F283003
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 184 | 124 | 176 | 901 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0000049|Ga0451577_0000049_145858_148938 |
| Length | 943 |
| Sequence | MPKYVYSFGGGNADGNETMKNLLGGKGANLAEMAGHPALKLPVPPGFTITTDVCTYYYKHEKTYPVELQKQVEVALKKVEKLMGKKFGDSANPLLVSVRSGARKSMPGMMDTVLNVGLNDDTIQGLIEKTGNARFAYDAYRRLIMMYADVVMEKAEGLEPHGGKGIRKVLDEIMEEVKKEKGFHTDTELSADDLKELVVVFKGKVLEILGKPFPEDPLDQLWGGIGAVFMSWNGKRAKDYRRIERIPDEWGTAVNVQSMVFGNMGENSATGVAFTRNPGSGDAQFYGEYLINAQGEDVVAGIRTPSPINDYSKNDQSSHLPTLHEVMPAIYDELFAIQKKLEKHYRDMQDIEFTIEDGTLYMLQCRIGKRNGVAAVKMATDMYKEKLIDAPTALSRVAPNQLVELLLPMIDPDAELRTTPIAKGLPAGPGGATGRVVFTSETAVEWAGRGEKVILVREETSPEDVDGMHKAQAVLTLKGGMTSHAALVARGWGKCCIVGCSDISITNHSFTTKSGVTVNEGDWVSLNGTKGLVYNGALDLKDVDIEHNESYGVLMGLCDKYRKLKIRTNADTPSDAKKAVIFGAEGIGLFRTEHMFYGEGSEKPLFLLRKMILSANIEERKAALGELSVFVKNDVKATMKVLDGLPLTIRLLDPPLHEFIPQSEEKIAALANELHISVHEAKARGEKLHENNPMLGHRGVRLGITYPEVSEMQIRAIFEAAGELIQEGSKAYPEIMIPVTCSKNEIAHQKQIVEKVYAEVCEKLNMKKIPYLYGTMIEIPRAALTADKFADTAEFFSFGTNDLTQMGFGFSRDDIGSFLPDYLNAKILPADPFQTIDTEGVGELIRIGIERGRSVRTDLKVGICGEHGGDPDSVKFCHKIGMNYVSCSPFRVPIARLAAAQAAVEELAKKDLKKSVVASKSKATLATVSXXXSSIKAQAVKKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2510917021 | Novosphingobium sp. AP12 | Isolate | Rhizosphere |
| 3 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 4 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 5 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 6 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 7 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 18 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 20 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 26 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 27 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 28 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 29 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 32 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 33 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 34 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 35 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 36 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 37 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 38 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 39 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 40 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 81 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 82 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 83 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 85 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 86 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 87 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 88 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 89 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 90 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 91 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 92 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 93 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 94 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 95 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 96 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 97 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 98 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 99 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 104 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 105 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 106 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 107 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 108 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 109 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 110 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 111 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 112 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 114 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 115 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 116 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 117 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 120 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 122 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 123 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 124 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.11 |
| Metatranscriptomes | 0.54 |
| Isolates | 4.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.24 |
| Nodule | 0 |
| Rhizoplane | 1.09 |
| Rhizosphere | 82.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3273488 | 2162886007 | Bacteria | 68965 |
| 2 | Ga0065704_10070144 | 3300005289 | Bacteria | 333223 |
| 3 | Ga0065712_10077367 | 3300005290 | Bacteria | 3497 |
| 4 | Ga0070690_100028186 | 3300005330 | Bacteria | 3478 |
| 5 | Ga0070666_10017731 | 3300005335 | Bacteria | 4568 |
| 6 | Ga0070668_100000028 | 3300005347 | Bacteria | 89707 |
| 7 | Ga0070668_100014085 | 3300005347 | Bacteria | 5978 |
| 8 | Ga0070669_100000666 | 3300005353 | Bacteria | 25307 |
| 9 | Ga0070669_100041723 | 3300005353 | Bacteria | 3337 |
| 10 | Ga0070671_100000052 | 3300005355 | Bacteria | 78614 |
| 11 | Ga0070671_100000750 | 3300005355 | Bacteria | 23268 |
| 12 | Ga0070709_10000072 | 3300005434 | Bacteria | 78666 |
| 13 | Ga0070698_100014069 | 3300005471 | Bacteria | 8461 |
| 14 | Ga0070684_100019244 | 3300005535 | Bacteria | 5645 |
| 15 | Ga0068853_100062973 | 3300005539 | Bacteria | 3211 |
| 16 | Ga0070665_100050680 | 3300005548 | Bacteria | 4166 |
| 17 | Ga0068855_100003628 | 3300005563 | Bacteria | 18867 |
| 18 | Ga0068855_100077120 | 3300005563 | Bacteria | 3866 |
| 19 | Ga0070664_100016465 | 3300005564 | Bacteria | 6061 |
| 20 | Ga0068857_100055325 | 3300005577 | Bacteria | 3521 |
| 21 | Ga0068852_100002978 | 3300005616 | Bacteria | 11767 |
| 22 | Ga0068859_100005065 | 3300005617 | Bacteria | 13379 |
| 23 | Ga0068859_100014978 | 3300005617 | Bacteria | 7785 |
| 24 | Ga0068861_100003102 | 3300005719 | Bacteria | 10985 |
| 25 | Ga0068861_100017313 | 3300005719 | Bacteria | 5113 |
| 26 | Ga0068863_100000092 | 3300005841 | Bacteria | 97076 |
| 27 | Ga0068863_100000116 | 3300005841 | Bacteria | 84030 |
| 28 | Ga0068858_100003069 | 3300005842 | Bacteria | 16727 |
| 29 | Ga0068860_100000192 | 3300005843 | Bacteria | 97363 |
| 30 | Ga0068860_100003789 | 3300005843 | Bacteria | 15555 |
| 31 | Ga0068860_100004874 | 3300005843 | Bacteria | 13675 |
| 32 | Ga0068860_100033603 | 3300005843 | Bacteria | 4920 |
| 33 | Ga0068862_100020274 | 3300005844 | Bacteria | 5554 |
| 34 | Ga0068862_100030291 | 3300005844 | Bacteria | 4559 |
| 35 | Ga0075363_100008139 | 3300006048 | Bacteria | 4867 |
| 36 | Ga0075364_10029683 | 3300006051 | Bacteria | 3507 |
| 37 | Ga0075362_10000007 | 3300006177 | Bacteria | 116409 |
| 38 | Ga0075369_10017279 | 3300006186 | Bacteria | 2921 |
| 39 | Ga0075366_10000068 | 3300006195 | Bacteria | 39441 |
| 40 | Ga0097621_100024824 | 3300006237 | Bacteria | 4686 |
| 41 | Ga0075370_10003235 | 3300006353 | Bacteria | 7711 |
| 42 | Ga0075428_100062704 | 3300006844 | Bacteria | 4069 |
| 43 | Ga0075430_100016610 | 3300006846 | Bacteria | 6268 |
| 44 | Ga0075431_100026275 | 3300006847 | Bacteria | 5972 |
| 45 | Ga0068865_100036042 | 3300006881 | Bacteria | 3332 |
| 46 | Ga0097620_100005066 | 3300006931 | Bacteria | 13379 |
| 47 | Ga0097620_100014977 | 3300006931 | Bacteria | 7785 |
| 48 | Ga0105240_10000340 | 3300009093 | Bacteria | 87388 |
| 49 | Ga0105240_10002643 | 3300009093 | Bacteria | 28533 |
| 50 | Ga0105240_10004075 | 3300009093 | Bacteria | 22481 |
| 51 | Ga0105240_10070942 | 3300009093 | Bacteria | 4309 |
| 52 | Ga0105241_10026586 | 3300009174 | Bacteria | 4307 |
| 53 | Ga0105241_10048882 | 3300009174 | Bacteria | 3220 |
| 54 | Ga0105242_10011894 | 3300009176 | Bacteria | 6697 |
| 55 | Ga0105248_10022584 | 3300009177 | Bacteria | 6982 |
| 56 | Ga0105248_10068421 | 3300009177 | Bacteria | 3986 |
| 57 | Ga0105237_10003370 | 3300009545 | Bacteria | 19015 |
| 58 | Ga0105238_10006075 | 3300009551 | Bacteria | 11978 |
| 59 | Ga0105238_10009964 | 3300009551 | Bacteria | 9529 |
| 60 | Ga0105249_10002039 | 3300009553 | Bacteria | 17525 |
| 61 | Ga0105249_10002730 | 3300009553 | Bacteria | 15266 |
| 62 | Ga0105249_10023867 | 3300009553 | Bacteria | 5493 |
| 63 | Ga0157371_10002753 | 3300013102 | Bacteria | 16525 |
| 64 | Ga0157370_10000990 | 3300013104 | Bacteria | 35940 |
| 65 | Ga0157370_10002370 | 3300013104 | Bacteria | 22713 |
| 66 | Ga0157369_10013920 | 3300013105 | Bacteria | 9088 |
| 67 | Ga0163162_10005976 | 3300013306 | Bacteria | 11781 |
| 68 | Ga0163163_10002407 | 3300014325 | Bacteria | 15820 |
| 69 | Ga0157380_10015067 | 3300014326 | Bacteria | 5672 |
| 70 | Ga0157377_10009571 | 3300014745 | Bacteria | 4762 |
| 71 | Ga0209050_1000215 | 3300025298 | Bacteria | 129179 |
| 72 | Ga0207647_10000476 | 3300025904 | Bacteria | 32374 |
| 73 | Ga0207699_10000076 | 3300025906 | Bacteria | 78930 |
| 74 | Ga0207643_10023898 | 3300025908 | Bacteria | 3372 |
| 75 | Ga0207695_10002726 | 3300025913 | Bacteria | 25785 |
| 76 | Ga0207695_10020732 | 3300025913 | Bacteria | 7520 |
| 77 | Ga0207695_10030059 | 3300025913 | Bacteria | 5988 |
| 78 | Ga0207695_10030772 | 3300025913 | Bacteria | 5905 |
| 79 | Ga0207657_10003237 | 3300025919 | Bacteria | 17428 |
| 80 | Ga0207681_10001698 | 3300025923 | Bacteria | 14165 |
| 81 | Ga0207694_10003355 | 3300025924 | Bacteria | 12745 |
| 82 | Ga0207694_10011999 | 3300025924 | Bacteria | 6533 |
| 83 | Ga0207687_10001907 | 3300025927 | Bacteria | 14346 |
| 84 | Ga0207644_10000003 | 3300025931 | Bacteria | 585905 |
| 85 | Ga0207644_10000094 | 3300025931 | Bacteria | 64592 |
| 86 | Ga0207711_10000752 | 3300025941 | Bacteria | 31778 |
| 87 | Ga0207661_10014341 | 3300025944 | Bacteria | 5807 |
| 88 | Ga0207679_10007110 | 3300025945 | Bacteria | 7092 |
| 89 | Ga0207667_10002812 | 3300025949 | Bacteria | 21572 |
| 90 | Ga0207667_10055853 | 3300025949 | Bacteria | 4149 |
| 91 | Ga0207712_10012714 | 3300025961 | Bacteria | 5379 |
| 92 | Ga0207712_10019149 | 3300025961 | Bacteria | 4466 |
| 93 | Ga0207668_10001023 | 3300025972 | Bacteria | 16730 |
| 94 | Ga0207658_10005674 | 3300025986 | Bacteria | 8535 |
| 95 | Ga0207703_10009931 | 3300026035 | Bacteria | 7468 |
| 96 | Ga0207702_10048660 | 3300026078 | Bacteria | 3576 |
| 97 | Ga0207641_10000004 | 3300026088 | Bacteria | 481088 |
| 98 | Ga0207641_10000035 | 3300026088 | Bacteria | 214358 |
| 99 | Ga0207641_10006685 | 3300026088 | Bacteria | 9667 |
| 100 | Ga0207674_10017986 | 3300026116 | Bacteria | 7699 |
| 101 | Ga0207674_10025981 | 3300026116 | Bacteria | 6231 |
| 102 | Ga0207675_100008711 | 3300026118 | Bacteria | 9536 |
| 103 | Ga0268266_10016231 | 3300028379 | Bacteria | 6366 |
| 104 | Ga0268265_10024843 | 3300028380 | Bacteria | 4245 |
| 105 | Ga0268264_10000018 | 3300028381 | Bacteria | 495324 |
| 106 | Ga0268264_10000226 | 3300028381 | Bacteria | 109817 |
| 107 | Ga0268264_10002475 | 3300028381 | Bacteria | 16228 |
| 108 | Ga0265322_10000151 | 3300028654 | Bacteria | 31679 |
| 109 | Ga0265322_10008828 | 3300028654 | Bacteria | 2931 |
| 110 | Ga0265338_10018226 | 3300028800 | Bacteria | 7525 |
| 111 | Ga0265324_10000020 | 3300029957 | Bacteria | 172436 |
| 112 | Ga0265332_10018994 | 3300031238 | Bacteria | 3034 |
| 113 | Ga0265339_10000009 | 3300031249 | Bacteria | 221449 |
| 114 | Ga0265316_10000116 | 3300031344 | Bacteria | 86833 |
| 115 | Ga0265316_10000576 | 3300031344 | Bacteria | 41017 |
| 116 | Ga0265316_10001473 | 3300031344 | Bacteria | 25220 |
| 117 | Ga0265316_10002138 | 3300031344 | Bacteria | 20777 |
| 118 | Ga0265316_10002754 | 3300031344 | Bacteria | 18010 |
| 119 | Ga0265316_10025648 | 3300031344 | Bacteria | 4916 |
| 120 | Ga0265316_10037015 | 3300031344 | Bacteria | 3943 |
| 121 | Ga0265313_10004090 | 3300031595 | Bacteria | 11356 |
| 122 | Ga0265314_10002244 | 3300031711 | Bacteria | 20023 |
| 123 | Ga0265342_10000040 | 3300031712 | Bacteria | 139906 |
| 124 | Ga0265342_10000985 | 3300031712 | Bacteria | 28059 |
| 125 | Ga0316578_10000620 | 3300031728 | Bacteria | 12476 |
| 126 | Ga0316577_10003554 | 3300031733 | Bacteria | 7894 |
| 127 | Ga0316577_10024257 | 3300031733 | Bacteria | 3371 |
| 128 | Ga0316587_1001023 | 3300033529 | Bacteria | 3245 |
| 129 | Ga0373927_0005137 | 3300035695 | Bacteria | 9058 |
| 130 | Ga0373927_0013023 | 3300035695 | Bacteria | 5532 |
| 131 | Ga0373947_0010620 | 3300035725 | Bacteria | 5283 |
| 132 | Ga0316584_0000519 | 3300036712 | Bacteria | 20482 |
| 133 | Ga0316584_0000812 | 3300036712 | Bacteria | 17588 |
| 134 | Ga0451577_0000049 | 3300042876 | Bacteria | 304750 |
| 135 | Ga0453683_0002875 | 3300044673 | Bacteria | 13028 |
| 136 | Ga0453684_0000049 | 3300044712 | Bacteria | 559289 |
| 137 | Ga0453684_0000156 | 3300044712 | Bacteria | 304753 |
| 138 | Ga0453684_0000307 | 3300044712 | Bacteria | 207314 |
| 139 | Ga0453684_0001159 | 3300044712 | Bacteria | 82240 |
| 140 | Ga0453684_0002804 | 3300044712 | Bacteria | 41206 |
| 141 | Ga0453684_0025298 | 3300044712 | Bacteria | 8625 |
| 142 | Ga0453684_0029189 | 3300044712 | Bacteria | 7844 |
| 143 | Ga0451576_0002928 | 3300045051 | Bacteria | 24282 |
| 144 | Ga0451576_0003912 | 3300045051 | Bacteria | 19894 |
| 145 | Ga0451576_0005490 | 3300045051 | Bacteria | 15869 |
| 146 | Ga0451576_0055875 | 3300045051 | Bacteria | 4129 |
| 147 | Ga0495580_0007417 | 3300046472 | Bacteria | 8819 |
| 148 | Ga0495610_0003946 | 3300046512 | Bacteria | 11235 |
| 149 | Ga0495643_0000199 | 3300046522 | Bacteria | 93741 |
| 150 | Ga0495643_0014805 | 3300046522 | Bacteria | 4631 |
| 151 | Ga0495615_0000079 | 3300048090 | Bacteria | 29318 |
| 152 | Ga0496105_0062638 | 3300048908 | Bacteria | 3069 |
| 153 | Ga0496107_0005195 | 3300048910 | Bacteria | 8897 |
| 154 | Ga0496116_0000060 | 3300048919 | Bacteria | 272219 |
| 155 | Ga0496121_0001098 | 3300048924 | Bacteria | 47733 |
| 156 | Ga0496122_0001106 | 3300048925 | Bacteria | 46592 |
| 157 | Ga0496123_0001757 | 3300048926 | Bacteria | 28598 |
| 158 | Ga0496124_0002938 | 3300048927 | Bacteria | 21440 |
| 159 | Ga0496124_0010817 | 3300048927 | Bacteria | 9189 |
| 160 | Ga0496125_0008290 | 3300048928 | Bacteria | 10915 |
| 161 | Ga0496126_0001633 | 3300048929 | Bacteria | 33895 |
| 162 | Ga0496126_0003145 | 3300048929 | Bacteria | 21275 |
| 163 | Ga0501034_0095767 | 3300049571 | Bacteria | 2965 |
| 164 | nmdc:mga03683_18_c1 | 3300050489 | Bacteria | 86681 |
| 165 | nmdc:mga00v17_5183_c1 | 3300050491 | Bacteria | 6856 |
| 166 | nmdc:mga00v17_8478_c1 | 3300050491 | Bacteria | 5532 |
| 167 | nmdc:mga0k408_145_c1 | 3300050493 | Bacteria | 36258 |
| 168 | nmdc:mga07m45_226_c1 | 3300050496 | Bacteria | 14972 |
| 169 | nmdc:mga07m45_8_c1 | 3300050496 | Bacteria | 214050 |
| 170 | nmdc:mga09592_3689_c1 | 3300050508 | Bacteria | 12345 |
| 171 | nmdc:mga06r32_138393_c1 | 3300050510 | Bacteria | 2409 |
| 172 | nmdc:mga0sz30_4692_c1 | 3300050516 | Bacteria | 4960 |
| 173 | nmdc:mga0sz30_742_c1 | 3300050516 | Bacteria | 11923 |
| 174 | Ga0495595_0014867 | 3300053084 | Bacteria | 3309 |
| 175 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 176 | Ga0500622_0000495 | 3300053156 | Bacteria | 36800 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050510 | nmdc:mga06r32_138393_c1 | nmdc:mga06r32_138393_c1_63_2381 | 742 |
| 2 | 3300014745 | Ga0157377_10009571 | Ga0157377_100095711 | 782 |
| 3 | 3300053084 | Ga0495595_0014867 | Ga0495595_0014867_323_2860 | 815 |
| 4 | 3300036712 | Ga0316584_0000519 | Ga0316584_0000519_8981_11692 | 838 |
| 5 | 3300009093 | Ga0105240_10000340 | Ga0105240_1000034072 | 845 |
| 6 | 3300009545 | Ga0105237_10003370 | Ga0105237_1000337015 | 845 |
| 7 | 3300025913 | Ga0207695_10020732 | Ga0207695_100207322 | 845 |
| 8 | 3300031344 | Ga0265316_10000576 | Ga0265316_1000057615 | 845 |
| 9 | 3300006048 | Ga0075363_100008139 | Ga0075363_1000081393 | 847 |
| 10 | 3300006177 | Ga0075362_10000007 | Ga0075362_10000007105 | 847 |
| 11 | 3300006195 | Ga0075366_10000068 | Ga0075366_1000006834 | 847 |
| 12 | 3300006353 | Ga0075370_10003235 | Ga0075370_100032353 | 847 |
| 13 | 3300050489 | nmdc:mga03683_18_c1 | nmdc:mga03683_18_c1_18928_21588 | 847 |
| 14 | 3300050493 | nmdc:mga0k408_145_c1 | nmdc:mga0k408_145_c1_13586_16246 | 847 |
| 15 | 3300050496 | nmdc:mga07m45_8_c1 | nmdc:mga07m45_8_c1_96383_99043 | 847 |
| 16 | 3300050516 | nmdc:mga0sz30_742_c1 | nmdc:mga0sz30_742_c1_6243_8903 | 847 |
| 17 | 3300050496 | nmdc:mga07m45_226_c1 | nmdc:mga07m45_226_c1_7381_10083 | 849 |
| 18 | 3300025298 | Ga0209050_1000215 | Ga0209050_100021581 | 851 |
| 19 | 3300046512 | Ga0495610_0003946 | Ga0495610_0003946_1832_4495 | 851 |
| 20 | 3300046522 | Ga0495643_0000199 | Ga0495643_0000199_42871_45534 | 851 |
| 21 | 3300031344 | Ga0265316_10000116 | Ga0265316_1000011641 | 854 |
| 22 | 3300031712 | Ga0265342_10000985 | Ga0265342_100009859 | 854 |
| 23 | 3300031344 | Ga0265316_10002754 | Ga0265316_100027542 | 856 |
| 24 | 3300031344 | Ga0265316_10037015 | Ga0265316_100370152 | 856 |
| 25 | 3300028654 | Ga0265322_10000151 | Ga0265322_100001516 | 857 |
| 26 | 3300028800 | Ga0265338_10018226 | Ga0265338_100182265 | 857 |
| 27 | 3300031344 | Ga0265316_10002138 | Ga0265316_100021386 | 857 |
| 28 | 3300031344 | Ga0265316_10025648 | Ga0265316_100256483 | 861 |
| 29 | 3300005563 | Ga0068855_100077120 | Ga0068855_1000771202 | 864 |
| 30 | 3300005843 | Ga0068860_100004874 | Ga0068860_10000487414 | 864 |
| 31 | 3300006051 | Ga0075364_10029683 | Ga0075364_100296832 | 864 |
| 32 | 3300028381 | Ga0268264_10000226 | Ga0268264_1000022657 | 864 |
| 33 | 3300031733 | Ga0316577_10024257 | Ga0316577_100242571 | 864 |
| 34 | 3300050491 | nmdc:mga00v17_5183_c1 | nmdc:mga00v17_5183_c1_304_2970 | 864 |
| 35 | 3300045051 | Ga0451576_0003912 | Ga0451576_0003912_9815_12553 | 865 |
| 36 | 3300045051 | Ga0451576_0055875 | Ga0451576_0055875_1238_3964 | 865 |
| 37 | iso_pu_bacteria | 8002317523 | 8002324654 | 866 |
| 38 | iso_pu_bacteria | 8046991243 | 8046994974 | 866 |
| 39 | 3300044712 | Ga0453684_0000049 | Ga0453684_0000049_56878_59616 | 868 |
| 40 | 3300049571 | Ga0501034_0095767 | Ga0501034_0095767_52_2685 | 868 |
| 41 | iso_pu_bacteria | 2925326138 | 2925331560 | 868 |
| 42 | 3300005347 | Ga0070668_100000028 | Ga0070668_10000002817 | 869 |
| 43 | 3300005355 | Ga0070671_100000750 | Ga0070671_1000007507 | 869 |
| 44 | 3300005841 | Ga0068863_100000092 | Ga0068863_10000009296 | 869 |
| 45 | 3300025931 | Ga0207644_10000094 | Ga0207644_1000009451 | 869 |
| 46 | 3300025972 | Ga0207668_10001023 | Ga0207668_100010234 | 869 |
| 47 | 3300026088 | Ga0207641_10000004 | Ga0207641_10000004395 | 869 |
| 48 | 3300028381 | Ga0268264_10002475 | Ga0268264_1000247514 | 869 |
| 49 | 3300005335 | Ga0070666_10017731 | Ga0070666_100177312 | 871 |
| 50 | 3300005539 | Ga0068853_100062973 | Ga0068853_1000629732 | 871 |
| 51 | 3300005563 | Ga0068855_100003628 | Ga0068855_10000362813 | 871 |
| 52 | 3300005577 | Ga0068857_100055325 | Ga0068857_1000553252 | 871 |
| 53 | 3300005842 | Ga0068858_100003069 | Ga0068858_10000306910 | 871 |
| 54 | 3300005843 | Ga0068860_100033603 | Ga0068860_1000336032 | 871 |
| 55 | 3300006237 | Ga0097621_100024824 | Ga0097621_1000248241 | 871 |
| 56 | 3300006881 | Ga0068865_100036042 | Ga0068865_1000360421 | 871 |
| 57 | 3300009093 | Ga0105240_10002643 | Ga0105240_1000264310 | 871 |
| 58 | 3300009093 | Ga0105240_10004075 | Ga0105240_100040752 | 871 |
| 59 | 3300009093 | Ga0105240_10070942 | Ga0105240_100709422 | 871 |
| 60 | 3300009174 | Ga0105241_10026586 | Ga0105241_100265862 | 871 |
| 61 | 3300009176 | Ga0105242_10011894 | Ga0105242_100118943 | 871 |
| 62 | 3300009177 | Ga0105248_10068421 | Ga0105248_100684212 | 871 |
| 63 | 3300009551 | Ga0105238_10006075 | Ga0105238_1000607510 | 871 |
| 64 | 3300009551 | Ga0105238_10009964 | Ga0105238_100099646 | 871 |
| 65 | 3300013104 | Ga0157370_10000990 | Ga0157370_1000099019 | 871 |
| 66 | 3300013104 | Ga0157370_10002370 | Ga0157370_1000237011 | 871 |
| 67 | 3300013105 | Ga0157369_10013920 | Ga0157369_100139202 | 871 |
| 68 | 3300013306 | Ga0163162_10005976 | Ga0163162_100059766 | 871 |
| 69 | 3300014325 | Ga0163163_10002407 | Ga0163163_100024078 | 871 |
| 70 | 3300025913 | Ga0207695_10002726 | Ga0207695_100027266 | 871 |
| 71 | 3300025913 | Ga0207695_10030059 | Ga0207695_100300593 | 871 |
| 72 | 3300025919 | Ga0207657_10003237 | Ga0207657_1000323710 | 871 |
| 73 | 3300025924 | Ga0207694_10003355 | Ga0207694_100033552 | 871 |
| 74 | 3300025924 | Ga0207694_10011999 | Ga0207694_100119993 | 871 |
| 75 | 3300025927 | Ga0207687_10001907 | Ga0207687_1000190712 | 871 |
| 76 | 3300025941 | Ga0207711_10000752 | Ga0207711_100007523 | 871 |
| 77 | 3300025949 | Ga0207667_10002812 | Ga0207667_1000281215 | 871 |
| 78 | 3300025949 | Ga0207667_10055853 | Ga0207667_100558532 | 871 |
| 79 | 3300025961 | Ga0207712_10012714 | Ga0207712_100127142 | 871 |
| 80 | 3300026035 | Ga0207703_10009931 | Ga0207703_100099312 | 871 |
| 81 | 3300026078 | Ga0207702_10048660 | Ga0207702_100486602 | 871 |
| 82 | 3300026088 | Ga0207641_10006685 | Ga0207641_100066852 | 871 |
| 83 | 3300026116 | Ga0207674_10025981 | Ga0207674_100259814 | 871 |
| 84 | 3300031711 | Ga0265314_10002244 | Ga0265314_100022442 | 871 |
| 85 | 3300035695 | Ga0373927_0005137 | Ga0373927_0005137_2811_5546 | 871 |
| 86 | 3300035695 | Ga0373927_0013023 | Ga0373927_0013023_1819_4557 | 871 |
| 87 | 3300035725 | Ga0373947_0010620 | Ga0373947_0010620_322_3057 | 871 |
| 88 | 3300046472 | Ga0495580_0007417 | Ga0495580_0007417_3472_6207 | 871 |
| 89 | 3300029957 | Ga0265324_10000020 | Ga0265324_1000002052 | 874 |
| 90 | 3300031249 | Ga0265339_10000009 | Ga0265339_10000009179 | 874 |
| 91 | 3300031595 | Ga0265313_10004090 | Ga0265313_100040905 | 874 |
| 92 | 3300005535 | Ga0070684_100019244 | Ga0070684_1000192444 | 875 |
| 93 | 3300005564 | Ga0070664_100016465 | Ga0070664_1000164654 | 875 |
| 94 | 3300025944 | Ga0207661_10014341 | Ga0207661_100143412 | 875 |
| 95 | 3300025945 | Ga0207679_10007110 | Ga0207679_100071104 | 875 |
| 96 | 3300005434 | Ga0070709_10000072 | Ga0070709_1000007259 | 876 |
| 97 | 3300025906 | Ga0207699_10000076 | Ga0207699_100000763 | 876 |
| 98 | 3300031728 | Ga0316578_10000620 | Ga0316578_100006204 | 876 |
| 99 | 3300031733 | Ga0316577_10003554 | Ga0316577_100035542 | 876 |
| 100 | 3300036712 | Ga0316584_0000812 | Ga0316584_0000812_10549_13290 | 876 |
| 101 | 3300033529 | Ga0316587_1001023 | Ga0316587_10010232 | 880 |
| 102 | 3300042876 | Ga0451577_0000049 | Ga0451577_0000049_145858_148938 | 880 |
| 103 | 3300044673 | Ga0453683_0002875 | Ga0453683_0002875_245_3325 | 880 |
| 104 | 3300044712 | Ga0453684_0000156 | Ga0453684_0000156_155816_158896 | 880 |
| 105 | 3300044712 | Ga0453684_0000307 | Ga0453684_0000307_23225_26251 | 880 |
| 106 | 3300044712 | Ga0453684_0002804 | Ga0453684_0002804_29249_32278 | 880 |
| 107 | 3300045051 | Ga0451576_0002928 | Ga0451576_0002928_15795_18872 | 880 |
| 108 | 3300028654 | Ga0265322_10008828 | Ga0265322_100088281 | 881 |
| 109 | 3300031238 | Ga0265332_10018994 | Ga0265332_100189942 | 881 |
| 110 | 3300031344 | Ga0265316_10001473 | Ga0265316_100014733 | 881 |
| 111 | 3300031712 | Ga0265342_10000040 | Ga0265342_1000004039 | 881 |
| 112 | 3300044712 | Ga0453684_0025298 | Ga0453684_0025298_5143_7923 | 882 |
| 113 | 3300045051 | Ga0451576_0005490 | Ga0451576_0005490_6091_8871 | 882 |
| 114 | 3300044712 | Ga0453684_0001159 | Ga0453684_0001159_51500_54247 | 883 |
| 115 | iso_pu_bacteria | 2510917021 | 2511128735 | 883 |
| 116 | iso_pu_bacteria | 2818991438 | 2819550502 | 883 |
| 117 | iso_pu_bacteria | 2896253425 | 2896255175 | 883 |
| 118 | iso_pu_bacteria | 2919138771 | 2919139871 | 883 |
| 119 | 3300005290 | Ga0065712_10077367 | Ga0065712_100773672 | 884 |
| 120 | 3300005347 | Ga0070668_100014085 | Ga0070668_1000140853 | 884 |
| 121 | 3300005353 | Ga0070669_100041723 | Ga0070669_1000417232 | 884 |
| 122 | 3300005471 | Ga0070698_100014069 | Ga0070698_1000140693 | 884 |
| 123 | 3300005616 | Ga0068852_100002978 | Ga0068852_1000029788 | 884 |
| 124 | 3300005617 | Ga0068859_100005065 | Ga0068859_1000050655 | 884 |
| 125 | 3300005617 | Ga0068859_100014978 | Ga0068859_1000149783 | 884 |
| 126 | 3300005719 | Ga0068861_100003102 | Ga0068861_10000310210 | 884 |
| 127 | 3300005719 | Ga0068861_100017313 | Ga0068861_1000173132 | 884 |
| 128 | 3300005843 | Ga0068860_100003789 | Ga0068860_1000037895 | 884 |
| 129 | 3300006844 | Ga0075428_100062704 | Ga0075428_1000627042 | 884 |
| 130 | 3300006846 | Ga0075430_100016610 | Ga0075430_1000166102 | 884 |
| 131 | 3300006847 | Ga0075431_100026275 | Ga0075431_1000262752 | 884 |
| 132 | 3300006931 | Ga0097620_100005066 | Ga0097620_1000050665 | 884 |
| 133 | 3300006931 | Ga0097620_100014977 | Ga0097620_1000149775 | 884 |
| 134 | 3300009174 | Ga0105241_10048882 | Ga0105241_100488822 | 884 |
| 135 | 3300009553 | Ga0105249_10002039 | Ga0105249_100020393 | 884 |
| 136 | 3300009553 | Ga0105249_10023867 | Ga0105249_100238675 | 884 |
| 137 | 3300013102 | Ga0157371_10002753 | Ga0157371_1000275312 | 884 |
| 138 | 3300014326 | Ga0157380_10015067 | Ga0157380_100150675 | 884 |
| 139 | 3300025904 | Ga0207647_10000476 | Ga0207647_1000047613 | 884 |
| 140 | 3300025908 | Ga0207643_10023898 | Ga0207643_100238982 | 884 |
| 141 | 3300025913 | Ga0207695_10030772 | Ga0207695_100307723 | 884 |
| 142 | 3300026116 | Ga0207674_10017986 | Ga0207674_100179863 | 884 |
| 143 | 3300026118 | Ga0207675_100008711 | Ga0207675_1000087113 | 884 |
| 144 | 3300028380 | Ga0268265_10024843 | Ga0268265_100248432 | 884 |
| 145 | 3300044712 | Ga0453684_0029189 | Ga0453684_0029189_2691_5435 | 884 |
| 146 | 3300050508 | nmdc:mga09592_3689_c1 | nmdc:mga09592_3689_c1_3118_6021 | 884 |
| 147 | 3300005844 | Ga0068862_100030291 | Ga0068862_1000302912 | 885 |
| 148 | 3300009553 | Ga0105249_10002730 | Ga0105249_1000273014 | 885 |
| 149 | 3300025961 | Ga0207712_10019149 | Ga0207712_100191492 | 885 |
| 150 | 3300048919 | Ga0496116_0000060 | Ga0496116_0000060_36291_38969 | 885 |
| 151 | 3300048925 | Ga0496122_0001106 | Ga0496122_0001106_30441_33119 | 885 |
| 152 | 3300048927 | Ga0496124_0010817 | Ga0496124_0010817_5269_7947 | 885 |
| 153 | 3300048928 | Ga0496125_0008290 | Ga0496125_0008290_1418_4096 | 885 |
| 154 | 3300048929 | Ga0496126_0001633 | Ga0496126_0001633_8050_10728 | 885 |
| 155 | iso_pu_bacteria | 2818991438 | 2819552068 | 885 |
| 156 | 3300005330 | Ga0070690_100028186 | Ga0070690_1000281862 | 886 |
| 157 | 3300005353 | Ga0070669_100000666 | Ga0070669_1000006667 | 886 |
| 158 | 3300005355 | Ga0070671_100000052 | Ga0070671_1000000524 | 886 |
| 159 | 3300005548 | Ga0070665_100050680 | Ga0070665_1000506802 | 886 |
| 160 | 3300005841 | Ga0068863_100000116 | Ga0068863_10000011648 | 886 |
| 161 | 3300005843 | Ga0068860_100000192 | Ga0068860_10000019276 | 886 |
| 162 | 3300005844 | Ga0068862_100020274 | Ga0068862_1000202743 | 886 |
| 163 | 3300009177 | Ga0105248_10022584 | Ga0105248_100225845 | 886 |
| 164 | 3300025923 | Ga0207681_10001698 | Ga0207681_100016987 | 886 |
| 165 | 3300025931 | Ga0207644_10000003 | Ga0207644_10000003484 | 886 |
| 166 | 3300025986 | Ga0207658_10005674 | Ga0207658_100056741 | 886 |
| 167 | 3300026088 | Ga0207641_10000035 | Ga0207641_1000003534 | 886 |
| 168 | 3300028379 | Ga0268266_10016231 | Ga0268266_100162312 | 886 |
| 169 | 3300028381 | Ga0268264_10000018 | Ga0268264_1000001822 | 886 |
| 170 | 3300048908 | Ga0496105_0062638 | Ga0496105_0062638_145_2805 | 886 |
| 171 | 3300048910 | Ga0496107_0005195 | Ga0496107_0005195_5110_7770 | 886 |
| 172 | 3300048924 | Ga0496121_0001098 | Ga0496121_0001098_13576_16236 | 886 |
| 173 | 3300048929 | Ga0496126_0003145 | Ga0496126_0003145_12805_15516 | 886 |
| 174 | 2162886007 | SwRhRL2b_contig_3273488 | SwRhRL2b_0336.00004610 | 887 |
| 175 | 3300005289 | Ga0065704_10070144 | Ga0065704_10070144139 | 887 |
| 176 | 3300006186 | Ga0075369_10017279 | Ga0075369_100172792 | 887 |
| 177 | 3300046522 | Ga0495643_0014805 | Ga0495643_0014805_1518_4181 | 887 |
| 178 | 3300048090 | Ga0495615_0000079 | Ga0495615_0000079_23922_26585 | 887 |
| 179 | 3300048926 | Ga0496123_0001757 | Ga0496123_0001757_23253_25916 | 887 |
| 180 | 3300048927 | Ga0496124_0002938 | Ga0496124_0002938_9918_12584 | 887 |
| 181 | 3300050491 | nmdc:mga00v17_8478_c1 | nmdc:mga00v17_8478_c1_1564_4227 | 887 |
| 182 | 3300050516 | nmdc:mga0sz30_4692_c1 | nmdc:mga0sz30_4692_c1_2190_4853 | 887 |
| 183 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1373795_1376461 | 887 |
| 184 | 3300053156 | Ga0500622_0000495 | Ga0500622_0000495_5313_7982 | 887 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5jvl-assembly2.cif.gz_B | c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue | 0.9339 | 263 | 884 |
| 1vbg-assembly1.cif.gz_A-2 | pyruvate phosphate dikinase from maize | 0.9285 | 2 | 885 |
| 5jvl-assembly2.cif.gz_B | c4-type pyruvate phospate dikinase: nucleotide binding domain with bound atp analogue | 0.9269 | 263 | 884 |
| 1vbg-assembly1.cif.gz_A-2 | pyruvate phosphate dikinase from maize | 0.9265 | 2 | 885 |
| 2r82-assembly1.cif.gz_A-2 | pyruvate phosphate dikinase (ppdk) triple mutant r219e/e271r/s262d adapts a second conformational state | 0.9136 | 2 | 886 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1kc7A05 | Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; | 0.9935 | 116 | 203 | 1.20.80.30 |
| 2r82A02 | Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; | 0.9903 | 116 | 201 | 1.20.80.30 |
| 1dikA04 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9825 | 547 | 886 | 3.20.20.60 |
| 1buk005 | Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; | 0.9796 | 116 | 203 | 1.20.80.30 |
| 1kblA05 | Mainly Alpha;Up-down Bundle;Acyl-CoA Binding Protein; | 0.9774 | 116 | 203 | 1.20.80.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E0ULC6-F1-model_v4 | Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) | 1.001 | 758 | 886 |
GO:0006090
GO:0050242 |
| AF-A0A662REV5-F1-model_v4 | Pyruvate, phosphate dikinase (EC 2.7.9.1) | 1 | 756 | 886 |
GO:0006090
GO:0016301 GO:0050242 |
| AF-A0A349H8F9-F1-model_v4 | Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) | 0.9988 | 750 | 886 |
GO:0006090
GO:0016301 GO:0050242 |
| AF-A0A0P9DNR6-F1-model_v4 | Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) | 0.9982 | 751 | 886 |
GO:0006090
GO:0046872 GO:0050242 |
| AF-A0A7Y3GVR5-F1-model_v4 | Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) | 0.9981 | 754 | 886 |
GO:0006090
GO:0016301 GO:0050242 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar