F282981

General Info

Members Datasets Scaffolds Average Seq Length
184 103 368 291

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0562005|Ga0451853_0562005_278_1237
Length 319
Sequence MATTGPIDLLPQSPTRTRSALAPATPRVGHSRARRIATYVLFGLAILVIWESVKFVGGVPWRFQNVLGTDIDIEHFPPFRWAFASDLNLPHWWNILAALAAPVQRNAESSLAQFLVGAAFYTWREAVIGFIVGTLXXLLLATVFVHSRLAERAFVPYIVASQTIPIVALAPMIVFAFGPNVTSVVVIATYLTFFPVTIAMIRGLRAPDPRSLELMRSYAAGRWATYWKLRLPASMPYLFTALKIAATASIVGAIIGEGPGGIPNGLGRAIINFNQQYITGPEKLWAAILVASLLGVTFFVMIRALELVALRGRPGAAEG

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
6 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
59 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
60 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
61 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
62 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
63 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
64 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
65 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
66 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
67 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
68 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
69 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
70 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
71 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
72 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
73 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
74 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
75 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
76 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
77 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
78 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
79 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
80 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
81 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
82 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
83 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
84 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
85 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
86 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
87 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
88 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
89 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
90 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
91 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
92 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
93 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
96 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
97 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
98 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
99 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
100 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
101 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
102 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
103 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.35
Rhizosphere 94.57
Stem 0
Stem Tuber 0
Unclassified 2.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_0562005 3300041512 Bacteria 1372
2 Ga0070666_10207077 3300005335 Bacteria 1381
3 Ga0070680_100000129 3300005336 Bacteria 44971
4 Ga0070675_100448543 3300005354 Bacteria 1157
5 Ga0070705_100036173 3300005440 Bacteria 2774
6 Ga0070705_100042804 3300005440 Bacteria 2591
7 Ga0070705_100236465 3300005440 Bacteria 1274
8 Ga0070700_100094903 3300005441 Bacteria 1954
9 Ga0070700_100238725 3300005441 Bacteria 1298
10 Ga0070694_100047084 3300005444 Bacteria 2897
11 Ga0070708_100003004 3300005445 Bacteria 13102
12 Ga0070708_100008539 3300005445 Bacteria 8231
13 Ga0070708_100144175 3300005445 Bacteria 2211
14 Ga0070662_100153339 3300005457 Bacteria 1796
15 Ga0070706_100032558 3300005467 Bacteria 4808
16 Ga0070706_100134737 3300005467 Bacteria 2306
17 Ga0070707_100008634 3300005468 Bacteria 9456
18 Ga0070707_100025449 3300005468 Bacteria 5614
19 Ga0070707_100143218 3300005468 Bacteria 2326
20 Ga0070707_100663333 3300005468 Unclassified 1006
21 Ga0070698_100020952 3300005471 Bacteria 6851
22 Ga0070698_100422344 3300005471 Bacteria 1268
23 Ga0070698_100456536 3300005471 Unclassified 1213
24 Ga0070699_100057129 3300005518 Bacteria 3380
25 Ga0070684_100014758 3300005535 Bacteria 6339
26 Ga0070697_100030641 3300005536 Bacteria 4321
27 Ga0070697_100044992 3300005536 Bacteria 3576
28 Ga0070697_100190497 3300005536 Bacteria 1740
29 Ga0070686_100103844 3300005544 Bacteria 1924
30 Ga0070686_100111098 3300005544 Bacteria 1868
31 Ga0070695_100159991 3300005545 Bacteria 1580
32 Ga0070696_100001209 3300005546 Bacteria 16765
33 Ga0070696_100061554 3300005546 Bacteria 2626
34 Ga0070696_100074759 3300005546 Bacteria 2390
35 Ga0070696_100165441 3300005546 Bacteria 1632
36 Ga0070704_100063037 3300005549 Bacteria 2659
37 Ga0070704_100110466 3300005549 Bacteria 2091
38 Ga0068855_100317871 3300005563 Bacteria 1722
39 Ga0068855_100604628 3300005563 Bacteria 1182
40 Ga0070664_100225834 3300005564 Bacteria 1677
41 Ga0068857_100379841 3300005577 Unclassified 1312
42 Ga0068854_100522027 3300005578 Bacteria 1003
43 Ga0068856_100536791 3300005614 Bacteria 1191
44 Ga0070702_100056712 3300005615 Bacteria 2264
45 Ga0068859_100439525 3300005617 Bacteria 1401
46 Ga0068861_100253116 3300005719 Bacteria 1504
47 Ga0068861_100502134 3300005719 Bacteria 1097
48 Ga0068860_100104780 3300005843 Bacteria 2700
49 Ga0068862_100575846 3300005844 Bacteria 1078
50 Ga0075428_100000128 3300006844 Bacteria 65974
51 Ga0075431_100045570 3300006847 Bacteria 4521
52 Ga0075434_100047308 3300006871 Bacteria 4269
53 Ga0097620_100439533 3300006931 Bacteria 1401
54 Ga0111539_10046686 3300009094 Bacteria 5180
55 Ga0111539_10153554 3300009094 Bacteria 2694
56 Ga0111539_10273474 3300009094 Bacteria 1966
57 Ga0111539_10484674 3300009094 Bacteria 1440
58 Ga0111539_10642848 3300009094 Bacteria 1235
59 Ga0105245_10008568 3300009098 Bacteria 8922
60 Ga0114129_10124219 3300009147 Bacteria 3550
61 Ga0114129_10278849 3300009147 Bacteria 2234
62 Ga0105242_10292994 3300009176 Bacteria 1482
63 Ga0157378_10096672 3300013297 Bacteria 2691
64 Ga0163162_10370340 3300013306 Bacteria 1566
65 Ga0157375_10101798 3300013308 Bacteria 2956
66 Ga0157377_10077948 3300014745 Bacteria 1930
67 Ga0157377_10135761 3300014745 Bacteria 1507
68 Ga0157377_10322414 3300014745 Bacteria 1027
69 Ga0207680_10253075 3300025903 Bacteria 1217
70 Ga0207684_10022683 3300025910 Bacteria 5360
71 Ga0207660_10000001 3300025917 Bacteria 1034169
72 Ga0207660_10470886 3300025917 Bacteria 1017
73 Ga0207662_10009864 3300025918 Bacteria 5269
74 Ga0207646_10041673 3300025922 Bacteria 4126
75 Ga0207646_10239219 3300025922 Bacteria 1640
76 Ga0207659_10137590 3300025926 Bacteria 1892
77 Ga0207659_10382973 3300025926 Bacteria 1173
78 Ga0207706_10184814 3300025933 Bacteria 1830
79 Ga0207711_10077356 3300025941 Bacteria 2900
80 Ga0207640_10128872 3300025981 Bacteria 1826
81 Ga0207708_10213869 3300026075 Bacteria 1542
82 Ga0207708_10379132 3300026075 Bacteria 1166
83 Ga0207676_10163695 3300026095 Bacteria 1930
84 Ga0207674_10237530 3300026116 Bacteria 1770
85 Ga0207675_100036023 3300026118 Bacteria 4615
86 Ga0207675_100533115 3300026118 Bacteria 1172
87 Ga0207683_10088162 3300026121 Bacteria 2760
88 Ga0209974_10028504 3300027876 Bacteria 1849
89 Ga0268264_10034525 3300028381 Bacteria 4161
90 Ga0268264_10333903 3300028381 Bacteria 1437
91 Ga0265319_1004783 3300028563 Bacteria 6641
92 Ga0307409_100387403 3300031995 Bacteria 1331
93 Ga0436365_0441518 3300039437 Bacteria 1891
94 Ga0451789_0448316 3300041443 Bacteria 1288
95 Ga0453683_0070627 3300044673 Bacteria 2184
96 Ga0495666_0140159 3300046526 Unclassified 1128
97 Ga0495634_0138338 3300046642 Bacteria 1548
98 Ga0496106_0241326 3300048909 Bacteria 1444
99 Ga0496108_0068917 3300048911 Bacteria 2985
100 Ga0496109_0086846 3300048912 Bacteria 2889
101 Ga0496109_0123937 3300048912 Bacteria 2408
102 Ga0496109_0345906 3300048912 Bacteria 1404
103 Ga0496112_0000012 3300048915 Bacteria 243643
104 Ga0496112_0192251 3300048915 Bacteria 2002
105 Ga0501031_0042921 3300049568 Bacteria 2952
106 Ga0501032_0028541 3300049569 Bacteria 3834
107 Ga0501032_0183637 3300049569 Bacteria 1369
108 Ga0501036_0030503 3300049572 Bacteria 4553
109 Ga0501036_0241061 3300049572 Bacteria 1516
110 Ga0501037_0278380 3300049573 Bacteria 1166
111 Ga0501038_0019369 3300049574 Bacteria 6135
112 Ga0501038_0038271 3300049574 Bacteria 4201
113 Ga0501038_0309761 3300049574 Bacteria 1237
114 Ga0501039_0137731 3300049575 Bacteria 1917
115 Ga0501040_0037067 3300049576 Bacteria 3311
116 Ga0501040_0060974 3300049576 Bacteria 2593
117 Ga0501041_0024445 3300049577 Bacteria 3626
118 Ga0501041_0192917 3300049577 Bacteria 1276
119 Ga0501042_0006808 3300049578 Bacteria 7452
120 Ga0501042_0060763 3300049578 Bacteria 2699
121 Ga0501048_0001660 3300049582 Bacteria 16963
122 Ga0501048_0018290 3300049582 Bacteria 5155
123 Ga0501067_0003627 3300049583 Bacteria 8503
124 Ga0501067_0019543 3300049583 Bacteria 3752
125 Ga0501068_0011333 3300049584 Bacteria 5029
126 Ga0501068_0033780 3300049584 Bacteria 3048
127 Ga0501068_0095780 3300049584 Bacteria 1836
128 Ga0501069_0005162 3300049585 Bacteria 6781
129 Ga0501069_0006221 3300049585 Bacteria 6237
130 Ga0501069_0076628 3300049585 Bacteria 1880
131 Ga0501069_0111506 3300049585 Bacteria 1558
132 Ga0501069_0160488 3300049585 Bacteria 1294
133 Ga0501070_0079223 3300049586 Bacteria 2719
134 Ga0501070_0276086 3300049586 Bacteria 1372
135 Ga0501071_0003976 3300049587 Bacteria 9326
136 Ga0501071_0028280 3300049587 Bacteria 3950
137 Ga0501071_0204872 3300049587 Bacteria 1482
138 Ga0501072_0001010 3300049588 Bacteria 20824
139 Ga0501072_0025315 3300049588 Bacteria 4622
140 Ga0501072_0026541 3300049588 Bacteria 4516
141 Ga0501073_0172805 3300049589 Bacteria 1496
142 Ga0501074_0003891 3300049590 Bacteria 10643
143 Ga0501074_0046117 3300049590 Bacteria 3151
144 Ga0501075_0074088 3300049591 Bacteria 2575
145 Ga0501075_0080305 3300049591 Bacteria 2468
146 Ga0501075_0098969 3300049591 Bacteria 2214
147 Ga0501076_0016274 3300049592 Bacteria 5636
148 Ga0501076_0069034 3300049592 Bacteria 2824
149 Ga0501076_0071388 3300049592 Bacteria 2777
150 Ga0501077_0069263 3300049593 Bacteria 2236
151 Ga0501077_0128611 3300049593 Bacteria 1606
152 Ga0501079_0000452 3300049741 Bacteria 26865
153 Ga0501079_0125669 3300049741 Bacteria 1995
154 Ga0501079_0175470 3300049741 Bacteria 1671
155 Ga0501080_0015813 3300049742 Bacteria 6961
156 Ga0501080_0072097 3300049742 Bacteria 3214
157 Ga0501080_0308661 3300049742 Bacteria 1434
158 Ga0501081_0014114 3300049743 Bacteria 5264
159 Ga0501081_0015419 3300049743 Bacteria 5043
160 Ga0501081_0023156 3300049743 Bacteria 4162
161 Ga0501081_0097245 3300049743 Bacteria 2077
162 Ga0501083_0047646 3300049744 Bacteria 2896
163 Ga0501035_0474608 3300049822 Bacteria 1032
164 Ga0501045_0005976 3300049824 Bacteria 8423
165 Ga0501045_0123511 3300049824 Bacteria 1922
166 Ga0501045_0164829 3300049824 Bacteria 1650
167 nmdc:mga05p37_2037_c1 3300050507 Bacteria 23577
168 nmdc:mga05p37_355978_c1 3300050507 Bacteria 1722
169 nmdc:mga06r32_81554_c1 3300050510 Bacteria 3150
170 nmdc:mga08y16_102110_c1 3300050511 Bacteria 2985
171 nmdc:mga08y16_345345_c1 3300050511 Bacteria 1529
172 nmdc:mga08y16_445546_c1 3300050511 Bacteria 1321
173 nmdc:mga08y16_70661_c1 3300050511 Bacteria 3639
174 nmdc:mga0n895_263449_c1 3300050512 Bacteria 1749
175 nmdc:mga0n895_94214_c1 3300050512 Bacteria 2998
176 Ga0501084_0058412 3300054114 Bacteria 3227
177 Ga0501084_0098480 3300054114 Bacteria 2455
178 Ga0501084_0118638 3300054114 Bacteria 2224
179 Ga0590075_001894 3300059424 Bacteria 5079
180 Ga0501082_0155244 3300060353 Bacteria 1988
181 Ga0501082_0210277 3300060353 Bacteria 1692
182 Ga0530510_0009548 3300061734 Bacteria 6803
183 Ga0530510_0022476 3300061734 Bacteria 4493
184 Ga0530510_0073698 3300061734 Bacteria 2478
185 Ga0451853_0562005
186 Ga0070666_10207077
187 Ga0070680_100000129
188 Ga0070675_100448543
189 Ga0070705_100036173
190 Ga0070705_100042804
191 Ga0070705_100236465
192 Ga0070700_100094903
193 Ga0070700_100238725
194 Ga0070694_100047084
195 Ga0070708_100003004
196 Ga0070708_100008539
197 Ga0070708_100144175
198 Ga0070662_100153339
199 Ga0070706_100032558
200 Ga0070706_100134737
201 Ga0070707_100008634
202 Ga0070707_100025449
203 Ga0070707_100143218
204 Ga0070707_100663333
205 Ga0070698_100020952
206 Ga0070698_100422344
207 Ga0070698_100456536
208 Ga0070699_100057129
209 Ga0070684_100014758
210 Ga0070697_100030641
211 Ga0070697_100044992
212 Ga0070697_100190497
213 Ga0070686_100103844
214 Ga0070686_100111098
215 Ga0070695_100159991
216 Ga0070696_100001209
217 Ga0070696_100061554
218 Ga0070696_100074759
219 Ga0070696_100165441
220 Ga0070704_100063037
221 Ga0070704_100110466
222 Ga0068855_100317871
223 Ga0068855_100604628
224 Ga0070664_100225834
225 Ga0068857_100379841
226 Ga0068854_100522027
227 Ga0068856_100536791
228 Ga0070702_100056712
229 Ga0068859_100439525
230 Ga0068861_100253116
231 Ga0068861_100502134
232 Ga0068860_100104780
233 Ga0068862_100575846
234 Ga0075428_100000128
235 Ga0075431_100045570
236 Ga0075434_100047308
237 Ga0097620_100439533
238 Ga0111539_10046686
239 Ga0111539_10153554
240 Ga0111539_10273474
241 Ga0111539_10484674
242 Ga0111539_10642848
243 Ga0105245_10008568
244 Ga0114129_10124219
245 Ga0114129_10278849
246 Ga0105242_10292994
247 Ga0157378_10096672
248 Ga0163162_10370340
249 Ga0157375_10101798
250 Ga0157377_10077948
251 Ga0157377_10135761
252 Ga0157377_10322414
253 Ga0207680_10253075
254 Ga0207684_10022683
255 Ga0207660_10000001
256 Ga0207660_10470886
257 Ga0207662_10009864
258 Ga0207646_10041673
259 Ga0207646_10239219
260 Ga0207659_10137590
261 Ga0207659_10382973
262 Ga0207706_10184814
263 Ga0207711_10077356
264 Ga0207640_10128872
265 Ga0207708_10213869
266 Ga0207708_10379132
267 Ga0207676_10163695
268 Ga0207674_10237530
269 Ga0207675_100036023
270 Ga0207675_100533115
271 Ga0207683_10088162
272 Ga0209974_10028504
273 Ga0268264_10034525
274 Ga0268264_10333903
275 Ga0265319_1004783
276 Ga0307409_100387403
277 Ga0436365_0441518
278 Ga0451789_0448316
279 Ga0453683_0070627
280 Ga0495666_0140159
281 Ga0495634_0138338
282 Ga0496106_0241326
283 Ga0496108_0068917
284 Ga0496109_0086846
285 Ga0496109_0123937
286 Ga0496109_0345906
287 Ga0496112_0000012
288 Ga0496112_0192251
289 Ga0501031_0042921
290 Ga0501032_0028541
291 Ga0501032_0183637
292 Ga0501036_0030503
293 Ga0501036_0241061
294 Ga0501037_0278380
295 Ga0501038_0019369
296 Ga0501038_0038271
297 Ga0501038_0309761
298 Ga0501039_0137731
299 Ga0501040_0037067
300 Ga0501040_0060974
301 Ga0501041_0024445
302 Ga0501041_0192917
303 Ga0501042_0006808
304 Ga0501042_0060763
305 Ga0501048_0001660
306 Ga0501048_0018290
307 Ga0501067_0003627
308 Ga0501067_0019543
309 Ga0501068_0011333
310 Ga0501068_0033780
311 Ga0501068_0095780
312 Ga0501069_0005162
313 Ga0501069_0006221
314 Ga0501069_0076628
315 Ga0501069_0111506
316 Ga0501069_0160488
317 Ga0501070_0079223
318 Ga0501070_0276086
319 Ga0501071_0003976
320 Ga0501071_0028280
321 Ga0501071_0204872
322 Ga0501072_0001010
323 Ga0501072_0025315
324 Ga0501072_0026541
325 Ga0501073_0172805
326 Ga0501074_0003891
327 Ga0501074_0046117
328 Ga0501075_0074088
329 Ga0501075_0080305
330 Ga0501075_0098969
331 Ga0501076_0016274
332 Ga0501076_0069034
333 Ga0501076_0071388
334 Ga0501077_0069263
335 Ga0501077_0128611
336 Ga0501079_0000452
337 Ga0501079_0125669
338 Ga0501079_0175470
339 Ga0501080_0015813
340 Ga0501080_0072097
341 Ga0501080_0308661
342 Ga0501081_0014114
343 Ga0501081_0015419
344 Ga0501081_0023156
345 Ga0501081_0097245
346 Ga0501083_0047646
347 Ga0501035_0474608
348 Ga0501045_0005976
349 Ga0501045_0123511
350 Ga0501045_0164829
351 nmdc:mga05p37_2037_c1
352 nmdc:mga05p37_355978_c1
353 nmdc:mga06r32_81554_c1
354 nmdc:mga08y16_102110_c1
355 nmdc:mga08y16_345345_c1
356 nmdc:mga08y16_445546_c1
357 nmdc:mga08y16_70661_c1
358 nmdc:mga0n895_263449_c1
359 nmdc:mga0n895_94214_c1
360 Ga0501084_0058412
361 Ga0501084_0098480
362 Ga0501084_0118638
363 Ga0590075_001894
364 Ga0501082_0155244
365 Ga0501082_0210277
366 Ga0530510_0009548
367 Ga0530510_0022476
368 Ga0530510_0073698

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

126

307

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.9137 112 297
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.9093 112 296
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8963 108 296
7ahd-assembly1.cif.gz_A opua (e190q) occluded 0.8164 103 296
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8108 102 296
ID Description Score Start End Superfamily
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9323 104 296 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.932 106 296 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.927 100 296 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9184 104 302 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.918 100 296 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A535W0M3-F1-model_v4 ABC transporter permease subunit 0.9765 106 309 GO:0005886
GO:0055085
AF-C0EZ01-F1-model_v4 ABC transporter, permease protein 0.9748 105 302 GO:0005886
GO:0055085
AF-A0A2E3AYT2-F1-model_v4 Nitrate ABC transporter permease 0.9722 105 302 GO:0005886
GO:0055085
AF-A0A434VPK6-F1-model_v4 ABC transporter permease 0.9719 75 302 GO:0005886
GO:0055085
AF-A0A260IRF7-F1-model_v4 Nitrate ABC transporter permease 0.9715 105 301 GO:0005886
GO:0055085

Map