F283129

General Info

Members Datasets Scaffolds Average Seq Length
184 111 177 296

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0001614|Ga0495610_0001614_12300_13211
Length 303
Sequence MNIDLEIFSPVQQISSPLFDSHGVKVFIKRDDLIHPMISGNKWRKLKYVLKRAQNQWKTHLVTFGGAYSNHLMATAAAAAKFGFKSTGIVRGEEVDNDTLFLCSLHGMKLQFTDRDSYRDKPSLFNQYFGNDDQAFFIDEGGASAEGAKGCSELVDELTEAYDHIFCACGTGTTAAGIINGLKKHQLETKFNAVPVFKNGGFIKEEIDRFLTAPTDYNTYTDYHFGGYGKANNELIGFIKQFVAATGILIEPVYTGKMMYALYDLIAKGHFEPGSRILAIHSGGIWGLLGMKEKFKIALINQH

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
59 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
60 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
81 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
82 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
86 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
90 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
91 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
92 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
93 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
94 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
95 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
96 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
101 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
104 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
107 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
108 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
109 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
110 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
111 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.2
Metatranscriptomes 0
Isolates 3.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 0.54
Rhizosphere 88.59
Stem 0
Stem Tuber 0
Unclassified 5.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001913 3300001904 Bacteria 3708
2 JGI24739J22299_10061439 3300001989 Bacteria 1187
3 JGI24737J22298_10005248 3300001990 Bacteria 4485
4 JGI24735J21928_10000016 3300002067 Bacteria 157028
5 JGI24735J21928_10024966 3300002067 Bacteria 1805
6 JGI24744J21845_10004936 3300002077 Bacteria 2763
7 rootH1_10035699 3300003316 Bacteria 12157
8 rootH2_10075043 3300003320 Bacteria 30977
9 rootL2_10021022 3300003322 Bacteria 5135
10 rootL2_10246660 3300003322 Bacteria 1741
11 rootH1_10164539 3300003323 Bacteria 6508
12 rootH1_10231771 3300003323 Bacteria 2165
13 Ga0070676_10000004 3300005328 Bacteria 82919
14 Ga0068868_100006477 3300005338 Bacteria 8287
15 Ga0070660_100018191 3300005339 Bacteria 5131
16 Ga0070671_100025577 3300005355 Bacteria 4845
17 Ga0070674_100043013 3300005356 Bacteria 3071
18 Ga0070659_100047332 3300005366 Bacteria 3373
19 Ga0070678_100083234 3300005456 Bacteria 2432
20 Ga0070662_100000029 3300005457 Bacteria 82498
21 Ga0070662_100120910 3300005457 Bacteria 2007
22 Ga0068867_100006571 3300005459 Bacteria 8215
23 Ga0070679_100574089 3300005530 Bacteria 1071
24 Ga0070684_100016545 3300005535 Bacteria 6030
25 Ga0068853_100143984 3300005539 Bacteria 2141
26 Ga0070665_100000032 3300005548 Bacteria 333352
27 Ga0068855_100000226 3300005563 Bacteria 72130
28 Ga0068855_100000658 3300005563 Bacteria 42234
29 Ga0068855_100047274 3300005563 Bacteria 5085
30 Ga0068855_100189354 3300005563 Bacteria 2322
31 Ga0068855_100218416 3300005563 Bacteria 2139
32 Ga0068856_100000005 3300005614 Bacteria 225505
33 Ga0068856_100000424 3300005614 Bacteria 46509
34 Ga0068852_100000244 3300005616 Bacteria 37013
35 Ga0068852_100539222 3300005616 Bacteria 1166
36 Ga0068858_100056866 3300005842 Unclassified 3615
37 Ga0075366_10001766 3300006195 Bacteria 10903
38 Ga0097621_100001022 3300006237 Bacteria 19710
39 Ga0068871_100000021 3300006358 Bacteria 83155
40 Ga0068865_100000045 3300006881 Bacteria 70227
41 Ga0105240_10000010 3300009093 Bacteria 537830
42 Ga0105240_10024830 3300009093 Bacteria 7890
43 Ga0105240_10054997 3300009093 Bacteria 4985
44 Ga0105240_10211160 3300009093 Bacteria 2268
45 Ga0105240_10350872 3300009093 Bacteria 1674
46 Ga0105240_10516421 3300009093 Bacteria 1326
47 Ga0105241_10000305 3300009174 Bacteria 36958
48 Ga0105241_10003971 3300009174 Bacteria 10938
49 Ga0105241_10021041 3300009174 Bacteria 4822
50 Ga0105242_10009178 3300009176 Bacteria 7591
51 Ga0105237_10000243 3300009545 Bacteria 77722
52 Ga0105237_10002281 3300009545 Bacteria 23860
53 Ga0105237_10002359 3300009545 Bacteria 23435
54 Ga0105237_10004573 3300009545 Bacteria 15971
55 Ga0105237_10082866 3300009545 Bacteria 3198
56 Ga0105238_10005153 3300009551 Bacteria 12923
57 Ga0105238_10361424 3300009551 Bacteria 1441
58 Ga0105239_10000059 3300010375 Bacteria 155685
59 Ga0105239_10000190 3300010375 Bacteria 89155
60 Ga0105239_10002606 3300010375 Bacteria 22829
61 Ga0105239_10002708 3300010375 Bacteria 22283
62 Ga0105239_10007242 3300010375 Bacteria 12745
63 Ga0105239_10015541 3300010375 Bacteria 8431
64 Ga0105239_10194158 3300010375 Bacteria 2273
65 Ga0105246_10071093 3300011119 Bacteria 2449
66 Ga0157373_10000181 3300013100 Bacteria 51804
67 Ga0157373_10025277 3300013100 Bacteria 4297
68 Ga0157373_10048131 3300013100 Bacteria 3040
69 Ga0157371_10000266 3300013102 Bacteria 71146
70 Ga0157371_10101608 3300013102 Bacteria 2040
71 Ga0157370_10081382 3300013104 Bacteria 3047
72 Ga0157370_10209763 3300013104 Bacteria 1805
73 Ga0157369_10166789 3300013105 Bacteria 2322
74 Ga0157369_10369131 3300013105 Bacteria 1490
75 Ga0157369_10587430 3300013105 Bacteria 1150
76 Ga0157374_10000700 3300013296 Bacteria 29512
77 Ga0157378_10033594 3300013297 Bacteria 4536
78 Ga0157378_10055846 3300013297 Bacteria 3518
79 Ga0163162_10000010 3300013306 Bacteria 302032
80 Ga0163162_10004700 3300013306 Bacteria 13167
81 Ga0163162_10012613 3300013306 Bacteria 8253
82 Ga0157372_10001490 3300013307 Bacteria 25443
83 Ga0157372_10006937 3300013307 Bacteria 12056
84 Ga0157372_10017533 3300013307 Bacteria 7682
85 Ga0157372_10078926 3300013307 Bacteria 3721
86 Ga0157375_10029680 3300013308 Bacteria 5146
87 Ga0157375_10184417 3300013308 Bacteria 2239
88 Ga0157375_10575880 3300013308 Bacteria 1286
89 Ga0157377_10216610 3300014745 Bacteria 1224
90 Ga0157376_10064901 3300014969 Bacteria 3080
91 Ga0182007_10029988 3300015262 Bacteria 1860
92 Ga0213872_10023344 3300021361 Bacteria 2846
93 Ga0209437_100148 3300025233 Bacteria 158795
94 Ga0209233_1000564 3300025261 Bacteria 19855
95 Ga0207647_10000022 3300025904 Bacteria 118094
96 Ga0207647_10000211 3300025904 Bacteria 47375
97 Ga0207647_10035278 3300025904 Bacteria 3188
98 Ga0207645_10000151 3300025907 Bacteria 54588
99 Ga0207654_10002352 3300025911 Bacteria 9698
100 Ga0207695_10000019 3300025913 Bacteria 732137
101 Ga0207695_10216576 3300025913 Bacteria 1824
102 Ga0207695_10344332 3300025913 Unclassified 1378
103 Ga0207671_10000598 3300025914 Bacteria 48008
104 Ga0207671_10002797 3300025914 Bacteria 18193
105 Ga0207671_10003350 3300025914 Bacteria 16080
106 Ga0207671_10029126 3300025914 Bacteria 4125
107 Ga0207657_10028481 3300025919 Bacteria 5095
108 Ga0207657_10059365 3300025919 Bacteria 3287
109 Ga0207652_10506467 3300025921 Bacteria 1087
110 Ga0207694_10019514 3300025924 Bacteria 5125
111 Ga0207644_10030003 3300025931 Bacteria 3776
112 Ga0207690_10031845 3300025932 Bacteria 3379
113 Ga0207706_10000047 3300025933 Bacteria 119022
114 Ga0207706_10167209 3300025933 Bacteria 1933
115 Ga0207686_10008602 3300025934 Bacteria 5513
116 Ga0207704_10000077 3300025938 Bacteria 60841
117 Ga0207667_10000039 3300025949 Bacteria 278843
118 Ga0207667_10001998 3300025949 Bacteria 25593
119 Ga0207667_10023311 3300025949 Bacteria 6817
120 Ga0207667_10110247 3300025949 Bacteria 2839
121 Ga0207703_10023539 3300026035 Bacteria 4840
122 Ga0207702_10000249 3300026078 Bacteria 62542
123 Ga0207702_10067754 3300026078 Bacteria 3064
124 Ga0207702_10433802 3300026078 Bacteria 1272
125 Ga0207648_10002829 3300026089 Bacteria 18417
126 Ga0207683_10019540 3300026121 Bacteria 5786
127 Ga0207698_10003780 3300026142 Bacteria 9151
128 Ga0268266_10000030 3300028379 Bacteria 417120
129 Ga0307515_10000859 3300028794 Bacteria 69963
130 Ga0307515_10081168 3300028794 Bacteria 4216
131 Ga0395899_0000002 3300037312 Bacteria 1324310
132 Ga0395899_0000749 3300037312 Bacteria 32276
133 Ga0395900_0000406 3300037418 Bacteria 62078
134 Ga0395900_0000460 3300037418 Bacteria 58482
135 Ga0395905_0000175 3300037471 Bacteria 104024
136 Ga0395901_0000198 3300038443 Bacteria 76490
137 Ga0395901_0398106 3300038443 Bacteria 1415
138 Ga0436361_0611374 3300039447 Bacteria 11788
139 Ga0439448_0029018 3300042005 Bacteria 1750
140 Ga0466966_0099753 3300044684 Bacteria 1797
141 Ga0466959_0060780 3300045049 Bacteria 2749
142 Ga0495651_0167128 3300046462 Bacteria 1570
143 Ga0495650_0001050 3300046471 Bacteria 30706
144 Ga0495585_0000695 3300046492 Bacteria 30570
145 Ga0495606_0000033 3300046507 Bacteria 247739
146 Ga0495606_0026287 3300046507 Bacteria 4151
147 Ga0495610_0001614 3300046512 Bacteria 19820
148 Ga0495610_0015453 3300046512 Bacteria 4434
149 Ga0495616_0001749 3300046513 Bacteria 14782
150 Ga0495616_0022215 3300046513 Bacteria 3427
151 Ga0495637_0079730 3300046520 Bacteria 1307
152 Ga0495648_0061164 3300046524 Bacteria 2238
153 Ga0495648_0094940 3300046524 Bacteria 1660
154 Ga0495633_0000172 3300046558 Bacteria 84811
155 Ga0495633_0005173 3300046558 Bacteria 8068
156 Ga0495668_0000069 3300046616 Bacteria 174287
157 Ga0495625_0000131 3300046660 Bacteria 117738
158 Ga0495625_0000385 3300046660 Bacteria 67419
159 Ga0495625_0006307 3300046660 Bacteria 10603
160 Ga0495625_0171611 3300046660 Bacteria 1448
161 Ga0495661_0003916 3300046665 Bacteria 10867
162 Ga0495599_0184095 3300046678 Bacteria 1287
163 Ga0495649_0000009 3300046694 Bacteria 451725
164 Ga0495687_000483 3300047443 Bacteria 48330
165 Ga0495687_000882 3300047443 Bacteria 31691
166 Ga0495673_0042209 3300047469 Bacteria 2049
167 Ga0495686_0000299 3300047472 Bacteria 85384
168 Ga0495686_0043664 3300047472 Bacteria 2841
169 Ga0495614_0093279 3300048089 Bacteria 1311
170 Ga0496126_0147313 3300048929 Bacteria 2021
171 Ga0495678_002638 3300049459 Bacteria 11934
172 nmdc:mga0k408_1182_c2 3300050493 Bacteria 11156
173 nmdc:mga0k408_222070_c1 3300050493 Bacteria 1128
174 nmdc:mga0k408_76777_c1 3300050493 Bacteria 1953
175 Ga0500608_029088 3300053122 Bacteria 2612
176 Ga0500608_058398 3300053122 Bacteria 1847
177 Ga0500634_0128375 3300053161 Bacteria 1221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0000299 Ga0495686_0000299_64249_65136 269
2 iso_pu_bacteria 2852623160 2852624756 292
3 iso_pu_bacteria 2884933994 2884936355 292
4 iso_pu_bacteria 2932082852 2932086072 292
5 iso_pu_bacteria 2599185184 2599478980 293
6 iso_pu_bacteria 2928078545 2928082705 293
7 iso_pu_bacteria 2928147474 2928153014 293
8 iso_pu_bacteria 2919437846 2919438346 294
9 3300002067 JGI24735J21928_10024966 JGI24735J21928_100249662 295
10 3300005356 Ga0070674_100043013 Ga0070674_1000430133 295
11 3300005366 Ga0070659_100047332 Ga0070659_1000473322 295
12 3300005563 Ga0068855_100000226 Ga0068855_10000022626 295
13 3300005563 Ga0068855_100000658 Ga0068855_10000065834 295
14 3300005616 Ga0068852_100539222 Ga0068852_1005392221 295
15 3300006195 Ga0075366_10001766 Ga0075366_100017661 295
16 3300009093 Ga0105240_10000010 Ga0105240_10000010104 295
17 3300009093 Ga0105240_10054997 Ga0105240_100549973 295
18 3300009093 Ga0105240_10350872 Ga0105240_103508722 295
19 3300009093 Ga0105240_10516421 Ga0105240_105164211 295
20 3300009174 Ga0105241_10021041 Ga0105241_100210415 295
21 3300009545 Ga0105237_10000243 Ga0105237_1000024321 295
22 3300009545 Ga0105237_10004573 Ga0105237_100045738 295
23 3300009551 Ga0105238_10361424 Ga0105238_103614241 295
24 3300010375 Ga0105239_10000190 Ga0105239_1000019056 295
25 3300010375 Ga0105239_10002606 Ga0105239_100026067 295
26 3300010375 Ga0105239_10002708 Ga0105239_1000270814 295
27 3300010375 Ga0105239_10015541 Ga0105239_100155414 295
28 3300013100 Ga0157373_10025277 Ga0157373_100252773 295
29 3300013102 Ga0157371_10000266 Ga0157371_1000026639 295
30 3300013104 Ga0157370_10081382 Ga0157370_100813823 295
31 3300013297 Ga0157378_10033594 Ga0157378_100335946 295
32 3300013306 Ga0163162_10012613 Ga0163162_100126133 295
33 3300013307 Ga0157372_10017533 Ga0157372_100175332 295
34 3300013308 Ga0157375_10184417 Ga0157375_101844172 295
35 3300025233 Ga0209437_100148 Ga0209437_1001484 295
36 3300025261 Ga0209233_1000564 Ga0209233_10005646 295
37 3300025904 Ga0207647_10000211 Ga0207647_1000021137 295
38 3300025913 Ga0207695_10000019 Ga0207695_10000019348 295
39 3300025914 Ga0207671_10000598 Ga0207671_1000059817 295
40 3300025914 Ga0207671_10003350 Ga0207671_1000335010 295
41 3300025932 Ga0207690_10031845 Ga0207690_100318452 295
42 3300025949 Ga0207667_10000039 Ga0207667_1000003989 295
43 3300025949 Ga0207667_10001998 Ga0207667_1000199815 295
44 3300025949 Ga0207667_10110247 Ga0207667_101102472 295
45 3300028794 Ga0307515_10000859 Ga0307515_1000085950 295
46 3300028794 Ga0307515_10081168 Ga0307515_100811683 295
47 3300037312 Ga0395899_0000002 Ga0395899_0000002_655826_656713 295
48 3300037418 Ga0395900_0000460 Ga0395900_0000460_39494_40384 295
49 3300038443 Ga0395901_0398106 Ga0395901_0398106_295_1182 295
50 3300046462 Ga0495651_0167128 Ga0495651_0167128_620_1507 295
51 3300046507 Ga0495606_0026287 Ga0495606_0026287_2044_2931 295
52 3300046513 Ga0495616_0022215 Ga0495616_0022215_2410_3300 295
53 3300046524 Ga0495648_0061164 Ga0495648_0061164_365_1255 295
54 3300046524 Ga0495648_0094940 Ga0495648_0094940_358_1245 295
55 3300046558 Ga0495633_0000172 Ga0495633_0000172_43781_44668 295
56 3300046616 Ga0495668_0000069 Ga0495668_0000069_148020_148907 295
57 3300046660 Ga0495625_0000385 Ga0495625_0000385_60918_61805 295
58 3300046660 Ga0495625_0006307 Ga0495625_0006307_4224_5111 295
59 3300046660 Ga0495625_0171611 Ga0495625_0171611_107_994 295
60 3300048089 Ga0495614_0093279 Ga0495614_0093279_259_1146 295
61 3300049459 Ga0495678_002638 Ga0495678_002638_5682_6572 295
62 3300050493 nmdc:mga0k408_1182_c2 nmdc:mga0k408_1182_c2_9897_10784 295
63 3300053122 Ga0500608_058398 Ga0500608_058398_515_1402 295
64 3300053161 Ga0500634_0128375 Ga0500634_0128375_211_1098 295
65 3300003316 rootH1_10035699 rootH1_100356999 296
66 3300003320 rootH2_10075043 rootH2_100750434 296
67 3300003322 rootL2_10021022 rootL2_100210223 296
68 3300003323 rootH1_10164539 rootH1_101645394 296
69 3300005530 Ga0070679_100574089 Ga0070679_1005740891 296
70 3300005614 Ga0068856_100000005 Ga0068856_100000005147 296
71 3300005842 Ga0068858_100056866 Ga0068858_1000568665 296
72 3300025919 Ga0207657_10059365 Ga0207657_100593654 296
73 3300025921 Ga0207652_10506467 Ga0207652_105064672 296
74 3300026035 Ga0207703_10023539 Ga0207703_100235395 296
75 3300026078 Ga0207702_10000249 Ga0207702_1000024954 296
76 3300046471 Ga0495650_0001050 Ga0495650_0001050_11062_11952 296
77 3300046492 Ga0495585_0000695 Ga0495585_0000695_2302_3192 296
78 3300046507 Ga0495606_0000033 Ga0495606_0000033_134548_135438 296
79 3300046512 Ga0495610_0015453 Ga0495610_0015453_944_1834 296
80 3300046513 Ga0495616_0001749 Ga0495616_0001749_1743_2633 296
81 3300046660 Ga0495625_0000131 Ga0495625_0000131_11066_11956 296
82 3300046665 Ga0495661_0003916 Ga0495661_0003916_4897_5787 296
83 3300046678 Ga0495599_0184095 Ga0495599_0184095_285_1175 296
84 3300046694 Ga0495649_0000009 Ga0495649_0000009_11066_11956 296
85 3300047469 Ga0495673_0042209 Ga0495673_0042209_802_1692 296
86 3300047472 Ga0495686_0043664 Ga0495686_0043664_530_1420 296
87 3300048929 Ga0496126_0147313 Ga0496126_0147313_748_1638 296
88 3300050493 nmdc:mga0k408_222070_c1 nmdc:mga0k408_222070_c1_42_932 296
89 3300001904 JGI24736J21556_1001913 JGI24736J21556_10019132 297
90 3300001989 JGI24739J22299_10061439 JGI24739J22299_100614392 297
91 3300001990 JGI24737J22298_10005248 JGI24737J22298_100052482 297
92 3300002067 JGI24735J21928_10000016 JGI24735J21928_10000016103 297
93 3300002077 JGI24744J21845_10004936 JGI24744J21845_100049362 297
94 3300003322 rootL2_10246660 rootL2_102466602 297
95 3300003323 rootH1_10231771 rootH1_102317712 297
96 3300005328 Ga0070676_10000004 Ga0070676_1000000428 297
97 3300005338 Ga0068868_100006477 Ga0068868_1000064778 297
98 3300005339 Ga0070660_100018191 Ga0070660_1000181914 297
99 3300005355 Ga0070671_100025577 Ga0070671_1000255776 297
100 3300005456 Ga0070678_100083234 Ga0070678_1000832341 297
101 3300005457 Ga0070662_100000029 Ga0070662_1000000297 297
102 3300005457 Ga0070662_100120910 Ga0070662_1001209102 297
103 3300005459 Ga0068867_100006571 Ga0068867_1000065718 297
104 3300005535 Ga0070684_100016545 Ga0070684_1000165451 297
105 3300005539 Ga0068853_100143984 Ga0068853_1001439841 297
106 3300005548 Ga0070665_100000032 Ga0070665_100000032264 297
107 3300005563 Ga0068855_100047274 Ga0068855_1000472742 297
108 3300005563 Ga0068855_100189354 Ga0068855_1001893542 297
109 3300005563 Ga0068855_100218416 Ga0068855_1002184162 297
110 3300005614 Ga0068856_100000424 Ga0068856_10000042429 297
111 3300005616 Ga0068852_100000244 Ga0068852_10000024427 297
112 3300006237 Ga0097621_100001022 Ga0097621_10000102218 297
113 3300006358 Ga0068871_100000021 Ga0068871_10000002129 297
114 3300006881 Ga0068865_100000045 Ga0068865_10000004551 297
115 3300009093 Ga0105240_10024830 Ga0105240_100248307 297
116 3300009093 Ga0105240_10211160 Ga0105240_102111601 297
117 3300009174 Ga0105241_10000305 Ga0105241_100003058 297
118 3300009174 Ga0105241_10003971 Ga0105241_100039718 297
119 3300009176 Ga0105242_10009178 Ga0105242_100091785 297
120 3300009545 Ga0105237_10002281 Ga0105237_1000228118 297
121 3300009545 Ga0105237_10002359 Ga0105237_1000235922 297
122 3300009545 Ga0105237_10082866 Ga0105237_100828663 297
123 3300009551 Ga0105238_10005153 Ga0105238_100051539 297
124 3300010375 Ga0105239_10000059 Ga0105239_10000059143 297
125 3300010375 Ga0105239_10007242 Ga0105239_100072427 297
126 3300010375 Ga0105239_10194158 Ga0105239_101941582 297
127 3300011119 Ga0105246_10071093 Ga0105246_100710932 297
128 3300013100 Ga0157373_10000181 Ga0157373_1000018139 297
129 3300013100 Ga0157373_10048131 Ga0157373_100481311 297
130 3300013102 Ga0157371_10101608 Ga0157371_101016082 297
131 3300013104 Ga0157370_10209763 Ga0157370_102097632 297
132 3300013105 Ga0157369_10166789 Ga0157369_101667892 297
133 3300013105 Ga0157369_10369131 Ga0157369_103691312 297
134 3300013105 Ga0157369_10587430 Ga0157369_105874301 297
135 3300013296 Ga0157374_10000700 Ga0157374_100007009 297
136 3300013297 Ga0157378_10055846 Ga0157378_100558461 297
137 3300013306 Ga0163162_10000010 Ga0163162_10000010200 297
138 3300013306 Ga0163162_10004700 Ga0163162_1000470010 297
139 3300013307 Ga0157372_10001490 Ga0157372_100014906 297
140 3300013307 Ga0157372_10006937 Ga0157372_100069377 297
141 3300013307 Ga0157372_10078926 Ga0157372_100789264 297
142 3300013308 Ga0157375_10029680 Ga0157375_100296804 297
143 3300013308 Ga0157375_10575880 Ga0157375_105758802 297
144 3300014745 Ga0157377_10216610 Ga0157377_102166101 297
145 3300014969 Ga0157376_10064901 Ga0157376_100649012 297
146 3300015262 Ga0182007_10029988 Ga0182007_100299882 297
147 3300021361 Ga0213872_10023344 Ga0213872_100233443 297
148 3300025904 Ga0207647_10000022 Ga0207647_1000002273 297
149 3300025904 Ga0207647_10035278 Ga0207647_100352782 297
150 3300025907 Ga0207645_10000151 Ga0207645_1000015123 297
151 3300025911 Ga0207654_10002352 Ga0207654_100023529 297
152 3300025913 Ga0207695_10216576 Ga0207695_102165762 297
153 3300025913 Ga0207695_10344332 Ga0207695_103443322 297
154 3300025914 Ga0207671_10002797 Ga0207671_1000279712 297
155 3300025914 Ga0207671_10029126 Ga0207671_100291262 297
156 3300025919 Ga0207657_10028481 Ga0207657_100284813 297
157 3300025924 Ga0207694_10019514 Ga0207694_100195144 297
158 3300025931 Ga0207644_10030003 Ga0207644_100300032 297
159 3300025933 Ga0207706_10000047 Ga0207706_1000004733 297
160 3300025933 Ga0207706_10167209 Ga0207706_101672092 297
161 3300025934 Ga0207686_10008602 Ga0207686_100086022 297
162 3300025938 Ga0207704_10000077 Ga0207704_1000007718 297
163 3300025949 Ga0207667_10023311 Ga0207667_100233114 297
164 3300026078 Ga0207702_10067754 Ga0207702_100677542 297
165 3300026078 Ga0207702_10433802 Ga0207702_104338022 297
166 3300026089 Ga0207648_10002829 Ga0207648_1000282918 297
167 3300026121 Ga0207683_10019540 Ga0207683_100195402 297
168 3300026142 Ga0207698_10003780 Ga0207698_100037805 297
169 3300028379 Ga0268266_10000030 Ga0268266_1000003067 297
170 3300037312 Ga0395899_0000749 Ga0395899_0000749_3134_4027 297
171 3300037418 Ga0395900_0000406 Ga0395900_0000406_31623_32516 297
172 3300037471 Ga0395905_0000175 Ga0395905_0000175_82404_83297 297
173 3300038443 Ga0395901_0000198 Ga0395901_0000198_19649_20542 297
174 3300039447 Ga0436361_0611374 Ga0436361_0611374_1247_2140 297
175 3300042005 Ga0439448_0029018 Ga0439448_0029018_343_1236 297
176 3300044684 Ga0466966_0099753 Ga0466966_0099753_739_1632 297
177 3300045049 Ga0466959_0060780 Ga0466959_0060780_780_1673 297
178 3300046512 Ga0495610_0001614 Ga0495610_0001614_12300_13211 297
179 3300046520 Ga0495637_0079730 Ga0495637_0079730_386_1282 297
180 3300046558 Ga0495633_0005173 Ga0495633_0005173_3323_4234 297
181 3300047443 Ga0495687_000483 Ga0495687_000483_27459_28355 297
182 3300047443 Ga0495687_000882 Ga0495687_000882_1315_2208 297
183 3300050493 nmdc:mga0k408_76777_c1 nmdc:mga0k408_76777_c1_699_1595 297
184 3300053122 Ga0500608_029088 Ga0500608_029088_1052_1954 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

7

283

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ysk-assembly1.cif.gz_B crystal structure of d-cysteine desulfhydrase from pectobacterium atrosepticum 0.8958 8 296
1j0a-assembly1.cif.gz_A crystal structure analysis of the acc deaminase homologue 0.8949 5 295
7ysl-assembly1.cif.gz_B crystal structure of d-cysteine desulfhydrase with a trapped plp-pyruvate geminal diamine 0.8897 8 297
4d8t-assembly1.cif.gz_B crystal structure of d-cysteine desulfhydrase from salmonella typhimurium at 2.2 a resolution 0.8868 4 292
4d9f-assembly2.cif.gz_C d-cysteine desulfhydrase from salmonella typhimurium complexed with d-cycloserine (dcs) 0.8862 5 292
ID Description Score Start End Superfamily
af_A0A1D6NEQ8_83_185_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9 42 128 3.40.50.1100
4d8uD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8388 44 139 3.40.50.1100
1j0bQ02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8267 42 139 3.40.50.1100
af_A1L4V7_217_421_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8261 136 296 3.40.50.1100
af_B9EYZ1_202_400_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8227 136 295 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A4Q6E4R4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.986 1 185 GO:0019148
AF-A0A4Q6E4R4-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9756 1 185 GO:0019148
AF-A0A4Q5S8A2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9702 101 295 GO:0019148
AF-A0A520AL16-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9668 32 295 GO:0019148
AF-A0A4Q5S8A2-F1-model_v4 Pyridoxal-phosphate dependent enzyme 0.9654 101 295 GO:0019148

Feature Viewer

pLDDT pTM Quality
89.93 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map