F282927

General Info

Members Datasets Scaffolds Average Seq Length
184 141 172 387

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0031566|Ga0395900_0031566_2397_3704
Length 435
Sequence MIAIFLDFKNYLKLNRTLNILLCLIPGPNLLTTIAGFYFKTVENDRGRLTISTMKKKILQKYSELFEGVPLIVRSPGRINVIGEHTDYNEGFVLPAAIDKAAYIAISLRDDEEIHLVAADLNEKFSISIKDLKPVGDISWPNFMLGAVEQYRKRNLFLKGFNAVLLSDVPVGAGLSSSAAIECAVTFALNELLQLNLDNITLVKMAQEAEHEYAGVMCGIMDQFASMMGKKDYVIKLDCRTLDYEYVPFKLDGIKILLLDTNVKHSLASSEYNARRQECEQAVTWIKEHEPKVHSLRDTTETMLDKYVLPKNKLIDKRARFIVQEIGRLQEACEDLKCDNIEAVGKKMYQTHHGLTGMYEVSCKELDFLVDFVTNNNSVIGARMMGGGFGGCTINLVKEEAVDELIEKIKPAYQNETGLKLDHYIVSPENGTKII

Samples

Sample ID Description Type Environment
1 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
2 2739367656 Pedobacter sp. CF523 Isolate Unclassified
3 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
4 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
5 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
6 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
7 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
8 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
9 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
10 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
11 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
12 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
66 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
67 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
106 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
119 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
123 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
135 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
136 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
137 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
140 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
141 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.93
Metatranscriptomes 0.54
Isolates 6.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.89
Nodule 0
Rhizoplane 0
Rhizosphere 84.78
Stem 0
Stem Tuber 0
Unclassified 10.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10027056 3300001979 Bacteria 1913
2 rootH2_10124076 3300003320 Bacteria 2238
3 rootH1_10134555 3300003323 Bacteria 7593
4 JGI25160J50197_1001238 3300003354 Bacteria 12967
5 Ga0055531_10000875 3300003794 Bacteria 24688
6 Ga0065714_10002200 3300005288 Bacteria 145275
7 Ga0065704_10071274 3300005289 Bacteria 12073
8 Ga0070658_10161482 3300005327 Bacteria 1880
9 Ga0070658_10182286 3300005327 Bacteria 1767
10 Ga0070676_10008945 3300005328 Bacteria 5416
11 Ga0070683_100014955 3300005329 Bacteria 6805
12 Ga0070683_100029843 3300005329 Bacteria 4943
13 Ga0068869_100059454 3300005334 Unclassified 2798
14 Ga0070682_100151614 3300005337 Bacteria 1591
15 Ga0070660_100001349 3300005339 Bacteria 16684
16 Ga0070660_100133578 3300005339 Bacteria 1987
17 Ga0070689_100167261 3300005340 Bacteria 1780
18 Ga0070661_100058704 3300005344 Bacteria 2820
19 Ga0070668_100240815 3300005347 Unclassified 1498
20 Ga0070675_100093898 3300005354 Unclassified 2516
21 Ga0070671_100101248 3300005355 Bacteria 2417
22 Ga0070674_100056169 3300005356 Unclassified 2729
23 Ga0070673_100005988 3300005364 Bacteria 7867
24 Ga0070659_100139667 3300005366 Bacteria 1972
25 Ga0070667_100050184 3300005367 Unclassified 3516
26 Ga0070667_100105322 3300005367 Unclassified 2441
27 Ga0070678_100024931 3300005456 Bacteria 4013
28 Ga0068867_100050676 3300005459 Bacteria 3061
29 Ga0070679_100002258 3300005530 Bacteria 17402
30 Ga0070679_100083461 3300005530 Bacteria 3184
31 Ga0070679_100345557 3300005530 Bacteria 1436
32 Ga0070684_100022315 3300005535 Bacteria 5278
33 Ga0068853_100024611 3300005539 Bacteria 5050
34 Ga0070672_100026793 3300005543 Unclassified 4295
35 Ga0070664_100004349 3300005564 Bacteria 11390
36 Ga0068852_100006389 3300005616 Bacteria 8514
37 Ga0068852_100039703 3300005616 Bacteria 3964
38 Ga0068852_100245863 3300005616 Bacteria 1712
39 Ga0068859_100058062 3300005617 Unclassified 3898
40 Ga0068861_100050017 3300005719 Bacteria 3168
41 Ga0068863_100035977 3300005841 Bacteria 4716
42 Ga0068860_100073323 3300005843 Bacteria 3254
43 Ga0097621_100014046 3300006237 Bacteria 5983
44 Ga0068865_100125776 3300006881 Unclassified 1913
45 Ga0097620_100058062 3300006931 Unclassified 3898
46 Ga0105240_10061789 3300009093 Bacteria 4667
47 Ga0105243_10000003 3300009148 Bacteria 712931
48 Ga0105241_10010284 3300009174 Bacteria 6872
49 Ga0105241_10078043 3300009174 Bacteria 2587
50 Ga0105241_10079376 3300009174 Unclassified 2566
51 Ga0105242_10024399 3300009176 Unclassified 4775
52 Ga0105242_10042271 3300009176 Unclassified 3679
53 Ga0105237_10017965 3300009545 Bacteria 7327
54 Ga0105239_10095445 3300010375 Bacteria 3285
55 Ga0105239_10266833 3300010375 Bacteria 1925
56 Ga0105246_10144507 3300011119 Unclassified 1793
57 Ga0157373_10009585 3300013100 Bacteria 7147
58 Ga0157371_10098992 3300013102 Bacteria 2068
59 Ga0157370_10002662 3300013104 Bacteria 21430
60 Ga0157369_10015994 3300013105 Bacteria 8443
61 Ga0157369_10180964 3300013105 Bacteria 2218
62 Ga0157374_10070515 3300013296 Bacteria 3294
63 Ga0157378_10023935 3300013297 Bacteria 5371
64 Ga0157372_10005797 3300013307 Bacteria 13153
65 Ga0157372_10013264 3300013307 Bacteria 8795
66 Ga0157372_10021688 3300013307 Bacteria 6943
67 Ga0157372_10078083 3300013307 Bacteria 3740
68 Ga0157372_10128923 3300013307 Bacteria 2909
69 Ga0157372_10172869 3300013307 Bacteria 2500
70 Ga0157376_10120311 3300014969 Unclassified 2326
71 Ga0182006_1000230 3300015261 Bacteria 53105
72 Ga0182005_1000098 3300015265 Bacteria 66185
73 Ga0183373_1001 3300015682 Bacteria 1410374
74 Ga0213876_10006255 3300021384 Bacteria 6494
75 Ga0213875_10009255 3300021388 Bacteria 4997
76 Ga0209436_104192 3300025208 Bacteria 3614
77 Ga0207426_1000026 3300025302 Bacteria 515228
78 Ga0207426_1022902 3300025302 Bacteria 2138
79 Ga0209257_1000001 3300025304 Bacteria 2274655
80 Ga0207647_10000057 3300025904 Bacteria 85211
81 Ga0207645_10001767 3300025907 Bacteria 17508
82 Ga0207654_10005052 3300025911 Bacteria 6658
83 Ga0207695_10003298 3300025913 Bacteria 22912
84 Ga0207657_10050388 3300025919 Bacteria 3624
85 Ga0207657_10100800 3300025919 Bacteria 2397
86 Ga0207652_10061846 3300025921 Bacteria 3234
87 Ga0207652_10099365 3300025921 Bacteria 2567
88 Ga0207650_10045159 3300025925 Bacteria 3241
89 Ga0207659_10089191 3300025926 Unclassified 2299
90 Ga0207644_10126655 3300025931 Bacteria 1950
91 Ga0207690_10010807 3300025932 Bacteria 5439
92 Ga0207706_10159908 3300025933 Unclassified 1980
93 Ga0207686_10146762 3300025934 Bacteria 1637
94 Ga0207709_10000008 3300025935 Bacteria 713099
95 Ga0207691_10021576 3300025940 Bacteria 6080
96 Ga0207689_10002619 3300025942 Bacteria 16651
97 Ga0207689_10009081 3300025942 Bacteria 8606
98 Ga0207689_10025460 3300025942 Bacteria 4958
99 Ga0207661_10006773 3300025944 Bacteria 8114
100 Ga0207661_10077352 3300025944 Bacteria 2736
101 Ga0207661_10246683 3300025944 Unclassified 1586
102 Ga0207679_10004046 3300025945 Bacteria 9107
103 Ga0207679_10045831 3300025945 Bacteria 3165
104 Ga0207667_10006165 3300025949 Bacteria 14561
105 Ga0207651_10013688 3300025960 Bacteria 4653
106 Ga0207658_10115427 3300025986 Unclassified 2131
107 Ga0207658_10116845 3300025986 Unclassified 2119
108 Ga0207639_10015251 3300026041 Bacteria 5416
109 Ga0207639_10030765 3300026041 Bacteria 3939
110 Ga0207641_10025953 3300026088 Bacteria 4834
111 Ga0207648_10005538 3300026089 Bacteria 12716
112 Ga0207648_10037616 3300026089 Bacteria 4264
113 Ga0207676_10127902 3300026095 Bacteria 2155
114 Ga0207675_100019768 3300026118 Bacteria 6287
115 Ga0207683_10003686 3300026121 Bacteria 13312
116 Ga0207698_10016358 3300026142 Bacteria 4996
117 Ga0207698_10110307 3300026142 Bacteria 2304
118 Ga0207698_10213596 3300026142 Bacteria 1737
119 Ga0207698_10357403 3300026142 Bacteria 1382
120 Ga0268266_10079258 3300028379 Unclassified 2859
121 Ga0265323_10032091 3300028653 Unclassified 1950
122 Ga0265323_10044614 3300028653 Bacteria 1596
123 Ga0265330_10003913 3300031235 Bacteria 7660
124 Ga0265316_10021179 3300031344 Bacteria 5515
125 Ga0265316_10042735 3300031344 Bacteria 3620
126 Ga0307509_10242990 3300031507 Bacteria 1591
127 Ga0307508_10000354 3300031616 Bacteria 55733
128 Ga0316576_10065180 3300031727 Bacteria 2677
129 Ga0307516_10151354 3300031730 Bacteria 2080
130 Ga0307405_10071148 3300031731 Bacteria 2237
131 Ga0316577_10004656 3300031733 Bacteria 7115
132 Ga0307414_10016230 3300032004 Bacteria 4522
133 Ga0307414_10017450 3300032004 Bacteria 4392
134 Ga0307414_10047007 3300032004 Bacteria 2967
135 Ga0307414_10190542 3300032004 Bacteria 1659
136 Ga0316583_10000601 3300032133 Bacteria 10934
137 Ga0316584_0004173 3300036712 Bacteria 9540
138 Ga0395900_0031566 3300037418 Bacteria 5445
139 Ga0395900_0211752 3300037418 Bacteria 1957
140 Ga0395900_0302562 3300037418 Unclassified 1585
141 Ga0395898_0009401 3300037466 Bacteria 10267
142 Ga0395905_0005291 3300037471 Bacteria 13198
143 Ga0395905_0016473 3300037471 Bacteria 7026
144 Ga0395905_0038367 3300037471 Bacteria 4495
145 Ga0436364_0592490 3300037853 Bacteria 6608
146 Ga0436365_1747829 3300039437 Bacteria 10905
147 Ga0439449_0003139 3300042007 Bacteria 6428
148 Ga0439449_0022361 3300042007 Bacteria 2368
149 Ga0439457_009160 3300042014 Bacteria 2310
150 Ga0453683_0171745 3300044673 Bacteria 1373
151 Ga0453684_0008748 3300044712 Bacteria 17983
152 Ga0453684_0441239 3300044712 Bacteria 1451
153 Ga0466959_0100993 3300045049 Unclassified 2065
154 Ga0495627_003772 3300046453 Bacteria 6544
155 Ga0495633_0000175 3300046558 Bacteria 83653
156 Ga0495686_0147162 3300047472 Bacteria 1386
157 Ga0496116_0004556 3300048919 Bacteria 13144
158 Ga0496117_0001367 3300048920 Bacteria 35566
159 Ga0496121_0000030 3300048924 Bacteria 412079
160 Ga0496122_0008801 3300048925 Bacteria 10786
161 Ga0496123_0012536 3300048926 Bacteria 7217
162 Ga0501034_0241691 3300049571 Bacteria 1751
163 Ga0501037_0127821 3300049573 Bacteria 1824
164 Ga0501039_0014470 3300049575 Bacteria 6040
165 Ga0501198_007917 3300049649 Bacteria 1535
166 Ga0501225_0006553 3300049705 Bacteria 3400
167 Ga0501241_003684 3300049758 Bacteria 2890
168 Ga0501044_0292819 3300049823 Bacteria 1559
169 nmdc:mga0k408_61095_c1 3300050493 Bacteria 2190
170 Ga0500588_0001534 3300053146 Bacteria 4433
171 Ga0500622_0005392 3300053156 Bacteria 7695
172 Ga0587098_005039 3300059604 Bacteria 1278

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042014 Ga0439457_009160 Ga0439457_009160_1283_2227 308
2 3300026142 Ga0207698_10357403 Ga0207698_103574031 343
3 3300005841 Ga0068863_100035977 Ga0068863_1000359775 352
4 3300026088 Ga0207641_10025953 Ga0207641_100259535 352
5 3300003323 rootH1_10134555 rootH1_101345555 354
6 3300037853 Ga0436364_0592490 Ga0436364_0592490_3250_4335 357
7 3300031730 Ga0307516_10151354 Ga0307516_101513542 376
8 3300031731 Ga0307405_10071148 Ga0307405_100711482 376
9 iso_pu_bacteria 2910245624 2910245777 378
10 3300005340 Ga0070689_100167261 Ga0070689_1001672612 379
11 3300044712 Ga0453684_0441239 Ga0453684_0441239_46_1191 379
12 iso_pu_bacteria 2721755487 2722730985 379
13 iso_pu_bacteria 2857627736 2857630674 379
14 iso_pu_bacteria 2896317667 2896321320 379
15 iso_pu_bacteria 2904780799 2904783478 379
16 iso_pu_bacteria 2919177583 2919181344 379
17 iso_pu_bacteria 2739367656 2739617733 380
18 iso_pu_bacteria 2818991442 2819573190 380
19 iso_pu_bacteria 2821136567 2821136609 380
20 iso_pu_bacteria 2896344016 2896344915 380
21 iso_pu_bacteria 2904467357 2904468646 380
22 iso_pu_bacteria 2911138879 2911140476 380
23 3300005339 Ga0070660_100001349 Ga0070660_1000013498 381
24 3300005355 Ga0070671_100101248 Ga0070671_1001012482 381
25 3300025931 Ga0207644_10126655 Ga0207644_101266552 381
26 3300031507 Ga0307509_10242990 Ga0307509_102429901 381
27 3300031616 Ga0307508_10000354 Ga0307508_1000035424 381
28 3300037466 Ga0395898_0009401 Ga0395898_0009401_6722_7870 381
29 3300005366 Ga0070659_100139667 Ga0070659_1001396672 382
30 3300013296 Ga0157374_10070515 Ga0157374_100705154 382
31 3300013307 Ga0157372_10013264 Ga0157372_100132644 382
32 3300013307 Ga0157372_10078083 Ga0157372_100780833 382
33 3300025919 Ga0207657_10100800 Ga0207657_101008003 382
34 3300005288 Ga0065714_10002200 Ga0065714_1000220098 383
35 3300005289 Ga0065704_10071274 Ga0065704_100712748 383
36 3300005337 Ga0070682_100151614 Ga0070682_1001516141 383
37 3300005616 Ga0068852_100245863 Ga0068852_1002458631 383
38 3300009148 Ga0105243_10000003 Ga0105243_10000003158 383
39 3300013104 Ga0157370_10002662 Ga0157370_100026628 383
40 3300013105 Ga0157369_10015994 Ga0157369_100159945 383
41 3300015261 Ga0182006_1000230 Ga0182006_100023016 383
42 3300015682 Ga0183373_1001 Ga0183373_10011116 383
43 3300021384 Ga0213876_10006255 Ga0213876_100062554 383
44 3300025935 Ga0207709_10000008 Ga0207709_10000008414 383
45 3300026142 Ga0207698_10213596 Ga0207698_102135961 383
46 3300032004 Ga0307414_10190542 Ga0307414_101905422 383
47 3300039437 Ga0436365_1747829 Ga0436365_1747829_483_1634 383
48 3300042007 Ga0439449_0003139 Ga0439449_0003139_3601_4770 383
49 3300048919 Ga0496116_0004556 Ga0496116_0004556_6406_7557 383
50 3300048920 Ga0496117_0001367 Ga0496117_0001367_667_1818 383
51 3300048925 Ga0496122_0008801 Ga0496122_0008801_809_1960 383
52 3300048926 Ga0496123_0012536 Ga0496123_0012536_5979_7130 383
53 3300053146 Ga0500588_0001534 Ga0500588_0001534_2707_3876 383
54 3300003320 rootH2_10124076 rootH2_101240762 384
55 3300003794 Ga0055531_10000875 Ga0055531_100008753 384
56 3300005530 Ga0070679_100345557 Ga0070679_1003455571 384
57 3300013307 Ga0157372_10021688 Ga0157372_100216883 384
58 3300015265 Ga0182005_1000098 Ga0182005_100009829 384
59 3300025208 Ga0209436_104192 Ga0209436_1041922 384
60 3300025302 Ga0207426_1022902 Ga0207426_10229022 384
61 3300025304 Ga0209257_1000001 Ga0209257_10000011852 384
62 3300025921 Ga0207652_10099365 Ga0207652_100993653 384
63 3300031344 Ga0265316_10042735 Ga0265316_100427353 384
64 3300032004 Ga0307414_10017450 Ga0307414_100174503 384
65 3300032133 Ga0316583_10000601 Ga0316583_100006013 384
66 3300042007 Ga0439449_0022361 Ga0439449_0022361_519_1691 384
67 3300046453 Ga0495627_003772 Ga0495627_003772_1063_2229 384
68 3300046558 Ga0495633_0000175 Ga0495633_0000175_28250_29416 384
69 3300048924 Ga0496121_0000030 Ga0496121_0000030_354504_355670 384
70 3300049758 Ga0501241_003684 Ga0501241_003684_816_1982 384
71 3300053156 Ga0500622_0005392 Ga0500622_0005392_1564_2730 384
72 3300005329 Ga0070683_100029843 Ga0070683_1000298434 385
73 3300013105 Ga0157369_10180964 Ga0157369_101809642 385
74 3300013297 Ga0157378_10023935 Ga0157378_100239354 385
75 3300025944 Ga0207661_10077352 Ga0207661_100773523 385
76 3300025945 Ga0207679_10045831 Ga0207679_100458313 385
77 3300028653 Ga0265323_10032091 Ga0265323_100320912 385
78 3300031235 Ga0265330_10003913 Ga0265330_100039136 385
79 3300031344 Ga0265316_10021179 Ga0265316_100211793 385
80 3300005327 Ga0070658_10161482 Ga0070658_101614821 386
81 3300049571 Ga0501034_0241691 Ga0501034_0241691_47_1210 386
82 3300049573 Ga0501037_0127821 Ga0501037_0127821_20_1183 386
83 3300049575 Ga0501039_0014470 Ga0501039_0014470_333_1496 386
84 3300049649 Ga0501198_007917 Ga0501198_007917_153_1313 386
85 3300049705 Ga0501225_0006553 Ga0501225_0006553_1640_2800 386
86 3300049823 Ga0501044_0292819 Ga0501044_0292819_59_1222 386
87 3300028653 Ga0265323_10044614 Ga0265323_100446142 387
88 3300037418 Ga0395900_0302562 Ga0395900_0302562_96_1265 387
89 3300037471 Ga0395905_0038367 Ga0395905_0038367_320_1489 387
90 3300005327 Ga0070658_10182286 Ga0070658_101822861 388
91 3300005328 Ga0070676_10008945 Ga0070676_100089452 388
92 3300005329 Ga0070683_100014955 Ga0070683_1000149555 388
93 3300005334 Ga0068869_100059454 Ga0068869_1000594542 388
94 3300005339 Ga0070660_100133578 Ga0070660_1001335782 388
95 3300005347 Ga0070668_100240815 Ga0070668_1002408152 388
96 3300005354 Ga0070675_100093898 Ga0070675_1000938982 388
97 3300005356 Ga0070674_100056169 Ga0070674_1000561693 388
98 3300005364 Ga0070673_100005988 Ga0070673_1000059883 388
99 3300005367 Ga0070667_100050184 Ga0070667_1000501842 388
100 3300005367 Ga0070667_100105322 Ga0070667_1001053223 388
101 3300005456 Ga0070678_100024931 Ga0070678_1000249313 388
102 3300005459 Ga0068867_100050676 Ga0068867_1000506762 388
103 3300005535 Ga0070684_100022315 Ga0070684_1000223152 388
104 3300005543 Ga0070672_100026793 Ga0070672_1000267933 388
105 3300005564 Ga0070664_100004349 Ga0070664_1000043497 388
106 3300005617 Ga0068859_100058062 Ga0068859_1000580623 388
107 3300005719 Ga0068861_100050017 Ga0068861_1000500171 388
108 3300005843 Ga0068860_100073323 Ga0068860_1000733233 388
109 3300006237 Ga0097621_100014046 Ga0097621_1000140464 388
110 3300006881 Ga0068865_100125776 Ga0068865_1001257762 388
111 3300006931 Ga0097620_100058062 Ga0097620_1000580623 388
112 3300009174 Ga0105241_10079376 Ga0105241_100793762 388
113 3300009176 Ga0105242_10024399 Ga0105242_100243995 388
114 3300009176 Ga0105242_10042271 Ga0105242_100422713 388
115 3300011119 Ga0105246_10144507 Ga0105246_101445072 388
116 3300013102 Ga0157371_10098992 Ga0157371_100989922 388
117 3300013307 Ga0157372_10128923 Ga0157372_101289231 388
118 3300013307 Ga0157372_10172869 Ga0157372_101728692 388
119 3300014969 Ga0157376_10120311 Ga0157376_101203112 388
120 3300025907 Ga0207645_10001767 Ga0207645_1000176710 388
121 3300025925 Ga0207650_10045159 Ga0207650_100451592 388
122 3300025926 Ga0207659_10089191 Ga0207659_100891911 388
123 3300025933 Ga0207706_10159908 Ga0207706_101599081 388
124 3300025934 Ga0207686_10146762 Ga0207686_101467621 388
125 3300025940 Ga0207691_10021576 Ga0207691_100215764 388
126 3300025942 Ga0207689_10002619 Ga0207689_100026198 388
127 3300025942 Ga0207689_10009081 Ga0207689_100090817 388
128 3300025942 Ga0207689_10025460 Ga0207689_100254602 388
129 3300025944 Ga0207661_10006773 Ga0207661_100067732 388
130 3300025944 Ga0207661_10246683 Ga0207661_102466832 388
131 3300025945 Ga0207679_10004046 Ga0207679_100040466 388
132 3300025960 Ga0207651_10013688 Ga0207651_100136882 388
133 3300025986 Ga0207658_10115427 Ga0207658_101154272 388
134 3300025986 Ga0207658_10116845 Ga0207658_101168452 388
135 3300026089 Ga0207648_10005538 Ga0207648_100055383 388
136 3300026089 Ga0207648_10037616 Ga0207648_100376162 388
137 3300026118 Ga0207675_100019768 Ga0207675_1000197684 388
138 3300026121 Ga0207683_10003686 Ga0207683_100036867 388
139 3300028379 Ga0268266_10079258 Ga0268266_100792582 388
140 3300044673 Ga0453683_0171745 Ga0453683_0171745_122_1288 388
141 3300044712 Ga0453684_0008748 Ga0453684_0008748_12737_13903 388
142 3300045049 Ga0466959_0100993 Ga0466959_0100993_484_1650 388
143 3300047472 Ga0495686_0147162 Ga0495686_0147162_19_1188 388
144 3300059604 Ga0587098_005039 Ga0587098_005039_16_1182 388
145 3300005344 Ga0070661_100058704 Ga0070661_1000587042 389
146 3300025904 Ga0207647_10000057 Ga0207647_1000005715 389
147 3300025932 Ga0207690_10010807 Ga0207690_100108072 389
148 3300032004 Ga0307414_10016230 Ga0307414_100162302 389
149 3300021388 Ga0213875_10009255 Ga0213875_100092552 390
150 3300031727 Ga0316576_10065180 Ga0316576_100651801 390
151 3300031733 Ga0316577_10004656 Ga0316577_100046565 390
152 3300037471 Ga0395905_0005291 Ga0395905_0005291_1929_3113 390
153 3300005530 Ga0070679_100083461 Ga0070679_1000834611 391
154 3300005616 Ga0068852_100039703 Ga0068852_1000397033 391
155 3300009093 Ga0105240_10061789 Ga0105240_100617894 391
156 3300009174 Ga0105241_10010284 Ga0105241_100102846 391
157 3300010375 Ga0105239_10266833 Ga0105239_102668333 391
158 3300013100 Ga0157373_10009585 Ga0157373_100095851 391
159 3300025911 Ga0207654_10005052 Ga0207654_100050527 391
160 3300025913 Ga0207695_10003298 Ga0207695_1000329813 391
161 3300025949 Ga0207667_10006165 Ga0207667_1000616512 391
162 3300026041 Ga0207639_10030765 Ga0207639_100307654 391
163 3300026142 Ga0207698_10110307 Ga0207698_101103072 391
164 3300032004 Ga0307414_10047007 Ga0307414_100470072 391
165 3300037418 Ga0395900_0211752 Ga0395900_0211752_433_1632 391
166 3300037471 Ga0395905_0016473 Ga0395905_0016473_3835_5034 391
167 3300005530 Ga0070679_100002258 Ga0070679_10000225820 392
168 3300005616 Ga0068852_100006389 Ga0068852_1000063897 392
169 3300013307 Ga0157372_10005797 Ga0157372_100057972 392
170 3300025919 Ga0207657_10050388 Ga0207657_100503882 392
171 3300025921 Ga0207652_10061846 Ga0207652_100618464 392
172 3300026142 Ga0207698_10016358 Ga0207698_100163583 392
173 3300005539 Ga0068853_100024611 Ga0068853_1000246113 393
174 3300026041 Ga0207639_10015251 Ga0207639_100152512 393
175 3300003354 JGI25160J50197_1001238 JGI25160J50197_10012389 394
176 3300025302 Ga0207426_1000026 Ga0207426_1000026157 394
177 3300036712 Ga0316584_0004173 Ga0316584_0004173_2513_3700 394
178 3300037418 Ga0395900_0031566 Ga0395900_0031566_2397_3704 394
179 3300001979 JGI24740J21852_10027056 JGI24740J21852_100270561 396
180 3300009174 Ga0105241_10078043 Ga0105241_100780432 396
181 3300009545 Ga0105237_10017965 Ga0105237_100179654 396
182 3300010375 Ga0105239_10095445 Ga0105239_100954452 396
183 3300026095 Ga0207676_10127902 Ga0207676_101279021 396
184 3300050493 nmdc:mga0k408_61095_c1 nmdc:mga0k408_61095_c1_524_1714 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10509

GalKase_gal_bdg

Galactokinase galactose-binding signature

60

108

0.96

PF00288

GHMP_kinases_N

GHMP kinases N terminal domain

142

230

0.94

PF08544

GHMP_kinases_C

GHMP kinases C terminal

329

415

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dej-assembly1.cif.gz_A crystal structure of galaktokinase from pyrococcus horikoshii with amp-pn and galactose 0.9597 31 392
2dei-assembly1.cif.gz_A crystal structure of galaktokinase from pyrococcus horikoshii with amp-pnp and galactose 0.9595 31 392
1s4e-assembly9.cif.gz_I pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.9583 30 392
1s4e-assembly4.cif.gz_D pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.9567 30 392
1s4e-assembly8.cif.gz_H pyrococcus furiosus galactokinase in complex with galactose, adp and magnesium 0.956 30 390
ID Description Score Start End Superfamily
af_P9WN63_1_186_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9593 30 211 3.30.230.10
1s4eE01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9564 31 207 3.30.230.10
1pieA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9483 28 207 3.30.230.10
1s4eE01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9457 31 207 3.30.230.10
af_P9WN63_1_186_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9343 30 211 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A4Q5WIG5-F1-model_v4 Galactokinase (EC 2.7.1.6) 0.9864 101 394 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A6V8NW77-F1-model_v4 Galactokinase 0.9858 30 183 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A4Q6BE21-F1-model_v4 Galactokinase 0.9849 130 335 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A7X9KQ30-F1-model_v4 Galactokinase 0.9826 252 392 GO:0004335
GO:0005524
GO:0005829
GO:0006012
AF-A0A7X8RQ76-F1-model_v4 Galactokinase (EC 2.7.1.6) 0.98 34 319 GO:0004335
GO:0005524
GO:0005829
GO:0006012

Feature Viewer

pLDDT pTM Quality
91.84 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map