F282954

General Info

Members Datasets Scaffolds Average Seq Length
184 105 368 87

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0882823|Ga0436365_0882823_273_569
Length 98
Sequence MRQLATAGTRRVTRPRLVTGARLRYDEVREEHLLLVPEGAVRLNPTAVQVLELCDGERSVEEIVGVLSTRYDGADVGEDVRGLVEAMAQKGLLVDGSA

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
11 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
28 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
29 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
30 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
31 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
32 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
52 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
53 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
54 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
63 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
64 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
65 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
72 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
77 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
78 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
79 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
80 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
81 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
85 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
86 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
87 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
88 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
89 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
90 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
95 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
96 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
97 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
98 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
99 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
104 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
105 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 2.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.52
Rhizosphere 71.74
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0882823 3300039437 Bacteria 620
2 Ga0070682_100836785 3300005337 Bacteria 751
3 Ga0070709_10709695 3300005434 Bacteria 783
4 Ga0070714_100005711 3300005435 Bacteria 9533
5 Ga0070714_100857717 3300005435 Bacteria 881
6 Ga0070714_100983574 3300005435 Bacteria 821
7 Ga0070714_101971045 3300005435 Bacteria 570
8 Ga0070714_101990020 3300005435 Bacteria 567
9 Ga0070713_100033486 3300005436 Bacteria 4117
10 Ga0070713_100104095 3300005436 Bacteria 2464
11 Ga0070713_100451669 3300005436 Bacteria 1207
12 Ga0070713_101740297 3300005436 Unclassified 605
13 Ga0070710_11262563 3300005437 Bacteria 548
14 Ga0070711_100191285 3300005439 Bacteria 1573
15 Ga0070700_102026116 3300005441 Unclassified 500
16 Ga0070708_100493396 3300005445 Bacteria 1155
17 Ga0070663_100040522 3300005455 Bacteria 3261
18 Ga0070684_101340877 3300005535 Bacteria 673
19 Ga0070697_100240750 3300005536 Bacteria 1545
20 Ga0070696_100106403 3300005546 Bacteria 2016
21 Ga0070664_100347970 3300005564 Bacteria 1347
22 Ga0068857_100103330 3300005577 Bacteria 2558
23 Ga0068856_100326570 3300005614 Bacteria 1552
24 Ga0081455_10193457 3300005937 Bacteria 1530
25 Ga0081538_10041441 3300005981 Bacteria 2922
26 Ga0081538_10096105 3300005981 Bacteria 1511
27 Ga0070717_10006583 3300006028 Bacteria 8560
28 Ga0070717_10008229 3300006028 Bacteria 7788
29 Ga0070717_10088230 3300006028 Bacteria 2614
30 Ga0070717_11175923 3300006028 Bacteria 698
31 Ga0070716_100178028 3300006173 Bacteria 1394
32 Ga0070716_101067896 3300006173 Unclassified 642
33 Ga0070712_100242899 3300006175 Bacteria 1435
34 Ga0070712_100921751 3300006175 Bacteria 754
35 Ga0097621_101782952 3300006237 Bacteria 587
36 Ga0075434_101833408 3300006871 Unclassified 613
37 Ga0111539_11357446 3300009094 Bacteria 825
38 Ga0105245_10380078 3300009098 Bacteria 1406
39 Ga0105246_10137645 3300011119 Bacteria 1832
40 Ga0163163_10055697 3300014325 Bacteria 3908
41 Ga0197907_11205223 3300020069 Bacteria 1465
42 Ga0206350_11410591 3300020080 Bacteria 516
43 Ga0206354_10877886 3300020081 Bacteria 552
44 Ga0213873_10012353 3300021358 Bacteria 1850
45 Ga0213873_10028873 3300021358 Bacteria 1363
46 Ga0213873_10033103 3300021358 Bacteria 1295
47 Ga0213874_10021603 3300021377 Bacteria 1777
48 Ga0213874_10042338 3300021377 Bacteria 1367
49 Ga0213874_10045582 3300021377 Bacteria 1328
50 Ga0213874_10170286 3300021377 Bacteria 770
51 Ga0213876_10004253 3300021384 Bacteria 8027
52 Ga0213876_10025577 3300021384 Bacteria 3113
53 Ga0213876_10033692 3300021384 Bacteria 2700
54 Ga0213876_10182032 3300021384 Bacteria 1117
55 Ga0213876_10190871 3300021384 Bacteria 1089
56 Ga0213876_10194357 3300021384 Bacteria 1079
57 Ga0213876_10381064 3300021384 Bacteria 750
58 Ga0213876_10704918 3300021384 Bacteria 537
59 Ga0213875_10008974 3300021388 Bacteria 5090
60 Ga0213875_10025407 3300021388 Bacteria 2822
61 Ga0213875_10076403 3300021388 Bacteria 1563
62 Ga0213875_10231852 3300021388 Bacteria 870
63 Ga0213875_10376456 3300021388 Bacteria 676
64 Ga0224712_10369191 3300022467 Bacteria 680
65 Ga0207692_10092463 3300025898 Bacteria 1643
66 Ga0207699_10011056 3300025906 Bacteria 4548
67 Ga0207699_10933056 3300025906 Bacteria 641
68 Ga0207695_11766699 3300025913 Unclassified 500
69 Ga0207693_10000657 3300025915 Bacteria 31001
70 Ga0207693_10372581 3300025915 Unclassified 1117
71 Ga0207693_10988827 3300025915 Bacteria 643
72 Ga0207693_11066894 3300025915 Unclassified 615
73 Ga0207663_10098044 3300025916 Bacteria 1962
74 Ga0207663_10328352 3300025916 Bacteria 1152
75 Ga0207687_10370167 3300025927 Bacteria 1171
76 Ga0207700_10025022 3300025928 Bacteria 4140
77 Ga0207700_10346410 3300025928 Bacteria 1293
78 Ga0207700_10361315 3300025928 Bacteria 1266
79 Ga0207700_10761558 3300025928 Bacteria 865
80 Ga0207664_10028223 3300025929 Bacteria 4263
81 Ga0207664_10866226 3300025929 Bacteria 812
82 Ga0207664_11331841 3300025929 Bacteria 638
83 Ga0207664_11377440 3300025929 Bacteria 626
84 Ga0207664_11944447 3300025929 Unclassified 511
85 Ga0207644_10666224 3300025931 Bacteria 867
86 Ga0207665_10054955 3300025939 Bacteria 2685
87 Ga0207665_11215065 3300025939 Bacteria 601
88 Ga0207661_10040193 3300025944 Bacteria 3675
89 Ga0207679_10954507 3300025945 Bacteria 785
90 Ga0207678_10098259 3300026067 Bacteria 2501
91 Ga0207702_10644261 3300026078 Bacteria 1042
92 Ga0207702_10790668 3300026078 Bacteria 938
93 Ga0207674_10033398 3300026116 Bacteria 5387
94 Ga0307405_11009116 3300031731 Bacteria 710
95 Ga0307410_10020084 3300031852 Bacteria 4079
96 Ga0307407_10145072 3300031903 Bacteria 1536
97 Ga0307407_10504904 3300031903 Bacteria 887
98 Ga0307409_100096959 3300031995 Bacteria 2434
99 Ga0307416_100112035 3300032002 Bacteria 2407
100 Ga0307416_103439310 3300032002 Bacteria 530
101 Ga0307414_10620390 3300032004 Bacteria 972
102 Ga0307415_100269944 3300032126 Bacteria 1393
103 Ga0307415_101269706 3300032126 Bacteria 696
104 Ga0373925_0992132 3300037068 Bacteria 692
105 Ga0395900_0375501 3300037418 Bacteria 1391
106 Ga0395898_1399863 3300037466 Bacteria 627
107 Ga0436364_0171926 3300037853 Bacteria 1356
108 Ga0436364_0233629 3300037853 Bacteria 2404
109 Ga0436364_0276493 3300037853 Bacteria 6210
110 Ga0436364_0612863 3300037853 Bacteria 931
111 Ga0436364_0751774 3300037853 Bacteria 12115
112 Ga0436364_0997723 3300037853 Bacteria 2369
113 Ga0436364_1027295 3300037853 Bacteria 21751
114 Ga0436364_1542327 3300037853 Bacteria 2575
115 Ga0436365_0250149 3300039437 Bacteria 12865
116 Ga0436365_0427842 3300039437 Bacteria 7724
117 Ga0436365_0556685 3300039437 Bacteria 7702
118 Ga0436365_0815413 3300039437 Bacteria 2383
119 Ga0436365_0884167 3300039437 Bacteria 600
120 Ga0436365_0936576 3300039437 Bacteria 1487
121 Ga0436365_1328609 3300039437 Bacteria 20534
122 Ga0436365_1674624 3300039437 Bacteria 2789
123 Ga0436365_1809114 3300039437 Bacteria 1209
124 Ga0436363_0125467 3300039450 Bacteria 524
125 Ga0436363_0182670 3300039450 Bacteria 8848
126 Ga0436363_1241098 3300039450 Bacteria 2111
127 Ga0436363_1262880 3300039450 Unclassified 882
128 Ga0436363_1696205 3300039450 Bacteria 1023
129 Ga0436362_0343885 3300039453 Bacteria 2224
130 Ga0436362_0953908 3300039453 Bacteria 2072
131 Ga0436362_0997680 3300039453 Bacteria 2490
132 Ga0439460_0019534 3300042461 Bacteria 1836
133 Ga0439440_0131277 3300042993 Bacteria 705
134 Ga0466966_0064920 3300044684 Bacteria 2297
135 Ga0466963_0009457 3300044694 Bacteria 5870
136 Ga0466963_0082380 3300044694 Bacteria 2181
137 Ga0466964_0114693 3300044706 Bacteria 1206
138 Ga0466971_0033877 3300044719 Bacteria 2288
139 Ga0466968_0107935 3300044735 Bacteria 1249
140 Ga0466970_0312297 3300044765 Bacteria 888
141 Ga0466957_0202940 3300044842 Bacteria 1303
142 Ga0466959_0022264 3300045049 Bacteria 4683
143 Ga0466959_0212327 3300045049 Bacteria 1344
144 Ga0466959_0244714 3300045049 Bacteria 1238
145 Ga0466967_0000787 3300045976 Bacteria 16532
146 Ga0466967_0006114 3300045976 Bacteria 8468
147 Ga0466967_0261790 3300045976 Bacteria 1655
148 Ga0466967_0303730 3300045976 Bacteria 1536
149 Ga0466967_0316672 3300045976 Bacteria 1504
150 Ga0466967_2245154 3300045976 Bacteria 541
151 Ga0495629_0397344 3300046459 Bacteria 937
152 Ga0495641_0052965 3300046461 Bacteria 1848
153 Ga0495582_0633445 3300046473 Unclassified 619
154 Ga0495664_0396314 3300046477 Unclassified 829
155 Ga0495594_0785492 3300046499 Bacteria 537
156 Ga0495608_0952322 3300046511 Bacteria 500
157 Ga0495652_0330537 3300046529 Bacteria 1098
158 Ga0495640_0776343 3300046533 Bacteria 572
159 Ga0495668_0263485 3300046616 Bacteria 944
160 Ga0495635_0278291 3300046663 Bacteria 1124
161 Ga0495600_0258784 3300046809 Bacteria 1106
162 Ga0495604_0139328 3300047317 Bacteria 1735
163 Ga0495674_0286937 3300047319 Bacteria 1347
164 Ga0495680_0200262 3300047322 Bacteria 1433
165 Ga0495614_0279999 3300048089 Bacteria 768
166 Ga0496101_1067807 3300048904 Unclassified 634
167 Ga0496104_0020980 3300048907 Bacteria 5994
168 Ga0496106_1323249 3300048909 Bacteria 559
169 Ga0496108_0453050 3300048911 Bacteria 1121
170 Ga0496109_0056720 3300048912 Bacteria 3574
171 Ga0496109_1905894 3300048912 Bacteria 527
172 Ga0496110_1384097 3300048913 Bacteria 613
173 Ga0496110_1821651 3300048913 Bacteria 519
174 Ga0496112_0013264 3300048915 Bacteria 7607
175 Ga0496113_0175158 3300048916 Bacteria 1700
176 Ga0496113_0291511 3300048916 Bacteria 1306
177 Ga0496115_0617271 3300048918 Bacteria 860
178 Ga0501036_1278820 3300049572 Bacteria 597
179 Ga0501040_0989233 3300049576 Bacteria 610
180 Ga0501233_083698 3300049668 Bacteria 825
181 nmdc:mga0n895_2117381_c1 3300050512 Unclassified 519
182 nmdc:mga0rr50_1497513_c1 3300050513 Bacteria 570
183 Ga0501084_0444965 3300054114 Bacteria 1095
184 Ga0466962_0033982 3300061719 Bacteria 2440
185 Ga0436365_0882823
186 Ga0070682_100836785
187 Ga0070709_10709695
188 Ga0070714_100005711
189 Ga0070714_100857717
190 Ga0070714_100983574
191 Ga0070714_101971045
192 Ga0070714_101990020
193 Ga0070713_100033486
194 Ga0070713_100104095
195 Ga0070713_100451669
196 Ga0070713_101740297
197 Ga0070710_11262563
198 Ga0070711_100191285
199 Ga0070700_102026116
200 Ga0070708_100493396
201 Ga0070663_100040522
202 Ga0070684_101340877
203 Ga0070697_100240750
204 Ga0070696_100106403
205 Ga0070664_100347970
206 Ga0068857_100103330
207 Ga0068856_100326570
208 Ga0081455_10193457
209 Ga0081538_10041441
210 Ga0081538_10096105
211 Ga0070717_10006583
212 Ga0070717_10008229
213 Ga0070717_10088230
214 Ga0070717_11175923
215 Ga0070716_100178028
216 Ga0070716_101067896
217 Ga0070712_100242899
218 Ga0070712_100921751
219 Ga0097621_101782952
220 Ga0075434_101833408
221 Ga0111539_11357446
222 Ga0105245_10380078
223 Ga0105246_10137645
224 Ga0163163_10055697
225 Ga0197907_11205223
226 Ga0206350_11410591
227 Ga0206354_10877886
228 Ga0213873_10012353
229 Ga0213873_10028873
230 Ga0213873_10033103
231 Ga0213874_10021603
232 Ga0213874_10042338
233 Ga0213874_10045582
234 Ga0213874_10170286
235 Ga0213876_10004253
236 Ga0213876_10025577
237 Ga0213876_10033692
238 Ga0213876_10182032
239 Ga0213876_10190871
240 Ga0213876_10194357
241 Ga0213876_10381064
242 Ga0213876_10704918
243 Ga0213875_10008974
244 Ga0213875_10025407
245 Ga0213875_10076403
246 Ga0213875_10231852
247 Ga0213875_10376456
248 Ga0224712_10369191
249 Ga0207692_10092463
250 Ga0207699_10011056
251 Ga0207699_10933056
252 Ga0207695_11766699
253 Ga0207693_10000657
254 Ga0207693_10372581
255 Ga0207693_10988827
256 Ga0207693_11066894
257 Ga0207663_10098044
258 Ga0207663_10328352
259 Ga0207687_10370167
260 Ga0207700_10025022
261 Ga0207700_10346410
262 Ga0207700_10361315
263 Ga0207700_10761558
264 Ga0207664_10028223
265 Ga0207664_10866226
266 Ga0207664_11331841
267 Ga0207664_11377440
268 Ga0207664_11944447
269 Ga0207644_10666224
270 Ga0207665_10054955
271 Ga0207665_11215065
272 Ga0207661_10040193
273 Ga0207679_10954507
274 Ga0207678_10098259
275 Ga0207702_10644261
276 Ga0207702_10790668
277 Ga0207674_10033398
278 Ga0307405_11009116
279 Ga0307410_10020084
280 Ga0307407_10145072
281 Ga0307407_10504904
282 Ga0307409_100096959
283 Ga0307416_100112035
284 Ga0307416_103439310
285 Ga0307414_10620390
286 Ga0307415_100269944
287 Ga0307415_101269706
288 Ga0373925_0992132
289 Ga0395900_0375501
290 Ga0395898_1399863
291 Ga0436364_0171926
292 Ga0436364_0233629
293 Ga0436364_0276493
294 Ga0436364_0612863
295 Ga0436364_0751774
296 Ga0436364_0997723
297 Ga0436364_1027295
298 Ga0436364_1542327
299 Ga0436365_0250149
300 Ga0436365_0427842
301 Ga0436365_0556685
302 Ga0436365_0815413
303 Ga0436365_0884167
304 Ga0436365_0936576
305 Ga0436365_1328609
306 Ga0436365_1674624
307 Ga0436365_1809114
308 Ga0436363_0125467
309 Ga0436363_0182670
310 Ga0436363_1241098
311 Ga0436363_1262880
312 Ga0436363_1696205
313 Ga0436362_0343885
314 Ga0436362_0953908
315 Ga0436362_0997680
316 Ga0439460_0019534
317 Ga0439440_0131277
318 Ga0466966_0064920
319 Ga0466963_0009457
320 Ga0466963_0082380
321 Ga0466964_0114693
322 Ga0466971_0033877
323 Ga0466968_0107935
324 Ga0466970_0312297
325 Ga0466957_0202940
326 Ga0466959_0022264
327 Ga0466959_0212327
328 Ga0466959_0244714
329 Ga0466967_0000787
330 Ga0466967_0006114
331 Ga0466967_0261790
332 Ga0466967_0303730
333 Ga0466967_0316672
334 Ga0466967_2245154
335 Ga0495629_0397344
336 Ga0495641_0052965
337 Ga0495582_0633445
338 Ga0495664_0396314
339 Ga0495594_0785492
340 Ga0495608_0952322
341 Ga0495652_0330537
342 Ga0495640_0776343
343 Ga0495668_0263485
344 Ga0495635_0278291
345 Ga0495600_0258784
346 Ga0495604_0139328
347 Ga0495674_0286937
348 Ga0495680_0200262
349 Ga0495614_0279999
350 Ga0496101_1067807
351 Ga0496104_0020980
352 Ga0496106_1323249
353 Ga0496108_0453050
354 Ga0496109_0056720
355 Ga0496109_1905894
356 Ga0496110_1384097
357 Ga0496110_1821651
358 Ga0496112_0013264
359 Ga0496113_0175158
360 Ga0496113_0291511
361 Ga0496115_0617271
362 Ga0501036_1278820
363 Ga0501040_0989233
364 Ga0501233_083698
365 nmdc:mga0n895_2117381_c1
366 nmdc:mga0rr50_1497513_c1
367 Ga0501084_0444965
368 Ga0466962_0033982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05402

PqqD

Coenzyme PQQ synthesis protein D (PqqD)

31

93

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkr-assembly1.cif.gz_A crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.8438 2 82
5sxy-assembly1.cif.gz_A the solution nmr structure for the pqqd truncation of methylobacterium extorquens pqqcd representing a functional and stand-alone ribosomally synthesized and post-translational modified (ripp) recognition element (rre) 0.8364 4 82
8hkr-assembly1.cif.gz_B crystal structure of histone h3 lysine 79 (h3k79) methyltransferase rv2067c from mycobacterium tuberculosis 0.809 2 82
5v1u-assembly2.cif.gz_B tbib1 in complex with the tbia(beta) leader peptide 0.7917 5 83
6jx3-assembly1.cif.gz_B lasso peptide synthetase b1 complexed with the leader peptide 0.7804 3 83
ID Description Score Start End Superfamily
af_Q96JB1_1683_1822_1.20.58.1120 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Dynein motor heavy chain, linker domain, subdomain 4 0.8661 10 34 1.20.58.1120
af_P9WLL9_303_407_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8479 3 83 1.10.10.10
af_V6CJY2_717_933_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8413 10 34 3.90.70.10
af_A0A1D6HSL7_689_874_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.8387 10 35 3.90.70.10
af_Q18607_287_334_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8202 8 32 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A423PMZ6-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9722 4 83 GO:0018189
GO:0048038
AF-A0A2E0IVJ6-F1-model_v4 PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) 0.9719 2 83 GO:0018189
GO:0048038
AF-A0A847JEI3-F1-model_v4 Pyrroloquinoline quinone biosynthesis peptide chaperone PqqD 0.9693 2 82 GO:0018189
GO:0048038
AF-A0A1Q8KP49-F1-model_v4 Coenzyme PQQ synthesis protein D 0.969 2 83 GO:0018189
GO:0048038
AF-A0A1I6S3U1-F1-model_v4 Pyrroloquinoline quinone biosynthesis protein D 0.9689 2 83 GO:0018189
GO:0048038

Map