F283003

General Info

Members Datasets Scaffolds Average Seq Length
184 124 176 901

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0000049|Ga0451577_0000049_145858_148938
Length 943
Sequence MPKYVYSFGGGNADGNETMKNLLGGKGANLAEMAGHPALKLPVPPGFTITTDVCTYYYKHEKTYPVELQKQVEVALKKVEKLMGKKFGDSANPLLVSVRSGARKSMPGMMDTVLNVGLNDDTIQGLIEKTGNARFAYDAYRRLIMMYADVVMEKAEGLEPHGGKGIRKVLDEIMEEVKKEKGFHTDTELSADDLKELVVVFKGKVLEILGKPFPEDPLDQLWGGIGAVFMSWNGKRAKDYRRIERIPDEWGTAVNVQSMVFGNMGENSATGVAFTRNPGSGDAQFYGEYLINAQGEDVVAGIRTPSPINDYSKNDQSSHLPTLHEVMPAIYDELFAIQKKLEKHYRDMQDIEFTIEDGTLYMLQCRIGKRNGVAAVKMATDMYKEKLIDAPTALSRVAPNQLVELLLPMIDPDAELRTTPIAKGLPAGPGGATGRVVFTSETAVEWAGRGEKVILVREETSPEDVDGMHKAQAVLTLKGGMTSHAALVARGWGKCCIVGCSDISITNHSFTTKSGVTVNEGDWVSLNGTKGLVYNGALDLKDVDIEHNESYGVLMGLCDKYRKLKIRTNADTPSDAKKAVIFGAEGIGLFRTEHMFYGEGSEKPLFLLRKMILSANIEERKAALGELSVFVKNDVKATMKVLDGLPLTIRLLDPPLHEFIPQSEEKIAALANELHISVHEAKARGEKLHENNPMLGHRGVRLGITYPEVSEMQIRAIFEAAGELIQEGSKAYPEIMIPVTCSKNEIAHQKQIVEKVYAEVCEKLNMKKIPYLYGTMIEIPRAALTADKFADTAEFFSFGTNDLTQMGFGFSRDDIGSFLPDYLNAKILPADPFQTIDTEGVGELIRIGIERGRSVRTDLKVGICGEHGGDPDSVKFCHKIGMNYVSCSPFRVPIARLAAAQAAVEELAKKDLKKSVVASKSKATLATVSXXXSSIKAQAVKKK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
4 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
5 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
6 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
55 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
83 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
84 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
85 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
86 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
90 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
91 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
93 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
94 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
103 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
104 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
105 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
106 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
107 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
108 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
109 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
110 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
111 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
114 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
115 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
116 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
117 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
118 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
121 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
122 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
123 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
124 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 0.54
Isolates 4.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.24
Nodule 0
Rhizoplane 1.09
Rhizosphere 82.61
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3273488 2162886007 Bacteria 68965
2 Ga0065704_10070144 3300005289 Bacteria 333223
3 Ga0065712_10077367 3300005290 Bacteria 3497
4 Ga0070690_100028186 3300005330 Bacteria 3478
5 Ga0070666_10017731 3300005335 Bacteria 4568
6 Ga0070668_100000028 3300005347 Bacteria 89707
7 Ga0070668_100014085 3300005347 Bacteria 5978
8 Ga0070669_100000666 3300005353 Bacteria 25307
9 Ga0070669_100041723 3300005353 Bacteria 3337
10 Ga0070671_100000052 3300005355 Bacteria 78614
11 Ga0070671_100000750 3300005355 Bacteria 23268
12 Ga0070709_10000072 3300005434 Bacteria 78666
13 Ga0070698_100014069 3300005471 Bacteria 8461
14 Ga0070684_100019244 3300005535 Bacteria 5645
15 Ga0068853_100062973 3300005539 Bacteria 3211
16 Ga0070665_100050680 3300005548 Bacteria 4166
17 Ga0068855_100003628 3300005563 Bacteria 18867
18 Ga0068855_100077120 3300005563 Bacteria 3866
19 Ga0070664_100016465 3300005564 Bacteria 6061
20 Ga0068857_100055325 3300005577 Bacteria 3521
21 Ga0068852_100002978 3300005616 Bacteria 11767
22 Ga0068859_100005065 3300005617 Bacteria 13379
23 Ga0068859_100014978 3300005617 Bacteria 7785
24 Ga0068861_100003102 3300005719 Bacteria 10985
25 Ga0068861_100017313 3300005719 Bacteria 5113
26 Ga0068863_100000092 3300005841 Bacteria 97076
27 Ga0068863_100000116 3300005841 Bacteria 84030
28 Ga0068858_100003069 3300005842 Bacteria 16727
29 Ga0068860_100000192 3300005843 Bacteria 97363
30 Ga0068860_100003789 3300005843 Bacteria 15555
31 Ga0068860_100004874 3300005843 Bacteria 13675
32 Ga0068860_100033603 3300005843 Bacteria 4920
33 Ga0068862_100020274 3300005844 Bacteria 5554
34 Ga0068862_100030291 3300005844 Bacteria 4559
35 Ga0075363_100008139 3300006048 Bacteria 4867
36 Ga0075364_10029683 3300006051 Bacteria 3507
37 Ga0075362_10000007 3300006177 Bacteria 116409
38 Ga0075369_10017279 3300006186 Bacteria 2921
39 Ga0075366_10000068 3300006195 Bacteria 39441
40 Ga0097621_100024824 3300006237 Bacteria 4686
41 Ga0075370_10003235 3300006353 Bacteria 7711
42 Ga0075428_100062704 3300006844 Bacteria 4069
43 Ga0075430_100016610 3300006846 Bacteria 6268
44 Ga0075431_100026275 3300006847 Bacteria 5972
45 Ga0068865_100036042 3300006881 Bacteria 3332
46 Ga0097620_100005066 3300006931 Bacteria 13379
47 Ga0097620_100014977 3300006931 Bacteria 7785
48 Ga0105240_10000340 3300009093 Bacteria 87388
49 Ga0105240_10002643 3300009093 Bacteria 28533
50 Ga0105240_10004075 3300009093 Bacteria 22481
51 Ga0105240_10070942 3300009093 Bacteria 4309
52 Ga0105241_10026586 3300009174 Bacteria 4307
53 Ga0105241_10048882 3300009174 Bacteria 3220
54 Ga0105242_10011894 3300009176 Bacteria 6697
55 Ga0105248_10022584 3300009177 Bacteria 6982
56 Ga0105248_10068421 3300009177 Bacteria 3986
57 Ga0105237_10003370 3300009545 Bacteria 19015
58 Ga0105238_10006075 3300009551 Bacteria 11978
59 Ga0105238_10009964 3300009551 Bacteria 9529
60 Ga0105249_10002039 3300009553 Bacteria 17525
61 Ga0105249_10002730 3300009553 Bacteria 15266
62 Ga0105249_10023867 3300009553 Bacteria 5493
63 Ga0157371_10002753 3300013102 Bacteria 16525
64 Ga0157370_10000990 3300013104 Bacteria 35940
65 Ga0157370_10002370 3300013104 Bacteria 22713
66 Ga0157369_10013920 3300013105 Bacteria 9088
67 Ga0163162_10005976 3300013306 Bacteria 11781
68 Ga0163163_10002407 3300014325 Bacteria 15820
69 Ga0157380_10015067 3300014326 Bacteria 5672
70 Ga0157377_10009571 3300014745 Bacteria 4762
71 Ga0209050_1000215 3300025298 Bacteria 129179
72 Ga0207647_10000476 3300025904 Bacteria 32374
73 Ga0207699_10000076 3300025906 Bacteria 78930
74 Ga0207643_10023898 3300025908 Bacteria 3372
75 Ga0207695_10002726 3300025913 Bacteria 25785
76 Ga0207695_10020732 3300025913 Bacteria 7520
77 Ga0207695_10030059 3300025913 Bacteria 5988
78 Ga0207695_10030772 3300025913 Bacteria 5905
79 Ga0207657_10003237 3300025919 Bacteria 17428
80 Ga0207681_10001698 3300025923 Bacteria 14165
81 Ga0207694_10003355 3300025924 Bacteria 12745
82 Ga0207694_10011999 3300025924 Bacteria 6533
83 Ga0207687_10001907 3300025927 Bacteria 14346
84 Ga0207644_10000003 3300025931 Bacteria 585905
85 Ga0207644_10000094 3300025931 Bacteria 64592
86 Ga0207711_10000752 3300025941 Bacteria 31778
87 Ga0207661_10014341 3300025944 Bacteria 5807
88 Ga0207679_10007110 3300025945 Bacteria 7092
89 Ga0207667_10002812 3300025949 Bacteria 21572
90 Ga0207667_10055853 3300025949 Bacteria 4149
91 Ga0207712_10012714 3300025961 Bacteria 5379
92 Ga0207712_10019149 3300025961 Bacteria 4466
93 Ga0207668_10001023 3300025972 Bacteria 16730
94 Ga0207658_10005674 3300025986 Bacteria 8535
95 Ga0207703_10009931 3300026035 Bacteria 7468
96 Ga0207702_10048660 3300026078 Bacteria 3576
97 Ga0207641_10000004 3300026088 Bacteria 481088
98 Ga0207641_10000035 3300026088 Bacteria 214358
99 Ga0207641_10006685 3300026088 Bacteria 9667
100 Ga0207674_10017986 3300026116 Bacteria 7699
101 Ga0207674_10025981 3300026116 Bacteria 6231
102 Ga0207675_100008711 3300026118 Bacteria 9536
103 Ga0268266_10016231 3300028379 Bacteria 6366
104 Ga0268265_10024843 3300028380 Bacteria 4245
105 Ga0268264_10000018 3300028381 Bacteria 495324
106 Ga0268264_10000226 3300028381 Bacteria 109817
107 Ga0268264_10002475 3300028381 Bacteria 16228
108 Ga0265322_10000151 3300028654 Bacteria 31679
109 Ga0265322_10008828 3300028654 Bacteria 2931
110 Ga0265338_10018226 3300028800 Bacteria 7525
111 Ga0265324_10000020 3300029957 Bacteria 172436
112 Ga0265332_10018994 3300031238 Bacteria 3034
113 Ga0265339_10000009 3300031249 Bacteria 221449
114 Ga0265316_10000116 3300031344 Bacteria 86833
115 Ga0265316_10000576 3300031344 Bacteria 41017
116 Ga0265316_10001473 3300031344 Bacteria 25220
117 Ga0265316_10002138 3300031344 Bacteria 20777
118 Ga0265316_10002754 3300031344 Bacteria 18010
119 Ga0265316_10025648 3300031344 Bacteria 4916
120 Ga0265316_10037015 3300031344 Bacteria 3943
121 Ga0265313_10004090 3300031595 Bacteria 11356
122 Ga0265314_10002244 3300031711 Bacteria 20023
123 Ga0265342_10000040 3300031712 Bacteria 139906
124 Ga0265342_10000985 3300031712 Bacteria 28059
125 Ga0316578_10000620 3300031728 Bacteria 12476
126 Ga0316577_10003554 3300031733 Bacteria 7894
127 Ga0316577_10024257 3300031733 Bacteria 3371
128 Ga0316587_1001023 3300033529 Bacteria 3245
129 Ga0373927_0005137 3300035695 Bacteria 9058
130 Ga0373927_0013023 3300035695 Bacteria 5532
131 Ga0373947_0010620 3300035725 Bacteria 5283
132 Ga0316584_0000519 3300036712 Bacteria 20482
133 Ga0316584_0000812 3300036712 Bacteria 17588
134 Ga0451577_0000049 3300042876 Bacteria 304750
135 Ga0453683_0002875 3300044673 Bacteria 13028
136 Ga0453684_0000049 3300044712 Bacteria 559289
137 Ga0453684_0000156 3300044712 Bacteria 304753
138 Ga0453684_0000307 3300044712 Bacteria 207314
139 Ga0453684_0001159 3300044712 Bacteria 82240
140 Ga0453684_0002804 3300044712 Bacteria 41206
141 Ga0453684_0025298 3300044712 Bacteria 8625
142 Ga0453684_0029189 3300044712 Bacteria 7844
143 Ga0451576_0002928 3300045051 Bacteria 24282
144 Ga0451576_0003912 3300045051 Bacteria 19894
145 Ga0451576_0005490 3300045051 Bacteria 15869
146 Ga0451576_0055875 3300045051 Bacteria 4129
147 Ga0495580_0007417 3300046472 Bacteria 8819
148 Ga0495610_0003946 3300046512 Bacteria 11235
149 Ga0495643_0000199 3300046522 Bacteria 93741
150 Ga0495643_0014805 3300046522 Bacteria 4631
151 Ga0495615_0000079 3300048090 Bacteria 29318
152 Ga0496105_0062638 3300048908 Bacteria 3069
153 Ga0496107_0005195 3300048910 Bacteria 8897
154 Ga0496116_0000060 3300048919 Bacteria 272219
155 Ga0496121_0001098 3300048924 Bacteria 47733
156 Ga0496122_0001106 3300048925 Bacteria 46592
157 Ga0496123_0001757 3300048926 Bacteria 28598
158 Ga0496124_0002938 3300048927 Bacteria 21440
159 Ga0496124_0010817 3300048927 Bacteria 9189
160 Ga0496125_0008290 3300048928 Bacteria 10915
161 Ga0496126_0001633 3300048929 Bacteria 33895
162 Ga0496126_0003145 3300048929 Bacteria 21275
163 Ga0501034_0095767 3300049571 Bacteria 2965
164 nmdc:mga03683_18_c1 3300050489 Bacteria 86681
165 nmdc:mga00v17_5183_c1 3300050491 Bacteria 6856
166 nmdc:mga00v17_8478_c1 3300050491 Bacteria 5532
167 nmdc:mga0k408_145_c1 3300050493 Bacteria 36258
168 nmdc:mga07m45_226_c1 3300050496 Bacteria 14972
169 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
170 nmdc:mga09592_3689_c1 3300050508 Bacteria 12345
171 nmdc:mga06r32_138393_c1 3300050510 Bacteria 2409
172 nmdc:mga0sz30_4692_c1 3300050516 Bacteria 4960
173 nmdc:mga0sz30_742_c1 3300050516 Bacteria 11923
174 Ga0495595_0014867 3300053084 Bacteria 3309
175 Ga0500643_000001 3300053087 Bacteria 1440111
176 Ga0500622_0000495 3300053156 Bacteria 36800

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_138393_c1 nmdc:mga06r32_138393_c1_63_2381 742
2 3300014745 Ga0157377_10009571 Ga0157377_100095711 782
3 3300053084 Ga0495595_0014867 Ga0495595_0014867_323_2860 815
4 3300036712 Ga0316584_0000519 Ga0316584_0000519_8981_11692 838
5 3300009093 Ga0105240_10000340 Ga0105240_1000034072 845
6 3300009545 Ga0105237_10003370 Ga0105237_1000337015 845
7 3300025913 Ga0207695_10020732 Ga0207695_100207322 845
8 3300031344 Ga0265316_10000576 Ga0265316_1000057615 845
9 3300006048 Ga0075363_100008139 Ga0075363_1000081393 847
10 3300006177 Ga0075362_10000007 Ga0075362_10000007105 847
11 3300006195 Ga0075366_10000068 Ga0075366_1000006834 847
12 3300006353 Ga0075370_10003235 Ga0075370_100032353 847
13 3300050489 nmdc:mga03683_18_c1 nmdc:mga03683_18_c1_18928_21588 847
14 3300050493 nmdc:mga0k408_145_c1 nmdc:mga0k408_145_c1_13586_16246 847
15 3300050496 nmdc:mga07m45_8_c1 nmdc:mga07m45_8_c1_96383_99043 847
16 3300050516 nmdc:mga0sz30_742_c1 nmdc:mga0sz30_742_c1_6243_8903 847
17 3300050496 nmdc:mga07m45_226_c1 nmdc:mga07m45_226_c1_7381_10083 849
18 3300025298 Ga0209050_1000215 Ga0209050_100021581 851
19 3300046512 Ga0495610_0003946 Ga0495610_0003946_1832_4495 851
20 3300046522 Ga0495643_0000199 Ga0495643_0000199_42871_45534 851
21 3300031344 Ga0265316_10000116 Ga0265316_1000011641 854
22 3300031712 Ga0265342_10000985 Ga0265342_100009859 854
23 3300031344 Ga0265316_10002754 Ga0265316_100027542 856
24 3300031344 Ga0265316_10037015 Ga0265316_100370152 856
25 3300028654 Ga0265322_10000151 Ga0265322_100001516 857
26 3300028800 Ga0265338_10018226 Ga0265338_100182265 857
27 3300031344 Ga0265316_10002138 Ga0265316_100021386 857
28 3300031344 Ga0265316_10025648 Ga0265316_100256483 861
29 3300005563 Ga0068855_100077120 Ga0068855_1000771202 864
30 3300005843 Ga0068860_100004874 Ga0068860_10000487414 864
31 3300006051 Ga0075364_10029683 Ga0075364_100296832 864
32 3300028381 Ga0268264_10000226 Ga0268264_1000022657 864
33 3300031733 Ga0316577_10024257 Ga0316577_100242571 864
34 3300050491 nmdc:mga00v17_5183_c1 nmdc:mga00v17_5183_c1_304_2970 864
35 3300045051 Ga0451576_0003912 Ga0451576_0003912_9815_12553 865
36 3300045051 Ga0451576_0055875 Ga0451576_0055875_1238_3964 865
37 iso_pu_bacteria 8002317523 8002324654 866
38 iso_pu_bacteria 8046991243 8046994974 866
39 3300044712 Ga0453684_0000049 Ga0453684_0000049_56878_59616 868
40 3300049571 Ga0501034_0095767 Ga0501034_0095767_52_2685 868
41 iso_pu_bacteria 2925326138 2925331560 868
42 3300005347 Ga0070668_100000028 Ga0070668_10000002817 869
43 3300005355 Ga0070671_100000750 Ga0070671_1000007507 869
44 3300005841 Ga0068863_100000092 Ga0068863_10000009296 869
45 3300025931 Ga0207644_10000094 Ga0207644_1000009451 869
46 3300025972 Ga0207668_10001023 Ga0207668_100010234 869
47 3300026088 Ga0207641_10000004 Ga0207641_10000004395 869
48 3300028381 Ga0268264_10002475 Ga0268264_1000247514 869
49 3300005335 Ga0070666_10017731 Ga0070666_100177312 871
50 3300005539 Ga0068853_100062973 Ga0068853_1000629732 871
51 3300005563 Ga0068855_100003628 Ga0068855_10000362813 871
52 3300005577 Ga0068857_100055325 Ga0068857_1000553252 871
53 3300005842 Ga0068858_100003069 Ga0068858_10000306910 871
54 3300005843 Ga0068860_100033603 Ga0068860_1000336032 871
55 3300006237 Ga0097621_100024824 Ga0097621_1000248241 871
56 3300006881 Ga0068865_100036042 Ga0068865_1000360421 871
57 3300009093 Ga0105240_10002643 Ga0105240_1000264310 871
58 3300009093 Ga0105240_10004075 Ga0105240_100040752 871
59 3300009093 Ga0105240_10070942 Ga0105240_100709422 871
60 3300009174 Ga0105241_10026586 Ga0105241_100265862 871
61 3300009176 Ga0105242_10011894 Ga0105242_100118943 871
62 3300009177 Ga0105248_10068421 Ga0105248_100684212 871
63 3300009551 Ga0105238_10006075 Ga0105238_1000607510 871
64 3300009551 Ga0105238_10009964 Ga0105238_100099646 871
65 3300013104 Ga0157370_10000990 Ga0157370_1000099019 871
66 3300013104 Ga0157370_10002370 Ga0157370_1000237011 871
67 3300013105 Ga0157369_10013920 Ga0157369_100139202 871
68 3300013306 Ga0163162_10005976 Ga0163162_100059766 871
69 3300014325 Ga0163163_10002407 Ga0163163_100024078 871
70 3300025913 Ga0207695_10002726 Ga0207695_100027266 871
71 3300025913 Ga0207695_10030059 Ga0207695_100300593 871
72 3300025919 Ga0207657_10003237 Ga0207657_1000323710 871
73 3300025924 Ga0207694_10003355 Ga0207694_100033552 871
74 3300025924 Ga0207694_10011999 Ga0207694_100119993 871
75 3300025927 Ga0207687_10001907 Ga0207687_1000190712 871
76 3300025941 Ga0207711_10000752 Ga0207711_100007523 871
77 3300025949 Ga0207667_10002812 Ga0207667_1000281215 871
78 3300025949 Ga0207667_10055853 Ga0207667_100558532 871
79 3300025961 Ga0207712_10012714 Ga0207712_100127142 871
80 3300026035 Ga0207703_10009931 Ga0207703_100099312 871
81 3300026078 Ga0207702_10048660 Ga0207702_100486602 871
82 3300026088 Ga0207641_10006685 Ga0207641_100066852 871
83 3300026116 Ga0207674_10025981 Ga0207674_100259814 871
84 3300031711 Ga0265314_10002244 Ga0265314_100022442 871
85 3300035695 Ga0373927_0005137 Ga0373927_0005137_2811_5546 871
86 3300035695 Ga0373927_0013023 Ga0373927_0013023_1819_4557 871
87 3300035725 Ga0373947_0010620 Ga0373947_0010620_322_3057 871
88 3300046472 Ga0495580_0007417 Ga0495580_0007417_3472_6207 871
89 3300029957 Ga0265324_10000020 Ga0265324_1000002052 874
90 3300031249 Ga0265339_10000009 Ga0265339_10000009179 874
91 3300031595 Ga0265313_10004090 Ga0265313_100040905 874
92 3300005535 Ga0070684_100019244 Ga0070684_1000192444 875
93 3300005564 Ga0070664_100016465 Ga0070664_1000164654 875
94 3300025944 Ga0207661_10014341 Ga0207661_100143412 875
95 3300025945 Ga0207679_10007110 Ga0207679_100071104 875
96 3300005434 Ga0070709_10000072 Ga0070709_1000007259 876
97 3300025906 Ga0207699_10000076 Ga0207699_100000763 876
98 3300031728 Ga0316578_10000620 Ga0316578_100006204 876
99 3300031733 Ga0316577_10003554 Ga0316577_100035542 876
100 3300036712 Ga0316584_0000812 Ga0316584_0000812_10549_13290 876
101 3300033529 Ga0316587_1001023 Ga0316587_10010232 880
102 3300042876 Ga0451577_0000049 Ga0451577_0000049_145858_148938 880
103 3300044673 Ga0453683_0002875 Ga0453683_0002875_245_3325 880
104 3300044712 Ga0453684_0000156 Ga0453684_0000156_155816_158896 880
105 3300044712 Ga0453684_0000307 Ga0453684_0000307_23225_26251 880
106 3300044712 Ga0453684_0002804 Ga0453684_0002804_29249_32278 880
107 3300045051 Ga0451576_0002928 Ga0451576_0002928_15795_18872 880
108 3300028654 Ga0265322_10008828 Ga0265322_100088281 881
109 3300031238 Ga0265332_10018994 Ga0265332_100189942 881
110 3300031344 Ga0265316_10001473 Ga0265316_100014733 881
111 3300031712 Ga0265342_10000040 Ga0265342_1000004039 881
112 3300044712 Ga0453684_0025298 Ga0453684_0025298_5143_7923 882
113 3300045051 Ga0451576_0005490 Ga0451576_0005490_6091_8871 882
114 3300044712 Ga0453684_0001159 Ga0453684_0001159_51500_54247 883
115 iso_pu_bacteria 2510917021 2511128735 883
116 iso_pu_bacteria 2818991438 2819550502 883
117 iso_pu_bacteria 2896253425 2896255175 883
118 iso_pu_bacteria 2919138771 2919139871 883
119 3300005290 Ga0065712_10077367 Ga0065712_100773672 884
120 3300005347 Ga0070668_100014085 Ga0070668_1000140853 884
121 3300005353 Ga0070669_100041723 Ga0070669_1000417232 884
122 3300005471 Ga0070698_100014069 Ga0070698_1000140693 884
123 3300005616 Ga0068852_100002978 Ga0068852_1000029788 884
124 3300005617 Ga0068859_100005065 Ga0068859_1000050655 884
125 3300005617 Ga0068859_100014978 Ga0068859_1000149783 884
126 3300005719 Ga0068861_100003102 Ga0068861_10000310210 884
127 3300005719 Ga0068861_100017313 Ga0068861_1000173132 884
128 3300005843 Ga0068860_100003789 Ga0068860_1000037895 884
129 3300006844 Ga0075428_100062704 Ga0075428_1000627042 884
130 3300006846 Ga0075430_100016610 Ga0075430_1000166102 884
131 3300006847 Ga0075431_100026275 Ga0075431_1000262752 884
132 3300006931 Ga0097620_100005066 Ga0097620_1000050665 884
133 3300006931 Ga0097620_100014977 Ga0097620_1000149775 884
134 3300009174 Ga0105241_10048882 Ga0105241_100488822 884
135 3300009553 Ga0105249_10002039 Ga0105249_100020393 884
136 3300009553 Ga0105249_10023867 Ga0105249_100238675 884
137 3300013102 Ga0157371_10002753 Ga0157371_1000275312 884
138 3300014326 Ga0157380_10015067 Ga0157380_100150675 884
139 3300025904 Ga0207647_10000476 Ga0207647_1000047613 884
140 3300025908 Ga0207643_10023898 Ga0207643_100238982 884
141 3300025913 Ga0207695_10030772 Ga0207695_100307723 884
142 3300026116 Ga0207674_10017986 Ga0207674_100179863 884
143 3300026118 Ga0207675_100008711 Ga0207675_1000087113 884
144 3300028380 Ga0268265_10024843 Ga0268265_100248432 884
145 3300044712 Ga0453684_0029189 Ga0453684_0029189_2691_5435 884
146 3300050508 nmdc:mga09592_3689_c1 nmdc:mga09592_3689_c1_3118_6021 884
147 3300005844 Ga0068862_100030291 Ga0068862_1000302912 885
148 3300009553 Ga0105249_10002730 Ga0105249_1000273014 885
149 3300025961 Ga0207712_10019149 Ga0207712_100191492 885
150 3300048919 Ga0496116_0000060 Ga0496116_0000060_36291_38969 885
151 3300048925 Ga0496122_0001106 Ga0496122_0001106_30441_33119 885
152 3300048927 Ga0496124_0010817 Ga0496124_0010817_5269_7947 885
153 3300048928 Ga0496125_0008290 Ga0496125_0008290_1418_4096 885
154 3300048929 Ga0496126_0001633 Ga0496126_0001633_8050_10728 885
155 iso_pu_bacteria 2818991438 2819552068 885
156 3300005330 Ga0070690_100028186 Ga0070690_1000281862 886
157 3300005353 Ga0070669_100000666 Ga0070669_1000006667 886
158 3300005355 Ga0070671_100000052 Ga0070671_1000000524 886
159 3300005548 Ga0070665_100050680 Ga0070665_1000506802 886
160 3300005841 Ga0068863_100000116 Ga0068863_10000011648 886
161 3300005843 Ga0068860_100000192 Ga0068860_10000019276 886
162 3300005844 Ga0068862_100020274 Ga0068862_1000202743 886
163 3300009177 Ga0105248_10022584 Ga0105248_100225845 886
164 3300025923 Ga0207681_10001698 Ga0207681_100016987 886
165 3300025931 Ga0207644_10000003 Ga0207644_10000003484 886
166 3300025986 Ga0207658_10005674 Ga0207658_100056741 886
167 3300026088 Ga0207641_10000035 Ga0207641_1000003534 886
168 3300028379 Ga0268266_10016231 Ga0268266_100162312 886
169 3300028381 Ga0268264_10000018 Ga0268264_1000001822 886
170 3300048908 Ga0496105_0062638 Ga0496105_0062638_145_2805 886
171 3300048910 Ga0496107_0005195 Ga0496107_0005195_5110_7770 886
172 3300048924 Ga0496121_0001098 Ga0496121_0001098_13576_16236 886
173 3300048929 Ga0496126_0003145 Ga0496126_0003145_12805_15516 886
174 2162886007 SwRhRL2b_contig_3273488 SwRhRL2b_0336.00004610 887
175 3300005289 Ga0065704_10070144 Ga0065704_10070144139 887
176 3300006186 Ga0075369_10017279 Ga0075369_100172792 887
177 3300046522 Ga0495643_0014805 Ga0495643_0014805_1518_4181 887
178 3300048090 Ga0495615_0000079 Ga0495615_0000079_23922_26585 887
179 3300048926 Ga0496123_0001757 Ga0496123_0001757_23253_25916 887
180 3300048927 Ga0496124_0002938 Ga0496124_0002938_9918_12584 887
181 3300050491 nmdc:mga00v17_8478_c1 nmdc:mga00v17_8478_c1_1564_4227 887
182 3300050516 nmdc:mga0sz30_4692_c1 nmdc:mga0sz30_4692_c1_2190_4853 887
183 3300053087 Ga0500643_000001 Ga0500643_000001_1373795_1376461 887
184 3300053156 Ga0500622_0000495 Ga0500622_0000495_5313_7982 887

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00391

PEP-utilizers

PEP-utilising enzyme, mobile domain

449

531

0.97

PF01326

PPDK_N

Pyruvate phosphate dikinase, AMP/ATP-binding domain

60

327

0.96

PF01326

PPDK_N

Pyruvate phosphate dikinase, AMP/ATP-binding domain

20

65

0.92

PF02896

PEP-utilizers_C

PEP-utilising enzyme, PEP-binding domain

546

904

0.92

PF01326

PPDK_N

Pyruvate phosphate dikinase, AMP/ATP-binding domain

308

387

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jvl-assembly2.cif.gz_B c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue 0.9339 263 884
1vbg-assembly1.cif.gz_A-2 pyruvate phosphate dikinase from maize 0.9285 2 885
5jvl-assembly2.cif.gz_B c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue 0.9269 263 884
1vbg-assembly1.cif.gz_A-2 pyruvate phosphate dikinase from maize 0.9265 2 885
2r82-assembly1.cif.gz_A-2 pyruvate phosphate dikinase (ppdk) triple mutant r219e/e271r/s262d adapts a second conformational state 0.9136 2 886
ID Description Score Start End Superfamily
1kc7A05 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9935 116 203 1.20.80.30
2r82A02 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9903 116 201 1.20.80.30
1dikA04 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9825 547 886 3.20.20.60
1buk005 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9796 116 203 1.20.80.30
1kblA05 Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; 0.9774 116 203 1.20.80.30
ID Description Score Start End GO Terms
AF-A0A2E0ULC6-F1-model_v4 Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) 1.001 758 886 GO:0006090
GO:0050242
AF-A0A662REV5-F1-model_v4 Pyruvate, phosphate dikinase (EC 2.7.9.1) 1 756 886 GO:0006090
GO:0016301
GO:0050242
AF-A0A349H8F9-F1-model_v4 Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) 0.9988 750 886 GO:0006090
GO:0016301
GO:0050242
AF-A0A0P9DNR6-F1-model_v4 Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) 0.9982 751 886 GO:0006090
GO:0046872
GO:0050242
AF-A0A7Y3GVR5-F1-model_v4 Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) 0.9981 754 886 GO:0006090
GO:0016301
GO:0050242

Feature Viewer

pLDDT pTM Quality
90.1 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map