F283013

General Info

Members Datasets Scaffolds Average Seq Length
184 151 368 222

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0035009|Ga0466969_0035009_212_964
Length 250
Sequence VAEILRRSRTFSPTATDRRNAVIFNRHKSQLPTPEQALPGRDRPAYAVPERHEVLGHPLLPPYPAGLEVADFGMGCFWGAERAFWQLPGVWTTLVGYQGGVTPNPTYEEVCSGLTGHAEVVRVVFDPSALPYEQLLKVFWESHDPTQGMRQGNDHGTQYRSAIYTHSTDHHAAAVASRDSFQSVLARLGHSPITTEILPAAPFYPAEPYHQQYLSNSKNPNGYCGLGGLGVNPGNPSDWTCPTGIAETEE

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
15 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
16 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
17 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
18 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
20 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
21 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
22 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
23 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
24 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
25 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
45 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
46 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
49 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
50 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
51 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
52 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
53 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
54 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
55 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
56 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
57 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
58 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
59 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
60 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
61 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
62 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
63 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
64 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
65 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
66 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
67 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
68 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
69 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
72 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
82 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
83 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
84 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
85 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
86 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
87 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
88 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
89 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
90 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
91 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
92 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
93 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
98 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
99 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
100 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
101 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
102 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
103 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
104 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
105 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
106 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
107 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
108 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
109 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
113 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
114 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
119 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
120 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
121 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
122 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
123 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
124 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
125 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
126 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
127 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
128 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
129 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
130 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
131 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
132 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
133 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
134 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
135 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
136 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
137 2867428634 Streptomyces sp. RP5T Isolate Unclassified
138 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
139 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
140 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
141 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
142 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
143 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
144 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
145 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
146 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
147 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
148 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
149 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
150 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
151 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.15
Metatranscriptomes 0.54
Isolates 16.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.35
Nodule 0.54
Rhizoplane 1.63
Rhizosphere 76.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0035009 3300044656 Bacteria 2542
2 rootH1_10019715 3300003316 Bacteria 3040
3 rootL2_10025730 3300003322 Bacteria 4129
4 Ga0006562J51391_1189206 3300003578 Bacteria 5490
5 Ga0070683_100128774 3300005329 Bacteria 2394
6 Ga0070680_100156345 3300005336 Bacteria 1916
7 Ga0070689_100450360 3300005340 Bacteria 1095
8 Ga0070681_10519967 3300005458 Bacteria 1103
9 Ga0070685_10422474 3300005466 Bacteria 928
10 Ga0070698_100147261 3300005471 Bacteria 2303
11 Ga0070679_100019693 3300005530 Bacteria 6567
12 Ga0070679_100152628 3300005530 Bacteria 2286
13 Ga0070665_100412378 3300005548 Bacteria 1359
14 Ga0068855_100211685 3300005563 Bacteria 2178
15 Ga0068859_101196086 3300005617 Bacteria 837
16 Ga0075363_100175547 3300006048 Bacteria 1218
17 Ga0075363_100193009 3300006048 Bacteria 1162
18 Ga0075370_10278889 3300006353 Bacteria 993
19 Ga0097620_101196137 3300006931 Bacteria 837
20 Ga0111539_11011694 3300009094 Bacteria 966
21 Ga0105245_10068323 3300009098 Bacteria 3220
22 Ga0105243_10895408 3300009148 Bacteria 882
23 Ga0105242_10862048 3300009176 Bacteria 902
24 Ga0105239_10525731 3300010375 Bacteria 1346
25 Ga0157375_10071437 3300013308 Bacteria 3484
26 Ga0157375_10087385 3300013308 Bacteria 3170
27 Ga0183367_1002 3300015688 Bacteria 1101531
28 Ga0207705_10205632 3300025909 Bacteria 1492
29 Ga0207707_10245842 3300025912 Bacteria 1554
30 Ga0207660_10243605 3300025917 Bacteria 1417
31 Ga0207652_10104666 3300025921 Bacteria 2503
32 Ga0207664_10036295 3300025929 Bacteria 3809
33 Ga0207686_10091366 3300025934 Bacteria 2011
34 Ga0207669_10639341 3300025937 Bacteria 869
35 Ga0207711_10556685 3300025941 Bacteria 1070
36 Ga0207661_10025808 3300025944 Bacteria 4471
37 Ga0207658_10877515 3300025986 Bacteria 816
38 Ga0207708_10710964 3300026075 Bacteria 860
39 Ga0207698_10670780 3300026142 Bacteria 1029
40 Ga0265334_10001478 3300028573 Bacteria 11326
41 Ga0307515_10169545 3300028794 Bacteria 2183
42 Ga0307511_10001682 3300030521 Bacteria 23317
43 Ga0307511_10194384 3300030521 Bacteria 1066
44 Ga0307512_10038253 3300030522 Bacteria 4039
45 Ga0307513_10104358 3300031456 Bacteria 2848
46 Ga0307509_10007642 3300031507 Bacteria 14049
47 Ga0307509_10007665 3300031507 Bacteria 14029
48 Ga0307508_10255172 3300031616 Bacteria 1349
49 Ga0307518_10094350 3300031838 Bacteria 2149
50 Ga0307518_10164012 3300031838 Bacteria 1523
51 Ga0307410_10844337 3300031852 Bacteria 781
52 Ga0307411_10002593 3300032005 Bacteria 8073
53 Ga0307510_10049827 3300033180 Bacteria 4450
54 Ga0439436_0011358 3300041404 Bacteria 2705
55 Ga0439439_0037856 3300041406 Bacteria 1244
56 Ga0451793_0944941 3300041452 Bacteria 1542
57 Ga0451833_0812579 3300041491 Bacteria 12673
58 Ga0439448_0048945 3300042005 Bacteria 1381
59 Ga0439432_032709 3300042006 Bacteria 1676
60 Ga0439457_003489 3300042014 Bacteria 4275
61 Ga0450894_017561 3300042131 Bacteria 953
62 Ga0466969_0031649 3300044656 Bacteria 2692
63 Ga0466972_0005033 3300044658 Bacteria 6624
64 Ga0466972_0031438 3300044658 Bacteria 2610
65 Ga0466965_0003307 3300044683 Bacteria 7057
66 Ga0466965_0006094 3300044683 Bacteria 5448
67 Ga0466966_0013102 3300044684 Bacteria 5488
68 Ga0466966_0042335 3300044684 Bacteria 2923
69 Ga0466966_0063317 3300044684 Bacteria 2330
70 Ga0466966_0145598 3300044684 Bacteria 1446
71 Ga0466961_0001240 3300044693 Bacteria 15711
72 Ga0466961_0065746 3300044693 Bacteria 2304
73 Ga0466963_0172635 3300044694 Bacteria 1507
74 Ga0466964_0005890 3300044706 Bacteria 4565
75 Ga0453684_0006743 3300044712 Bacteria 21617
76 Ga0453684_0032271 3300044712 Bacteria 7335
77 Ga0466971_0000197 3300044719 Bacteria 23180
78 Ga0466971_0009609 3300044719 Bacteria 4221
79 Ga0466968_0257566 3300044735 Bacteria 830
80 Ga0466970_0002240 3300044765 Bacteria 9330
81 Ga0466957_0000805 3300044842 Bacteria 15984
82 Ga0466959_0001684 3300045049 Bacteria 13695
83 Ga0466959_0020948 3300045049 Bacteria 4820
84 Ga0466959_0051042 3300045049 Bacteria 3035
85 Ga0466958_0000955 3300045836 Bacteria 13063
86 Ga0466967_0030587 3300045976 Bacteria 4520
87 Ga0466967_0224032 3300045976 Bacteria 1788
88 Ga0466967_0282276 3300045976 Bacteria 1593
89 Ga0495617_031088 3300046452 Bacteria 1794
90 Ga0495592_0062240 3300046454 Bacteria 2740
91 Ga0495603_0044003 3300046455 Bacteria 2664
92 Ga0495651_0023977 3300046462 Bacteria 4747
93 Ga0495605_0055701 3300046474 Bacteria 1909
94 Ga0495585_0153710 3300046492 Bacteria 1198
95 Ga0495594_0034494 3300046499 Bacteria 2752
96 Ga0495594_0350217 3300046499 Bacteria 841
97 Ga0495607_0089118 3300046501 Bacteria 1675
98 Ga0495608_0084075 3300046511 Bacteria 2065
99 Ga0495610_0094993 3300046512 Bacteria 1345
100 Ga0495620_0012330 3300046515 Bacteria 4423
101 Ga0495628_0057656 3300046516 Bacteria 3055
102 Ga0495631_0149457 3300046518 Bacteria 1002
103 Ga0495643_0020794 3300046522 Bacteria 3776
104 Ga0495648_0019231 3300046524 Bacteria 4811
105 Ga0495666_0031202 3300046526 Bacteria 2611
106 Ga0495666_0032812 3300046526 Bacteria 2540
107 Ga0495642_0015749 3300046528 Bacteria 2943
108 Ga0495652_0033185 3300046529 Bacteria 4509
109 Ga0495640_0003145 3300046533 Bacteria 13298
110 Ga0495586_0375259 3300046535 Bacteria 818
111 Ga0495597_0041320 3300046542 Bacteria 2060
112 Ga0495633_0011958 3300046558 Bacteria 4641
113 Ga0495656_0134218 3300046615 Bacteria 1181
114 Ga0495668_0009879 3300046616 Bacteria 5820
115 Ga0495634_0037752 3300046642 Bacteria 3298
116 Ga0495611_0076062 3300046648 Bacteria 1538
117 Ga0495625_0053998 3300046660 Bacteria 2871
118 Ga0495635_0180577 3300046663 Bacteria 1434
119 Ga0495661_0222258 3300046665 Bacteria 978
120 Ga0495623_0026109 3300046679 Bacteria 3762
121 Ga0495613_0031479 3300046689 Bacteria 3940
122 Ga0495613_0143256 3300046689 Bacteria 1706
123 Ga0495613_0216596 3300046689 Bacteria 1345
124 Ga0495613_0256379 3300046689 Bacteria 1219
125 Ga0495624_0109217 3300046690 Bacteria 1701
126 Ga0495649_0170426 3300046694 Bacteria 1139
127 Ga0495589_0004994 3300046794 Bacteria 7024
128 Ga0495600_0239509 3300046809 Bacteria 1156
129 Ga0495660_0082334 3300046810 Bacteria 1685
130 Ga0495660_0155745 3300046810 Bacteria 1124
131 Ga0495636_0016696 3300047318 Bacteria 2934
132 Ga0495636_0036823 3300047318 Bacteria 2019
133 Ga0495636_0040359 3300047318 Bacteria 1935
134 Ga0495672_0205395 3300047320 Bacteria 982
135 Ga0495676_0022134 3300047321 Bacteria 5537
136 Ga0495680_0007204 3300047322 Bacteria 10241
137 Ga0495683_0094390 3300047323 Bacteria 1445
138 Ga0495687_005013 3300047443 Bacteria 8641
139 Ga0495687_008400 3300047443 Bacteria 5913
140 Ga0495687_083800 3300047443 Bacteria 1240
141 Ga0495685_004812 3300047447 Bacteria 4382
142 Ga0495685_010846 3300047447 Bacteria 3061
143 Ga0495685_073375 3300047447 Bacteria 1144
144 Ga0495684_0053417 3300047471 Bacteria 3083
145 Ga0495626_0118874 3300048091 Bacteria 1138
146 Ga0496112_0269827 3300048915 Bacteria 1650
147 Ga0496112_0546711 3300048915 Bacteria 1092
148 Ga0496125_0029194 3300048928 Bacteria 4961
149 nmdc:mga03n38_129844_c1 3300050490 Bacteria 1247
150 nmdc:mga03n38_208008_c1 3300050490 Bacteria 1016
151 nmdc:mga07m45_432560_c1 3300050496 Bacteria 763
152 nmdc:mga08y16_682911_c1 3300050511 Bacteria 1028
153 Ga0500644_0185546 3300053088 Bacteria 853
154 Ga0500600_0144660 3300053149 Bacteria 1192
155 2599103394 2597490356 Bacteria 7030811
156 2616701371 2616644814 Bacteria 11555299
157 2644173651 2643221631 Bacteria 8168043
158 2676495000 2675903060 Bacteria 10051191
159 2739206919 2738543005 Bacteria 5278128
160 2785341604 2784746763 Bacteria 9783172
161 2791911243 2791354901 Bacteria 8322202
162 2808843627 2808606359 Bacteria 9866990
163 2812356423 2811994879 Bacteria 9313447
164 2837275159 2837268691 Bacteria 7850704
165 2846953279 2846952575 Bacteria 6587527
166 2862287288 2862281513 Bacteria 9621493
167 2862390787 2862382967 Bacteria 10317375
168 2863411290 2863404153 Bacteria 9672205
169 2866554910 2866552031 Bacteria 5824618
170 2867431947 2867428634 Bacteria 9590268
171 2868095910 2868088558 Bacteria 7609351
172 2919470491 2919468124 Bacteria 9133025
173 2946069435 2946064051 Bacteria 8957905
174 2947227485 2947224130 Bacteria 9938529
175 2954384395 2954380949 Bacteria 10050426
176 2990048326 2990044586 Bacteria 6603797
177 2990067959 2990059506 Bacteria 9321252
178 2990092655 2990088156 Bacteria 6657676
179 3006395973 3006393351 Bacteria 6615579
180 8008577546 8008574985 Bacteria 7815457
181 8048406874 8048406513 Bacteria 8936924
182 8053948537 8053945823 Bacteria 8962862
183 8056215244 8056207758 Bacteria 8639239
184 8056448112 8056447290 Bacteria 7680491
185 Ga0466969_0035009
186 rootH1_10019715
187 rootL2_10025730
188 Ga0006562J51391_1189206
189 Ga0070683_100128774
190 Ga0070680_100156345
191 Ga0070689_100450360
192 Ga0070681_10519967
193 Ga0070685_10422474
194 Ga0070698_100147261
195 Ga0070679_100019693
196 Ga0070679_100152628
197 Ga0070665_100412378
198 Ga0068855_100211685
199 Ga0068859_101196086
200 Ga0075363_100175547
201 Ga0075363_100193009
202 Ga0075370_10278889
203 Ga0097620_101196137
204 Ga0111539_11011694
205 Ga0105245_10068323
206 Ga0105243_10895408
207 Ga0105242_10862048
208 Ga0105239_10525731
209 Ga0157375_10071437
210 Ga0157375_10087385
211 Ga0183367_1002
212 Ga0207705_10205632
213 Ga0207707_10245842
214 Ga0207660_10243605
215 Ga0207652_10104666
216 Ga0207664_10036295
217 Ga0207686_10091366
218 Ga0207669_10639341
219 Ga0207711_10556685
220 Ga0207661_10025808
221 Ga0207658_10877515
222 Ga0207708_10710964
223 Ga0207698_10670780
224 Ga0265334_10001478
225 Ga0307515_10169545
226 Ga0307511_10001682
227 Ga0307511_10194384
228 Ga0307512_10038253
229 Ga0307513_10104358
230 Ga0307509_10007642
231 Ga0307509_10007665
232 Ga0307508_10255172
233 Ga0307518_10094350
234 Ga0307518_10164012
235 Ga0307410_10844337
236 Ga0307411_10002593
237 Ga0307510_10049827
238 Ga0439436_0011358
239 Ga0439439_0037856
240 Ga0451793_0944941
241 Ga0451833_0812579
242 Ga0439448_0048945
243 Ga0439432_032709
244 Ga0439457_003489
245 Ga0450894_017561
246 Ga0466969_0031649
247 Ga0466972_0005033
248 Ga0466972_0031438
249 Ga0466965_0003307
250 Ga0466965_0006094
251 Ga0466966_0013102
252 Ga0466966_0042335
253 Ga0466966_0063317
254 Ga0466966_0145598
255 Ga0466961_0001240
256 Ga0466961_0065746
257 Ga0466963_0172635
258 Ga0466964_0005890
259 Ga0453684_0006743
260 Ga0453684_0032271
261 Ga0466971_0000197
262 Ga0466971_0009609
263 Ga0466968_0257566
264 Ga0466970_0002240
265 Ga0466957_0000805
266 Ga0466959_0001684
267 Ga0466959_0020948
268 Ga0466959_0051042
269 Ga0466958_0000955
270 Ga0466967_0030587
271 Ga0466967_0224032
272 Ga0466967_0282276
273 Ga0495617_031088
274 Ga0495592_0062240
275 Ga0495603_0044003
276 Ga0495651_0023977
277 Ga0495605_0055701
278 Ga0495585_0153710
279 Ga0495594_0034494
280 Ga0495594_0350217
281 Ga0495607_0089118
282 Ga0495608_0084075
283 Ga0495610_0094993
284 Ga0495620_0012330
285 Ga0495628_0057656
286 Ga0495631_0149457
287 Ga0495643_0020794
288 Ga0495648_0019231
289 Ga0495666_0031202
290 Ga0495666_0032812
291 Ga0495642_0015749
292 Ga0495652_0033185
293 Ga0495640_0003145
294 Ga0495586_0375259
295 Ga0495597_0041320
296 Ga0495633_0011958
297 Ga0495656_0134218
298 Ga0495668_0009879
299 Ga0495634_0037752
300 Ga0495611_0076062
301 Ga0495625_0053998
302 Ga0495635_0180577
303 Ga0495661_0222258
304 Ga0495623_0026109
305 Ga0495613_0031479
306 Ga0495613_0143256
307 Ga0495613_0216596
308 Ga0495613_0256379
309 Ga0495624_0109217
310 Ga0495649_0170426
311 Ga0495589_0004994
312 Ga0495600_0239509
313 Ga0495660_0082334
314 Ga0495660_0155745
315 Ga0495636_0016696
316 Ga0495636_0036823
317 Ga0495636_0040359
318 Ga0495672_0205395
319 Ga0495676_0022134
320 Ga0495680_0007204
321 Ga0495683_0094390
322 Ga0495687_005013
323 Ga0495687_008400
324 Ga0495687_083800
325 Ga0495685_004812
326 Ga0495685_010846
327 Ga0495685_073375
328 Ga0495684_0053417
329 Ga0495626_0118874
330 Ga0496112_0269827
331 Ga0496112_0546711
332 Ga0496125_0029194
333 nmdc:mga03n38_129844_c1
334 nmdc:mga03n38_208008_c1
335 nmdc:mga07m45_432560_c1
336 nmdc:mga08y16_682911_c1
337 Ga0500644_0185546
338 Ga0500600_0144660
339 2599103394
340 2616701371
341 2644173651
342 2676495000
343 2739206919
344 2785341604
345 2791911243
346 2808843627
347 2812356423
348 2837275159
349 2846953279
350 2862287288
351 2862390787
352 2863411290
353 2866554910
354 2867431947
355 2868095910
356 2919470491
357 2946069435
358 2947227485
359 2954384395
360 2990048326
361 2990067959
362 2990092655
363 3006395973
364 8008577546
365 8048406874
366 8053948537
367 8056215244
368 8056448112

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

69

225

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fva-assembly2.cif.gz_B crystal structure of bovine methionine sulfoxide reductase 0.9737 11 214
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9724 8 202
6yev-assembly4.cif.gz_D crystal structure of msra c206 and trx c35s complex from escherichia coli 0.9678 9 211
6agv-assembly1.cif.gz_A crystal structure of apo mouse msra 0.9674 8 202
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9663 9 197
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9681 46 198 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9637 9 200 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9528 44 201 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9489 46 198 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9439 39 204 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A1C4T425-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.981 38 188 GO:0005737
GO:0008113
GO:0034599
GO:0036456
AF-A0A6J6ZVH5-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9794 45 214 GO:0005737
GO:0008113
GO:0033743
GO:0034599
GO:0036456
AF-A0A2E6EAS7-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9781 25 213 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A5C7PRF4-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9776 9 204 GO:0005737
GO:0008113
GO:0034599
GO:0036211
GO:0036456
AF-A0A444TXS8-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Protein-methionine-S-oxide reductase) 0.9774 27 219 GO:0005737
GO:0008113
GO:0034599
GO:0036456

Map