ga0207700_10316791 Ga0207700_103167912 227
26 3300028563 Ga0265319_1006707 Ga0265319_10067072 227
27 3300028573 Ga0265334_10002411 Ga0265334_100024116 227
28 3300028577 Ga0265318_10000002 Ga0265318_10000002274 227
29 3300028577 Ga0265318_10000802 Ga0265318_1000080220 227
30 3300028800 Ga0265338_10022441 Ga0265338_100224413 227
31 3300029957 Ga0265324_10010590 Ga0265324_100105902 227
32 3300031240 Ga0265320_10007750 Ga0265320_100077502 227
33 3300031240 Ga0265320_10009152 Ga0265320_100091522 227
34 3300031249 Ga0265339_10192010 Ga0265339_101920102 227
35 3300031250 Ga0265331_10016764 Ga0265331_100167644 227
36 3300031344 Ga0265316_10083831 Ga0265316_100838312 227
37 3300031595 Ga0265313_10001890 Ga0265313_1000189015 227
38 3300031711 Ga0265314_10003608 Ga0265314_100036086 227
39 3300005340 Ga0070689_100344419 Ga0070689_1003444192 228
40 3300005365 Ga0070688_100177212 Ga0070688_1001772122 228
41 3300005549 Ga0070704_100613764 Ga0070704_1006137641 228
42 3300005841 Ga0068863_100158855 Ga0068863_1001588552 228
43 3300025936 Ga0207670_10016732 Ga0207670_100167321 228
44 3300026041 Ga0207639_10000001 Ga0207639_1000000198 228
45 3300026088 Ga0207641_10152430 Ga0207641_101524302 228
46 3300029957 Ga0265324_10012549 Ga0265324_100125491 228
47 3300029957 Ga0265324_10028394 Ga0265324_100283942 228
48 3300029957 Ga0265324_10072807 Ga0265324_100728072 228
49 3300031238 Ga0265332_10070825 Ga0265332_100708251 228
50 3300031711 Ga0265314_10059541 Ga0265314_100595413 228
51 3300047322 Ga0495680_0235588 Ga0495680_0235588_212_898 228
52 3300049743 Ga0501081_0397599 Ga0501081_0397599_230_916 228
53 3300026078 Ga0207702_10343581 Ga0207702_103435812 229
54 3300049581 Ga0501047_0200026 Ga0501047_0200026_391_1080 229
55 3300005337 Ga0070682_100019720 Ga0070682_1000197204 230
56 3300005340 Ga0070689_100211066 Ga0070689_1002110662 230
57 3300005355 Ga0070671_100000509 Ga0070671_10000050914 230
58 3300005438 Ga0070701_10343401 Ga0070701_103434011 230
59 3300005445 Ga0070708_100101987 Ga0070708_1001019872 230
60 3300005455 Ga0070663_100006850 Ga0070663_1000068503 230
61 3300005466 Ga0070685_10033952 Ga0070685_100339522 230
62 3300005467 Ga0070706_100158555 Ga0070706_1001585552 230
63 3300005536 Ga0070697_100128353 Ga0070697_1001283532 230
64 3300005543 Ga0070672_100242878 Ga0070672_1002428781 230
65 3300005563 Ga0068855_100361599 Ga0068855_1003615992 230
66 3300009093 Ga0105240_10104697 Ga0105240_101046973 230
67 3300009551 Ga0105238_10005049 Ga0105238_100050496 230
68 3300009551 Ga0105238_10251340 Ga0105238_102513402 230
69 3300013307 Ga0157372_10483755 Ga0157372_104837552 230
70 3300025910 Ga0207684_10145346 Ga0207684_101453462 230
71 3300025931 Ga0207644_10008617 Ga0207644_100086172 230
72 3300025933 Ga0207706_10143350 Ga0207706_101433502 230
73 3300025934 Ga0207686_10109525 Ga0207686_101095252 230
74 3300025936 Ga0207670_10203460 Ga0207670_102034602 230
75 3300025949 Ga0207667_10152904 Ga0207667_101529042 230
76 3300026067 Ga0207678_10003446 Ga0207678_1000344610 230
77 3300005467 Ga0070706_100309254 Ga0070706_1003092542 231
78 3300005468 Ga0070707_100268405 Ga0070707_1002684052 231
79 3300005471 Ga0070698_100047564 Ga0070698_1000475642 231
80 3300005546 Ga0070696_100159709 Ga0070696_1001597092 231
81 3300005617 Ga0068859_100171621 Ga0068859_1001716212 231
82 3300006931 Ga0097620_100171635 Ga0097620_1001716352 231
83 3300009148 Ga0105243_10211467 Ga0105243_102114672 231
84 3300009553 Ga0105249_10336084 Ga0105249_103360842 231
85 3300013308 Ga0157375_10285657 Ga0157375_102856572 231
86 3300025922 Ga0207646_10100154 Ga0207646_101001543 231
87 3300025961 Ga0207712_10121143 Ga0207712_101211432 231
88 3300028381 Ga0268264_10447648 Ga0268264_104476482 231
89 3300041456 Ga0451795_0625305 Ga0451795_0625305_662_1360 231
90 3300005327 Ga0070658_10103947 Ga0070658_101039472 232
91 3300005335 Ga0070666_10018611 Ga0070666_100186114 232
92 3300005338 Ga0068868_100105776 Ga0068868_1001057761 232
93 3300005340 Ga0070689_100132498 Ga0070689_1001324982 232
94 3300005365 Ga0070688_100534684 Ga0070688_1005346841 232
95 3300005435 Ga0070714_100003451 Ga0070714_1000034515 232
96 3300005439 Ga0070711_100355734 Ga0070711_1003557342 232
97 3300005441 Ga0070700_100560439 Ga0070700_1005604391 232
98 3300005456 Ga0070678_100744563 Ga0070678_1007445631 232
99 3300005471 Ga0070698_100013338 Ga0070698_1000133383 232
100 3300005471 Ga0070698_100025304 Ga0070698_1000253042 232
101 3300005518 Ga0070699_100365622 Ga0070699_1003656222 232
102 3300005535 Ga0070684_100082549 Ga0070684_1000825492 232
103 3300005543 Ga0070672_100185642 Ga0070672_1001856421 232
104 3300005544 Ga0070686_100006854 Ga0070686_1000068543 232
105 3300005549 Ga0070704_100016511 Ga0070704_1000165112 232
106 3300005549 Ga0070704_100084583 Ga0070704_1000845832 232
107 3300005614 Ga0068856_100027147 Ga0068856_1000271476 232
108 3300005617 Ga0068859_100072686 Ga0068859_1000726862 232
109 3300005618 Ga0068864_100053688 Ga0068864_1000536882 232
110 3300005841 Ga0068863_100161292 Ga0068863_1001612922 232
111 3300005841 Ga0068863_100194659 Ga0068863_1001946592 232
112 3300006028 Ga0070717_10032517 Ga0070717_100325172 232
113 3300006028 Ga0070717_10054367 Ga0070717_100543672 232
114 3300006358 Ga0068871_100638380 Ga0068871_1006383801 232
115 3300006871 Ga0075434_100110639 Ga0075434_1001106392 232
116 3300006871 Ga0075434_100706408 Ga0075434_1007064082 232
117 3300006931 Ga0097620_100072686 Ga0097620_1000726862 232
118 3300009093 Ga0105240_10086519 Ga0105240_100865193 232
119 3300009094 Ga0111539_10002147 Ga0111539_100021479 232
120 3300009176 Ga0105242_10706418 Ga0105242_107064182 232
121 3300009551 Ga0105238_10125394 Ga0105238_101253942 232
122 3300013307 Ga0157372_10411531 Ga0157372_104115311 232
123 3300013308 Ga0157375_10000040 Ga0157375_1000004096 232
124 3300014325 Ga0163163_10097426 Ga0163163_100974262 232
125 3300014968 Ga0157379_10160058 Ga0157379_101600582 232
126 3300025919 Ga0207657_10188556 Ga0207657_101885562 232
127 3300025928 Ga0207700_10338107 Ga0207700_103381072 232
128 3300025929 Ga0207664_10032045 Ga0207664_100320452 232
129 3300025936 Ga0207670_10247043 Ga0207670_102470431 232
130 3300025941 Ga0207711_10775186 Ga0207711_107751861 232
131 3300025942 Ga0207689_10075368 Ga0207689_100753681 232
132 3300025960 Ga0207651_10271404 Ga0207651_102714042 232
133 3300026023 Ga0207677_10653281 Ga0207677_106532812 232
134 3300027907 Ga0207428_10019324 Ga0207428_100193244 232
135 3300028556 Ga0265337_1021380 Ga0265337_10213802 232
136 3300028558 Ga0265326_10017938 Ga0265326_100179382 232
137 3300028573 Ga0265334_10001045 Ga0265334_100010456 232
138 3300028573 Ga0265334_10023036 Ga0265334_100230362 232
139 3300028573 Ga0265334_10106712 Ga0265334_101067122 232
140 3300028653 Ga0265323_10010951 Ga0265323_100109512 232
141 3300028800 Ga0265338_10012699 Ga0265338_100126992 232
142 3300028800 Ga0265338_10089655 Ga0265338_100896553 232
143 3300029957 Ga0265324_10021333 Ga0265324_100213332 232
144 3300031235 Ga0265330_10092174 Ga0265330_100921742 232
145 3300031240 Ga0265320_10048539 Ga0265320_100485392 232
146 3300031241 Ga0265325_10013484 Ga0265325_100134843 232
147 3300031249 Ga0265339_10059082 Ga0265339_100590822 232
148 3300031250 Ga0265331_10075823 Ga0265331_100758232 232
149 3300031344 Ga0265316_10003141 Ga0265316_100031413 232
150 3300031456 Ga0307513_10259058 Ga0307513_102590582 232
151 3300031616 Ga0307508_10042355 Ga0307508_100423552 232
152 3300031711 Ga0265314_10007100 Ga0265314_100071003 232
153 3300031712 Ga0265342_10027598 Ga0265342_100275982 232
154 3300035086 Ga0373934_0193413 Ga0373934_0193413_87_797 232
155 3300035172 Ga0373955_0026904 Ga0373955_0026904_226_1011 232
156 3300035691 Ga0373931_0158236 Ga0373931_0158236_33_758 232
157 3300035695 Ga0373927_0364307 Ga0373927_0364307_98_835 232
158 3300036401 Ga0373937_0186172 Ga0373937_0186172_153_938 232
159 3300044673 Ga0453683_0001306 Ga0453683_0001306_20943_21671 232
160 3300044712 Ga0453684_0019330 Ga0453684_0019330_7095_7823 232
161 3300044712 Ga0453684_0161208 Ga0453684_0161208_1059_1787 232
162 3300044712 Ga0453684_0240618 Ga0453684_0240618_705_1433 232
163 3300045051 Ga0451576_0058488 Ga0451576_0058488_1909_2634 232
164 3300045051 Ga0451576_0094820 Ga0451576_0094820_38_787 232
165 3300045051 Ga0451576_0212911 Ga0451576_0212911_235_969 232
166 3300045051 Ga0451576_0374501 Ga0451576_0374501_24_755 232
167 3300045051 Ga0451576_0397973 Ga0451576_0397973_615_1400 232
168 3300046461 Ga0495641_0033529 Ga0495641_0033529_61_768 232
169 3300046462 Ga0495651_0138746 Ga0495651_0138746_97_882 232
170 3300046476 Ga0495662_0032764 Ga0495662_0032764_832_1539 232
171 3300046517 Ga0495630_0116931 Ga0495630_0116931_295_1002 232
172 3300046526 Ga0495666_0054033 Ga0495666_0054033_1192_1899 232
173 3300046533 Ga0495640_0184602 Ga0495640_0184602_122_829 232
174 3300046535 Ga0495586_0299278 Ga0495586_0299278_103_810 232
175 3300046642 Ga0495634_0035767 Ga0495634_0035767_1545_2252 232
176 3300046689 Ga0495613_0312385 Ga0495613_0312385_101_808 232
177 3300049589 Ga0501073_0038418 Ga0501073_0038418_238_942 232
178 3300049660 Ga0501216_000081 Ga0501216_000081_3386_4123 232
179 3300049665 Ga0501227_002282 Ga0501227_002282_157_894 232
180 3300049668 Ga0501233_010798 Ga0501233_010798_128_865 232
181 3300049744 Ga0501083_0350722 Ga0501083_0350722_171_875 232
182 3300050512 nmdc:mga0n895_214609_c1 nmdc:mga0n895_214609_c1_544_1293 232
183 3300050513 nmdc:mga0rr50_279049_c1 nmdc:mga0rr50_279049_c1_609_1331 232
184 3300053139 Ga0500568_0085563 Ga0500568_0085563_183_920 232
185 3300054114 Ga0501084_0057253 Ga0501084_0057253_421_1125 232

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

52

201

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9842 1 224
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.982 1 224
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9766 3 228
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9733 1 229
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.971 1 224
ID Description Score Start End Superfamily
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9842 1 224 3.40.50.300
af_Q8T665_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9791 1 227 3.40.50.300
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9776 30 227 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.971 1 224 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9703 1 225 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7K3MSC0-F1-model_v4 ABC transporter ATP-binding protein 0.9928 1 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A2V7LEA9-F1-model_v4 ABC transporter domain-containing protein 0.9909 2 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A1Q6ERV0-F1-model_v4 deleted 0.9889 7 227
AF-A0A7X4CR54-F1-model_v4 deleted 0.9879 3 226
AF-A0A843RV41-F1-model_v4 ATP-binding cassette domain-containing protein 0.9858 1 230 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
93.79 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map