F283206

General Info

Members Datasets Scaffolds Average Seq Length
184 110 368 205

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0107537|Ga0496102_0107537_203_955
Length 250
Sequence VLTALMTFAAAAALIVLLPGPDTLVVVRNIARGGRARGTATAAGVITGLAVWVVAAALGLSALLRASEVGYNVLRFAGAAYLLWLAVQSFRSRGGVSGADDLAPAGLERAGRFVRNGFSAGLITDLLNPKVGVFFVTFLPAFIPHGAPVGWTTMLLGAVFIGLTVLYFVALLGVARTITDWLARPRTRRRLEVLTGTVLLGFGVRLARIGRAKGPTFPTQVTNRSVALPHGLVCVGPAPYRRLSRFGGIA

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
38 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
40 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
41 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
57 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
58 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
63 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
66 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
75 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
76 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
77 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
78 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
81 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
82 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
83 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
87 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
89 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
90 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
91 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
92 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
93 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
94 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
95 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
96 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
97 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
98 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
99 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
100 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
101 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
104 2508501039 Frankia saprophytica CN3 Isolate Nodule
105 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
106 2687453737 Frankia sp. BMG5.36 Isolate Nodule
107 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
108 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
109 8002775197 Frankia nepalensis CN7 Isolate Nodule
110 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.48
Metatranscriptomes 2.72
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 2.72
Rhizoplane 2.17
Rhizosphere 91.85
Stem 0
Stem Tuber 0
Unclassified 4.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0107537 3300048905 Bacteria 2597
2 JGI24735J21928_10005764 3300002067 Bacteria 4097
3 JGI24735J21928_10155414 3300002067 Bacteria 661
4 Ga0070658_10199015 3300005327 Bacteria 1690
5 Ga0070658_10239660 3300005327 Bacteria 1537
6 Ga0070658_10433849 3300005327 Bacteria 1131
7 Ga0070683_100554167 3300005329 Bacteria 1099
8 Ga0070690_100307670 3300005330 Bacteria 1138
9 Ga0068869_100155546 3300005334 Bacteria 1776
10 Ga0070680_100304383 3300005336 Bacteria 1352
11 Ga0070680_100308010 3300005336 Bacteria 1343
12 Ga0070682_100897132 3300005337 Unclassified 728
13 Ga0070660_100007089 3300005339 Bacteria 7789
14 Ga0070660_100080780 3300005339 Bacteria 2552
15 Ga0070659_100001900 3300005366 Bacteria 14943
16 Ga0070659_100450436 3300005366 Bacteria 1092
17 Ga0070713_100515190 3300005436 Bacteria 1130
18 Ga0070698_100651740 3300005471 Bacteria 994
19 Ga0070699_100587358 3300005518 Bacteria 1015
20 Ga0070679_100086523 3300005530 Bacteria 3121
21 Ga0070679_100094165 3300005530 Bacteria 2982
22 Ga0070679_100521606 3300005530 Bacteria 1132
23 Ga0070684_100047205 3300005535 Bacteria 3732
24 Ga0070684_100232165 3300005535 Bacteria 1685
25 Ga0070665_100291195 3300005548 Bacteria 1635
26 Ga0068855_100564584 3300005563 Bacteria 1231
27 Ga0068855_101207945 3300005563 Bacteria 786
28 Ga0068855_101647030 3300005563 Bacteria 655
29 Ga0068856_100191095 3300005614 Bacteria 2061
30 Ga0068856_100193460 3300005614 Bacteria 2048
31 Ga0068852_100447577 3300005616 Unclassified 1278
32 Ga0081455_10011503 3300005937 Bacteria 8888
33 Ga0081540_1102190 3300005983 Bacteria 1232
34 Ga0070717_10731808 3300006028 Bacteria 899
35 Ga0105240_10017407 3300009093 Bacteria 9687
36 Ga0105240_10037820 3300009093 Bacteria 6198
37 Ga0105245_10045984 3300009098 Bacteria 3900
38 Ga0105243_10231862 3300009148 Bacteria 1638
39 Ga0105241_10371201 3300009174 Unclassified 1247
40 Ga0105242_11246312 3300009176 Bacteria 765
41 Ga0105237_10010695 3300009545 Bacteria 9739
42 Ga0105237_10030003 3300009545 Bacteria 5525
43 Ga0105237_10100475 3300009545 Bacteria 2884
44 Ga0105238_10108315 3300009551 Bacteria 2759
45 Ga0105238_10137693 3300009551 Bacteria 2419
46 Ga0105238_10772425 3300009551 Unclassified 975
47 Ga0105239_10094494 3300010375 Bacteria 3302
48 Ga0105239_10352921 3300010375 Bacteria 1661
49 Ga0157370_10019366 3300013104 Bacteria 6828
50 Ga0157369_10016723 3300013105 Bacteria 8244
51 Ga0157369_10163820 3300013105 Bacteria 2346
52 Ga0157369_10520802 3300013105 Bacteria 1230
53 Ga0157372_11053234 3300013307 Bacteria 941
54 Ga0157375_10180571 3300013308 Bacteria 2262
55 Ga0163163_10092505 3300014325 Bacteria 3039
56 Ga0163163_10275845 3300014325 Bacteria 1732
57 Ga0206356_10509386 3300020070 Bacteria 1175
58 Ga0206354_11118315 3300020081 Bacteria 758
59 Ga0206353_10247504 3300020082 Bacteria 2928
60 Ga0206353_10694058 3300020082 Bacteria 905
61 Ga0206353_10800502 3300020082 Bacteria 2792
62 Ga0213874_10088379 3300021377 Unclassified 1014
63 Ga0213876_10001670 3300021384 Bacteria 13544
64 Ga0207705_10146390 3300025909 Bacteria 1768
65 Ga0207705_10266601 3300025909 Bacteria 1309
66 Ga0207654_10056845 3300025911 Bacteria 2271
67 Ga0207671_10031981 3300025914 Bacteria 3917
68 Ga0207671_10048233 3300025914 Bacteria 3152
69 Ga0207671_10089935 3300025914 Bacteria 2311
70 Ga0207660_10259040 3300025917 Bacteria 1375
71 Ga0207657_10001763 3300025919 Bacteria 23366
72 Ga0207657_10376147 3300025919 Bacteria 1119
73 Ga0207657_10530589 3300025919 Bacteria 921
74 Ga0207652_10128664 3300025921 Bacteria 2257
75 Ga0207652_10178343 3300025921 Bacteria 1908
76 Ga0207652_10386047 3300025921 Bacteria 1264
77 Ga0207694_10315347 3300025924 Unclassified 1290
78 Ga0207690_10001031 3300025932 Bacteria 17838
79 Ga0207689_10209136 3300025942 Bacteria 1612
80 Ga0207667_10825484 3300025949 Bacteria 922
81 Ga0207667_11007722 3300025949 Bacteria 820
82 Ga0207667_11180710 3300025949 Bacteria 746
83 Ga0207702_10013133 3300026078 Bacteria 6886
84 Ga0207702_10599802 3300026078 Bacteria 1080
85 Ga0207674_10109551 3300026116 Bacteria 2737
86 Ga0207698_10004875 3300026142 Bacteria 8225
87 Ga0268266_10237491 3300028379 Bacteria 1681
88 Ga0265338_10144703 3300028800 Bacteria 1856
89 Ga0265325_10014421 3300031241 Bacteria 4467
90 Ga0265339_10087695 3300031249 Bacteria 1635
91 Ga0265327_10021867 3300031251 Bacteria 3846
92 Ga0265327_10173649 3300031251 Bacteria 989
93 Ga0265316_10216626 3300031344 Bacteria 1414
94 Ga0265342_10029608 3300031712 Bacteria 3399
95 Ga0307409_100199736 3300031995 Bacteria 1788
96 Ga0373927_0046078 3300035695 Bacteria 2822
97 Ga0373937_0950490 3300036401 Bacteria 808
98 Ga0395898_1101275 3300037466 Bacteria 728
99 Ga0436365_0388527 3300039437 Bacteria 15058
100 Ga0436363_1284269 3300039450 Bacteria 2863
101 Ga0466969_0055208 3300044656 Bacteria 1944
102 Ga0466972_0166782 3300044658 Bacteria 1034
103 Ga0466972_0173577 3300044658 Bacteria 1011
104 Ga0466966_0040137 3300044684 Bacteria 3013
105 Ga0466966_0229836 3300044684 Bacteria 1119
106 Ga0466966_0288553 3300044684 Unclassified 986
107 Ga0466961_0002173 3300044693 Bacteria 12205
108 Ga0466961_0118243 3300044693 Bacteria 1665
109 Ga0466961_0469240 3300044693 Bacteria 761
110 Ga0466963_0004957 3300044694 Bacteria 7763
111 Ga0466963_0085380 3300044694 Bacteria 2143
112 Ga0466963_0105551 3300044694 Bacteria 1931
113 Ga0466963_0520867 3300044694 Bacteria 839
114 Ga0466964_0118896 3300044706 Unclassified 1188
115 Ga0466964_0122257 3300044706 Bacteria 1175
116 Ga0466970_0015223 3300044765 Bacteria 3955
117 Ga0466970_0061286 3300044765 Bacteria 2015
118 Ga0466970_0378232 3300044765 Bacteria 806
119 Ga0466957_0082919 3300044842 Bacteria 1999
120 Ga0466957_0147919 3300044842 Bacteria 1517
121 Ga0466957_0212215 3300044842 Bacteria 1275
122 Ga0466960_0032846 3300044901 Bacteria 2407
123 Ga0466959_0008558 3300045049 Bacteria 7241
124 Ga0466959_0168100 3300045049 Bacteria 1539
125 Ga0466959_0188300 3300045049 Unclassified 1441
126 Ga0466958_0005583 3300045836 Bacteria 6784
127 Ga0466958_0015411 3300045836 Bacteria 4381
128 Ga0466967_0014851 3300045976 Bacteria 6086
129 Ga0466967_0024877 3300045976 Bacteria 4930
130 Ga0466967_0062136 3300045976 Bacteria 3315
131 Ga0466967_0173794 3300045976 Bacteria 2028
132 Ga0466967_0346432 3300045976 Bacteria 1437
133 Ga0466967_0422787 3300045976 Bacteria 1299
134 Ga0466967_0450853 3300045976 Bacteria 1257
135 Ga0466967_0491771 3300045976 Bacteria 1203
136 Ga0466967_0537015 3300045976 Bacteria 1150
137 Ga0466967_0696432 3300045976 Bacteria 1006
138 Ga0495648_0101454 3300046524 Bacteria 1587
139 Ga0496102_0001396 3300048905 Bacteria 21445
140 Ga0496103_0028441 3300048906 Bacteria 3392
141 Ga0496103_0125271 3300048906 Bacteria 1638
142 Ga0496119_0000092 3300048922 Bacteria 131512
143 Ga0496126_0025197 3300048929 Bacteria 5728
144 Ga0501034_0148216 3300049571 Bacteria 2323
145 Ga0501034_0938528 3300049571 Bacteria 751
146 Ga0501036_0364285 3300049572 Bacteria 1207
147 Ga0501037_0512969 3300049573 Bacteria 812
148 Ga0501043_0700165 3300049579 Bacteria 740
149 Ga0501046_0366209 3300049580 Bacteria 1045
150 Ga0501067_0002746 3300049583 Bacteria 9682
151 Ga0501067_0088509 3300049583 Bacteria 1718
152 Ga0501068_0020335 3300049584 Bacteria 3866
153 Ga0501070_0002647 3300049586 Bacteria 15633
154 Ga0501070_0034220 3300049586 Bacteria 4249
155 Ga0501070_0147837 3300049586 Bacteria 1939
156 Ga0501071_0235003 3300049587 Bacteria 1381
157 Ga0501072_0083949 3300049588 Bacteria 2525
158 Ga0501072_0247910 3300049588 Bacteria 1418
159 Ga0501073_0001137 3300049589 Bacteria 19351
160 Ga0501073_0083439 3300049589 Bacteria 2223
161 Ga0501073_0252670 3300049589 Bacteria 1217
162 Ga0501074_0004686 3300049590 Bacteria 9792
163 Ga0501074_0184340 3300049590 Bacteria 1488
164 Ga0501076_0671812 3300049592 Bacteria 855
165 Ga0501077_0074731 3300049593 Bacteria 2146
166 Ga0501079_0040768 3300049741 Bacteria 3583
167 Ga0501080_0005236 3300049742 Bacteria 11555
168 Ga0501080_0162427 3300049742 Bacteria 2062
169 Ga0501080_0328893 3300049742 Bacteria 1382
170 Ga0501081_0071995 3300049743 Bacteria 2410
171 Ga0501083_0052897 3300049744 Bacteria 2727
172 Ga0501083_0101733 3300049744 Bacteria 1894
173 Ga0501084_0015361 3300054114 Bacteria 6348
174 Ga0501084_1063892 3300054114 Bacteria 679
175 Ga0501082_0395743 3300060353 Bacteria 1205
176 Ga0466962_0013081 3300061719 Bacteria 3992
177 Ga0466962_0020471 3300061719 Bacteria 3179
178 2508673717 2508501039 Bacteria 9978592
179 2676201496 2675902999 Bacteria 9438463
180 2689964481 2687453737 Bacteria 11203906
181 2731907100 2731639228 Bacteria 4187555
182 2774846072 2773857921 Bacteria 9435764
183 8002781871 8002775197 Bacteria 10728764
184 8056454578 8056447290 Bacteria 7680491
185 Ga0496102_0107537
186 JGI24735J21928_10005764
187 JGI24735J21928_10155414
188 Ga0070658_10199015
189 Ga0070658_10239660
190 Ga0070658_10433849
191 Ga0070683_100554167
192 Ga0070690_100307670
193 Ga0068869_100155546
194 Ga0070680_100304383
195 Ga0070680_100308010
196 Ga0070682_100897132
197 Ga0070660_100007089
198 Ga0070660_100080780
199 Ga0070659_100001900
200 Ga0070659_100450436
201 Ga0070713_100515190
202 Ga0070698_100651740
203 Ga0070699_100587358
204 Ga0070679_100086523
205 Ga0070679_100094165
206 Ga0070679_100521606
207 Ga0070684_100047205
208 Ga0070684_100232165
209 Ga0070665_100291195
210 Ga0068855_100564584
211 Ga0068855_101207945
212 Ga0068855_101647030
213 Ga0068856_100191095
214 Ga0068856_100193460
215 Ga0068852_100447577
216 Ga0081455_10011503
217 Ga0081540_1102190
218 Ga0070717_10731808
219 Ga0105240_10017407
220 Ga0105240_10037820
221 Ga0105245_10045984
222 Ga0105243_10231862
223 Ga0105241_10371201
224 Ga0105242_11246312
225 Ga0105237_10010695
226 Ga0105237_10030003
227 Ga0105237_10100475
228 Ga0105238_10108315
229 Ga0105238_10137693
230 Ga0105238_10772425
231 Ga0105239_10094494
232 Ga0105239_10352921
233 Ga0157370_10019366
234 Ga0157369_10016723
235 Ga0157369_10163820
236 Ga0157369_10520802
237 Ga0157372_11053234
238 Ga0157375_10180571
239 Ga0163163_10092505
240 Ga0163163_10275845
241 Ga0206356_10509386
242 Ga0206354_11118315
243 Ga0206353_10247504
244 Ga0206353_10694058
245 Ga0206353_10800502
246 Ga0213874_10088379
247 Ga0213876_10001670
248 Ga0207705_10146390
249 Ga0207705_10266601
250 Ga0207654_10056845
251 Ga0207671_10031981
252 Ga0207671_10048233
253 Ga0207671_10089935
254 Ga0207660_10259040
255 Ga0207657_10001763
256 Ga0207657_10376147
257 Ga0207657_10530589
258 Ga0207652_10128664
259 Ga0207652_10178343
260 Ga0207652_10386047
261 Ga0207694_10315347
262 Ga0207690_10001031
263 Ga0207689_10209136
264 Ga0207667_10825484
265 Ga0207667_11007722
266 Ga0207667_11180710
267 Ga0207702_10013133
268 Ga0207702_10599802
269 Ga0207674_10109551
270 Ga0207698_10004875
271 Ga0268266_10237491
272 Ga0265338_10144703
273 Ga0265325_10014421
274 Ga0265339_10087695
275 Ga0265327_10021867
276 Ga0265327_10173649
277 Ga0265316_10216626
278 Ga0265342_10029608
279 Ga0307409_100199736
280 Ga0373927_0046078
281 Ga0373937_0950490
282 Ga0395898_1101275
283 Ga0436365_0388527
284 Ga0436363_1284269
285 Ga0466969_0055208
286 Ga0466972_0166782
287 Ga0466972_0173577
288 Ga0466966_0040137
289 Ga0466966_0229836
290 Ga0466966_0288553
291 Ga0466961_0002173
292 Ga0466961_0118243
293 Ga0466961_0469240
294 Ga0466963_0004957
295 Ga0466963_0085380
296 Ga0466963_0105551
297 Ga0466963_0520867
298 Ga0466964_0118896
299 Ga0466964_0122257
300 Ga0466970_0015223
301 Ga0466970_0061286
302 Ga0466970_0378232
303 Ga0466957_0082919
304 Ga0466957_0147919
305 Ga0466957_0212215
306 Ga0466960_0032846
307 Ga0466959_0008558
308 Ga0466959_0168100
309 Ga0466959_0188300
310 Ga0466958_0005583
311 Ga0466958_0015411
312 Ga0466967_0014851
313 Ga0466967_0024877
314 Ga0466967_0062136
315 Ga0466967_0173794
316 Ga0466967_0346432
317 Ga0466967_0422787
318 Ga0466967_0450853
319 Ga0466967_0491771
320 Ga0466967_0537015
321 Ga0466967_0696432
322 Ga0495648_0101454
323 Ga0496102_0001396
324 Ga0496103_0028441
325 Ga0496103_0125271
326 Ga0496119_0000092
327 Ga0496126_0025197
328 Ga0501034_0148216
329 Ga0501034_0938528
330 Ga0501036_0364285
331 Ga0501037_0512969
332 Ga0501043_0700165
333 Ga0501046_0366209
334 Ga0501067_0002746
335 Ga0501067_0088509
336 Ga0501068_0020335
337 Ga0501070_0002647
338 Ga0501070_0034220
339 Ga0501070_0147837
340 Ga0501071_0235003
341 Ga0501072_0083949
342 Ga0501072_0247910
343 Ga0501073_0001137
344 Ga0501073_0083439
345 Ga0501073_0252670
346 Ga0501074_0004686
347 Ga0501074_0184340
348 Ga0501076_0671812
349 Ga0501077_0074731
350 Ga0501079_0040768
351 Ga0501080_0005236
352 Ga0501080_0162427
353 Ga0501080_0328893
354 Ga0501081_0071995
355 Ga0501083_0052897
356 Ga0501083_0101733
357 Ga0501084_0015361
358 Ga0501084_1063892
359 Ga0501082_0395743
360 Ga0466962_0013081
361 Ga0466962_0020471
362 2508673717
363 2676201496
364 2689964481
365 2731907100
366 2774846072
367 8002781871
368 8056454578

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

13

210

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
8sbe-assembly1.cif.gz_A structure of the rat vesicular glutamate transporter 2 determined by single-particle cryo-em 0.4746 68 203
8dl8-assembly1.cif.gz_A cryo-em structure of human ferroportin/slc40 bound to co2+ in nanodisc 0.4606 4 202
6ob6-assembly1.cif.gz_A human equilibrative nucleoside transporter-1, s-(4-nitrobenzyl)-6-thioinosine bound, merohedrally twinned 0.4573 4 198
8ex6-assembly1.cif.gz_A human s1p transporter spns2 in an inward-facing open conformation (state 1*) 0.4538 4 200
8dl8-assembly1.cif.gz_A cryo-em structure of human ferroportin/slc40 bound to co2+ in nanodisc 0.4523 4 202
ID Description Score Start End Superfamily
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6077 2 202 1.20.1250.20
af_P38301_1_280_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6004 2 202 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5846 2 202 1.20.1250.20
af_Q9P7Q0_1_262_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5777 2 202 1.20.1250.20
af_Q10320_1_287_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5558 4 200 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3N0CAA6-F1-model_v4 LysE family translocator 0.9699 1 203 GO:0005886
GO:0015171
AF-A0A3N0CAA6-F1-model_v4 LysE family translocator 0.9652 1 203 GO:0005886
GO:0015171
AF-A0A0M9CU70-F1-model_v4 deleted 0.9463 1 202
AF-A0A0M9CU70-F1-model_v4 deleted 0.9325 1 202
AF-A0A0N0NGS5-F1-model_v4 deleted 0.9253 2 203

Map